Query         psy124
Match_columns 60
No_of_seqs    114 out of 1132
Neff          5.3 
Searched_HMMs 29240
Date          Fri Aug 16 18:15:00 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy124.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/124hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1c17_M ATP synthase subunit A;  99.7 5.2E-18 1.8E-22  111.0   3.2   48    2-50     87-134 (177)
  2 3ebb_A Phospholipase A2-activa  17.6      76  0.0026   21.4   2.3   18   27-44    165-182 (304)
  3 3gae_A Protein DOA1; UFD3, CDC  16.1      51  0.0017   21.6   1.1   14   28-41    108-121 (253)
  4 3l3f_X Protein DOA1, DOA1/UFD3  11.7      78  0.0027   22.2   1.1   14   29-42    218-231 (362)
  5 3pst_A Protein DOA1; protein d  10.3      93  0.0032   22.5   1.1   14   29-42    281-294 (425)
  6 2knc_A Integrin alpha-IIB; tra   8.1 2.9E+02  0.0098   14.4   3.3   20   37-56     19-38  (54)
  7 2bec_B Sodium/hydrogen exchang   6.4 2.4E+02  0.0083   13.7   1.4   11   30-40     21-31  (43)
  8 3h2d_A CHEC-like superfamily p   6.4   3E+02    0.01   16.3   2.1   17   30-46     89-105 (155)
  9 2l8s_A Integrin alpha-1; trans   6.3 3.7E+02   0.013   14.0   3.3   19   38-56     17-35  (54)
 10 3hm4_A Chemotaxis protein CHEX   6.3 3.1E+02   0.011   16.2   2.1   17   30-46     91-107 (156)

No 1  
>1c17_M ATP synthase subunit A; membrane protein, helix, complex; NMR {Escherichia coli} SCOP: f.18.1.1
Probab=99.70  E-value=5.2e-18  Score=111.01  Aligned_cols=48  Identities=23%  Similarity=0.305  Sum_probs=28.6

Q ss_pred             CCCCCchHHHHHHHHHHHHHHHHHHHHhHHHHHHhHHHHHHHHHHHHHH
Q psy124            2 IPSGTPNILIPIIVIIEITRNIIRPIALAVRLTANLLASLVWLGDLKQR   50 (60)
Q Consensus         2 ~P~G~p~~l~p~~~~iE~is~~~RPlsL~lRL~~N~~aG~il~~li~~~   50 (60)
                      .|.|+| ++.|+++++|++|+++||+||++|||+||+|||+++.++++.
T Consensus        87 ~P~g~p-~L~P~~v~iE~is~~~RP~sL~~RLfaNm~AGhlll~li~~~  134 (177)
T 1c17_M           87 QPFNHW-AFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGL  134 (177)
T ss_dssp             -------------------CTTHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCcc-HHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            588888 999999999999999999999999999999999999998864


No 2  
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens}
Probab=17.63  E-value=76  Score=21.38  Aligned_cols=18  Identities=22%  Similarity=0.085  Sum_probs=14.0

Q ss_pred             HHhHHHHHHhHHHHHHHH
Q psy124           27 IALAVRLTANLLASLVWL   44 (60)
Q Consensus        27 lsL~lRL~~N~~aG~il~   44 (60)
                      .-+++|+++|++....--
T Consensus       165 ~ml~lR~l~NlF~~~~g~  182 (304)
T 3ebb_A          165 QLLALRTFCNCFVGQAGQ  182 (304)
T ss_dssp             HHHHHHHHHHGGGSHHHH
T ss_pred             HHHHHHHHHHccCCchhH
Confidence            458999999999866543


No 3  
>3gae_A Protein DOA1; UFD3, CDC48, armadillo repeat, nucleus, phosphoprotein, UBL conjugation pathway, WD repeat, nuclear protein; 1.60A {Saccharomyces cerevisiae}
Probab=16.10  E-value=51  Score=21.59  Aligned_cols=14  Identities=29%  Similarity=0.375  Sum_probs=11.4

Q ss_pred             HhHHHHHHhHHHHH
Q psy124           28 ALAVRLTANLLASL   41 (60)
Q Consensus        28 sL~lRL~~N~~aG~   41 (60)
                      -+++|.++|++...
T Consensus       108 ml~lR~l~NlF~~~  121 (253)
T 3gae_A          108 MLTVRILVNCFNNE  121 (253)
T ss_dssp             HHHHHHHHHHTTCT
T ss_pred             HHHHHHHHHcccCC
Confidence            37999999999833


No 4  
>3l3f_X Protein DOA1, DOA1/UFD3; armadillo-like repeat structure, nucleus, UBL conjugation PA protein binding; 1.90A {Saccharomyces cerevisiae}
Probab=11.72  E-value=78  Score=22.24  Aligned_cols=14  Identities=29%  Similarity=0.339  Sum_probs=11.6

Q ss_pred             hHHHHHHhHHHHHH
Q psy124           29 LAVRLTANLLASLV   42 (60)
Q Consensus        29 L~lRL~~N~~aG~i   42 (60)
                      +++|+++|++....
T Consensus       218 ltlR~laNlF~~~~  231 (362)
T 3l3f_X          218 LTVRILVNCFNNEN  231 (362)
T ss_dssp             HHHHHHHHHTTCTT
T ss_pred             HHHHHHHHhccCcc
Confidence            78999999987544


No 5  
>3pst_A Protein DOA1; protein degradation, CDC48, ubiquitin, nuclear protein; 2.00A {Saccharomyces cerevisiae} PDB: 3psp_A
Probab=10.31  E-value=93  Score=22.46  Aligned_cols=14  Identities=29%  Similarity=0.339  Sum_probs=11.6

Q ss_pred             hHHHHHHhHHHHHH
Q psy124           29 LAVRLTANLLASLV   42 (60)
Q Consensus        29 L~lRL~~N~~aG~i   42 (60)
                      +++|+++|++....
T Consensus       281 ltlR~laNlF~~~~  294 (425)
T 3pst_A          281 LTVRILVNCFNNEN  294 (425)
T ss_dssp             HHHHHHHHHTTCTT
T ss_pred             HHHHHHHHhcCCcc
Confidence            78999999987544


No 6  
>2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens}
Probab=8.12  E-value=2.9e+02  Score=14.37  Aligned_cols=20  Identities=20%  Similarity=0.240  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHh
Q psy124           37 LLASLVWLGDLKQRLDQLNL   56 (60)
Q Consensus        37 ~~aG~il~~li~~~~~~~~~   56 (60)
                      ..+|-+++.++....|+++.
T Consensus        19 vl~GLllL~li~~~LwK~GF   38 (54)
T 2knc_A           19 VLGGLLLLTILVLAMWKVGF   38 (54)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHcCc
Confidence            35677777777777777654


No 7  
>2bec_B Sodium/hydrogen exchanger 1; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} PDB: 2e30_B
Probab=6.43  E-value=2.4e+02  Score=13.71  Aligned_cols=11  Identities=18%  Similarity=0.344  Sum_probs=7.5

Q ss_pred             HHHHHHhHHHH
Q psy124           30 AVRLTANLLAS   40 (60)
Q Consensus        30 ~lRL~~N~~aG   40 (60)
                      .-|++-+++||
T Consensus        21 h~~~~dhlmaG   31 (43)
T 2bec_B           21 HTQFLDHLLTG   31 (43)
T ss_dssp             HHHHHHHHHHH
T ss_pred             hhhhhhhhhhc
Confidence            34677777776


No 8  
>3h2d_A CHEC-like superfamily protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.86A {Shewanella oneidensis} PDB: 3iic_A*
Probab=6.43  E-value=3e+02  Score=16.27  Aligned_cols=17  Identities=12%  Similarity=-0.220  Sum_probs=11.2

Q ss_pred             HHHHHHhHHHHHHHHHH
Q psy124           30 AVRLTANLLASLVWLGD   46 (60)
Q Consensus        30 ~lRL~~N~~aG~il~~l   46 (60)
                      ++.=.+||.+|+..-.+
T Consensus        89 al~Ei~Nii~G~~~~~l  105 (155)
T 3h2d_A           89 LVGEITNMVTGGAKNLL  105 (155)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44557888888776443


No 9  
>2l8s_A Integrin alpha-1; transmembrane region, detergent micelle, CE adhesion; NMR {Homo sapiens}
Probab=6.32  E-value=3.7e+02  Score=14.01  Aligned_cols=19  Identities=26%  Similarity=0.205  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHHHHh
Q psy124           38 LASLVWLGDLKQRLDQLNL   56 (60)
Q Consensus        38 ~aG~il~~li~~~~~~~~~   56 (60)
                      .+|-+++.++....|+++.
T Consensus        17 l~GLLLL~Lii~~LwK~GF   35 (54)
T 2l8s_A           17 FAGLLLLMLLILALWKIGF   35 (54)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHcCc
Confidence            4566666666666676654


No 10 
>3hm4_A Chemotaxis protein CHEX; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; HET: MSE; 1.30A {Desulfovibrio desulfuricans subsp} PDB: 3h4y_A*
Probab=6.27  E-value=3.1e+02  Score=16.22  Aligned_cols=17  Identities=18%  Similarity=0.114  Sum_probs=11.3

Q ss_pred             HHHHHHhHHHHHHHHHH
Q psy124           30 AVRLTANLLASLVWLGD   46 (60)
Q Consensus        30 ~lRL~~N~~aG~il~~l   46 (60)
                      ++.=.+||.+|+..-.+
T Consensus        91 al~Ei~Nii~G~~~~~l  107 (156)
T 3hm4_A           91 AVGEVTNMISGQARAAL  107 (156)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34457888888876443


Done!