Diaphorina citri psyllid: psy12401

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----

MPDHGTNGNIENGSNGIHNDDNGHDEGNGESQSSAEKFRFKNQTESLESRVLVIYTGGTIGMIINNDGVLAPQSNKFKENIRQNPLMHDVDYLRNRPDKSEYLALPGLKHNKRVLYKVLEYDSLLDSSNMTVDDWINIASDVFDNYENFDGFVILHGTDTLCYTAAALSFMFENLGKTVIITGSQISIFQPRSDGVDNFIASLILAGNYVIPEVTVYFHNKLMRGNRTIKTSTYEFDAFISPNCLPLVQVGIEID

ccccccccccccccccEEEccccccccccccccccHHccccccccccccEEEEEEEcccccEEEcccccccccccHHHHHHHcccccccHHHHHccccccccccccccccccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHccccccEEEEccccccccccccHHHHHHHHHHHHcccccccEEEEEccEEEcccccEEcccccccccccccccccEEEEEECc

*****TN*NIENGSNGIHND****************************SRVLVIYTGGTIGMIINNDGVLAPQSNKFKENIRQNPLMHDVDYLRNRPDKSEYLALPGLKHNKRVLYKVLEYDSLLDSSNMTVDDWINIASDVFDNYENFDGFVILHGTDTLCYTAAALSFMFENLGKTVIITGSQISIFQPRSDGVDNFIASLILAGNYVIPEVTVYFHNKLMRGNRTIKTSTYEFDAFISPNCLPLVQVGIEID

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006528 [BP]	asparagine metabolic process	probable	GO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0043603, GO:0006520, GO:0019752, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0009066, GO:0008152, GO:0043436, GO:1901605, GO:0044281
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0004067 [MF]	asparaginase activity	probable	GO:0016787, GO:0016810, GO:0016811, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HIM, chain A
Confidence level:very confident
Coverage over the Query: 48-91,108-254
View the alignment between query and template
View the model in PyMOL