RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy12414
         (71 letters)



>gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in
          Carboxyl-Terminal Src Kinase (Csk).  Both the
          C-terminal Src kinase (CSK) and CSK-homologous kinase
          (CHK) are members of the CSK-family of protein tyrosine
          kinases. These proteins suppress activity of Src-family
          kinases (SFK) by selectively phosphorylating the
          conserved C-terminal tail regulatory tyrosine by a
          similar mechanism. CHK is also capable of inhibiting
          SFKs by a non-catalytic mechanism that involves binding
          of CHK to SFKs to form stable protein complexes. The
          unphosphorylated form of SFKs is inhibited by CSK and
          CHK by a two-step mechanism. The first step involves
          the formation of a complex of SFKs with CSK/CHK with
          the SFKs in the complex are inactive. The second step,
          involves the phosphorylation of the C-terminal tail
          tyrosine of SFKs, which then dissociates and adopt an
          inactive conformation. The structural basis of how the
          phosphorylated SFKs dissociate from CSK/CHK to adopt
          the inactive conformation is not known. The inactive
          conformation of SFKs is stabilized by two
          intramolecular inhibitory interactions: (a) the pYT:SH2
          interaction in which the phosphorylated C-terminal tail
          tyrosine (YT) binds to the SH2 domain, and (b) the
          linker:SH3 interaction of which the SH2-kinase domain
          linker binds to the SH3 domain. SFKs are activated by
          multiple mechanisms including binding of the ligands to
          the SH2 and SH3 domains to displace the two inhibitory
          intramolecular interactions, autophosphorylation, and
          dephosphorylation of YT. By selective phosphorylation
          and the non-catalytic inhibitory mechanism CSK and CHK
          are able to inhibit the active forms of SFKs. CSK and
          CHK are regulated by phosphorylation and inter-domain
          interactions. They both contain SH3, SH2, and kinase
          domains separated by the SH3-SH2 connector and SH2
          kinase linker, intervening segments separating the
          three domains. They lack a conserved tyrosine
          phosphorylation site in the kinase domain and the
          C-terminal tail regulatory tyrosine phosphorylation
          site. The CSK SH2 domain is crucial for stabilizing the
          kinase domain in the active conformation. A disulfide
          bond here regulates CSK kinase activity. The
          subcellular localization and activity of CSK are
          regulated by its SH2 domain. In general SH2 domains are
          involved in signal transduction.  They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 98

 Score =  131 bits (332), Expect = 4e-42
 Identities = 53/72 (73%), Positives = 59/72 (81%), Gaps = 1/72 (1%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAHLTID 59
          WFHGKISRE AE LL P EDGLFLVRESTN+P D+ +CV FE KVEHYRV Y+   LTID
Sbjct: 5  WFHGKISREEAERLLQPPEDGLFLVRESTNYPGDYTLCVSFEGKVEHYRVIYRNGKLTID 64

Query: 60 DEEFFENLAQLV 71
          +EE+FENL QLV
Sbjct: 65 EEEYFENLIQLV 76


>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains.  Src homology 2 domains
          bind phosphotyrosine-containing polypeptides via 2
          surface pockets. Specificity is provided via
          interaction with residues that are distinct from the
          phosphotyrosine. Only a single occurrence of a SH2
          domain has been found in S. cerevisiae.
          Length = 84

 Score = 80.0 bits (198), Expect = 8e-22
 Identities = 31/73 (42%), Positives = 45/73 (61%), Gaps = 2/73 (2%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAH-LTI 58
          W+HG ISRE AE LL  + DG FLVR+S + P D+ + V  + KV+HYR++  E     +
Sbjct: 3  WYHGFISREEAEKLLKNEGDGDFLVRDSESSPGDYVLSVRVKGKVKHYRIRRNEDGKFYL 62

Query: 59 DDEEFFENLAQLV 71
          +    F +L +LV
Sbjct: 63 EGGRKFPSLVELV 75


>gnl|CDD|215658 pfam00017, SH2, SH2 domain. 
          Length = 77

 Score = 75.7 bits (187), Expect = 3e-20
 Identities = 34/74 (45%), Positives = 46/74 (62%), Gaps = 3/74 (4%)

Query: 1  WFHGKISRETAESLL-APKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAH-LT 57
          W+HGKISRE AE LL  PK DG FLVRES + P D+ + V  + +V+HYR++  +     
Sbjct: 1  WYHGKISREEAERLLLNPKPDGTFLVRESESKPGDYTLSVRDDGRVKHYRIQSLDNGGYY 60

Query: 58 IDDEEFFENLAQLV 71
          I     F +L +LV
Sbjct: 61 ISGGVTFNSLPELV 74


>gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2)
          domain found in SH2 domains, ANK, and kinase domain
          (shark) proteins.  These non-receptor protein-tyrosine
          kinases contain two SH2 domains, five ankyrin
          (ANK)-like repeats, and a potential tyrosine
          phosphorylation site in the carboxyl-terminal tail
          which resembles the phosphorylation site in members of
          the src family. Like, mammalian non-receptor
          protein-tyrosine kinases, ZAP-70 and syk proteins, they
          do not have SH3 domains. However, the presence of ANK
          makes these unique among protein-tyrosine kinases. Both
          tyrosine kinases and ANK repeats have been shown to
          transduce developmental signals, and SH2 domains are
          known to participate intimately in tyrosine kinase
          signaling. These tyrosine kinases are believed to be
          involved in epithelial cell polarity. The members of
          this family include the shark (SH2 domains, ANK, and
          kinase domain) gene in Drosophila and yellow fever
          mosquitos, as well as the hydra protein HTK16.
          Drosophila Shark is proposed to transduce
          intracellularly the Crumbs, a protein necessary for
          proper organization of ectodermal epithelia,
          intercellular signal. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 81

 Score = 68.6 bits (168), Expect = 2e-17
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 5/76 (6%)

Query: 1  WFHGKISRETAESLLAPK--EDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKY--KEAH 55
          W+HGKISRE AE+LL  +   DGLFLVREST+ P D+ + +  + +V HY+++   ++A 
Sbjct: 3  WYHGKISREVAEALLLREGGRDGLFLVRESTSAPGDYVLSLLAQGEVLHYQIRRHGEDAF 62

Query: 56 LTIDDEEFFENLAQLV 71
           + D    F  L  L+
Sbjct: 63 FSDDGPLIFHGLDTLI 78


>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain.  In general, SH2
          domains are involved in signal transduction; they bind
          pTyr-containing polypeptide ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites. They are present in a
          wide array of proteins including: adaptor proteins
          (Nck1, Crk, Grb2), scaffolds (Slp76, Shc, Dapp1),
          kinases (Src, Syk, Fps, Tec), phosphatases (Shp-1,
          Shp-2), transcription factors (STAT1),  Ras signaling
          molecules (Ras-Gap), ubiquitination factors (c-Cbl),
          cytoskeleton regulators (Tensin), signal regulators
          (SAP), and phospholipid second messengers (PLCgamma),
          amongst others.
          Length = 79

 Score = 67.9 bits (166), Expect = 3e-17
 Identities = 33/75 (44%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFM--CVCFESKVEHYRVKYKEA--HL 56
          WFHG ISRE AE LL  K DG FLVRES++ P D++      + KV+HY ++  E   +L
Sbjct: 2  WFHGSISREEAERLLRGKPDGTFLVRESSSEPGDYVLSVRSGDGKVKHYLIERNEGGYYL 61

Query: 57 TIDDEEFFENLAQLV 71
                 F +L +LV
Sbjct: 62 LGGSGRTFPSLPELV 76


>gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson
          murine lymphosarcoma virus (ABL) proteins.  ABL-family
          proteins are highly conserved tyrosine kinases. Each
          ABL protein contains an SH3-SH2-TK (Src homology 3-Src
          homology 2-tyrosine kinase) domain cassette, which
          confers autoregulated kinase activity and is common
          among nonreceptor tyrosine kinases. Several types of
          posttranslational modifications control ABL catalytic
          activity, subcellular localization, and stability, with
          consequences for both cytoplasmic and nuclear ABL
          functions. Binding partners provide additional
          regulation of ABL catalytic activity, substrate
          specificity, and downstream signaling. By combining
          this cassette with actin-binding and -bundling domain,
          ABL proteins are capable of connecting
          phosphoregulation with actin-filament reorganization.
          Vertebrate paralogs, ABL1 and ABL2, have evolved to
          perform specialized functions. ABL1 includes nuclear
          localization signals and a DNA binding domain which is
          used to mediate DNA damage-repair functions, while ABL2
          has additional binding capacity for actin and for
          microtubules to enhance its cytoskeletal remodeling
          functions.  SH2 is involved in several autoinhibitory
          mechanism that constrain the enzymatic activity of the
          ABL-family kinases. In one mechanism SH2 and SH3 cradle
          the kinase domain while a cap sequence stabilizes the
          inactive conformation resulting in a locked inactive
          state. Another involves phosphatidylinositol
          4,5-bisphosphate (PIP2) which binds the SH2 domain
          through residues normally required for phosphotyrosine
          binding in the linker segment between the SH2 and
          kinase domains. The SH2 domain contributes to ABL
          catalytic activity and target site specificity. It is
          thought that the ABL catalytic site and SH2 pocket have
          coevolved to recognize the same sequences. Recent work
          now supports a hierarchical processivity model in which
          the substrate target site most compatible with ABL
          kinase domain preferences is phosphorylated with
          greatest efficiency. If this site is compatible with
          the ABL SH2 domain specificity, it will then reposition
          and dock in the SH2 pocket. This mechanism also
          explains how ABL kinases phosphorylates poor targets on
          the same substrate if they are properly positioned and
          how relatively poor substrate proteins might be
          recruited to ABL through a complex with strong
          substrates that can also dock with the SH2 pocket. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 94

 Score = 61.6 bits (150), Expect = 1e-14
 Identities = 28/73 (38%), Positives = 43/73 (58%), Gaps = 2/73 (2%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKY-KEAHLTI 58
          W+HG ISR  AE LL+   +G FLVRES + P  + + + ++ +V HYR+    +  + +
Sbjct: 5  WYHGPISRNAAEYLLSSGINGSFLVRESESSPGQYSISLRYDGRVYHYRISEDSDGKVYV 64

Query: 59 DDEEFFENLAQLV 71
            E  F  LA+LV
Sbjct: 65 TQEHRFNTLAELV 77


>gnl|CDD|198264 cd10401, SH2_C-SH2_Syk_like, C-terminal Src homology 2 (SH2)
          domain found in Spleen tyrosine kinase (Syk) proteins. 
          ZAP-70 and Syk comprise a family of hematopoietic cell
          specific protein tyrosine kinases (PTKs) that are
          required for antigen and antibody receptor function.
          ZAP-70 is expressed in T and natural killer (NK) cells 
          and Syk is expressed in B cells, mast cells,
          polymorphonuclear leukocytes, platelets, macrophages,
          and immature T cells. They are required for the proper
          development of T and B cells, immune receptors, and
          activating NK cells. They consist of two N-terminal Src
          homology 2 (SH2) domains and a C-terminal kinase domain
          separated from the SH2 domains by a linker or hinge
          region. Phosphorylation of both tyrosine residues
          within the Immunoreceptor Tyrosine-based Activation
          Motifs (ITAM; consensus sequence Yxx[LI]x(7,8)Yxx[LI])
          by the Src-family PTKs is required for efficient
          interaction of ZAP-70 and Syk with the receptor
          subunits and for receptor function. ZAP-70 forms two
          phosphotyrosine binding pockets, one of which is shared
          by both SH2 domains.  In Syk the two SH2 domains do not
          form such a phosphotyrosine-binding site.  The SH2
          domains here are believed to function independently. In
          addition, the two SH2 domains of Syk display
          flexibility in their relative orientation, allowing Syk
          to accommodate a greater variety of spacing sequences
          between the ITAM phosphotyrosines and singly
          phosphorylated non-classical ITAM ligands. This model
          contains the C-terminus SH2 domains of Syk. In general
          SH2 domains are involved in signal transduction.  They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 99

 Score = 59.5 bits (144), Expect = 1e-13
 Identities = 34/74 (45%), Positives = 45/74 (60%), Gaps = 3/74 (4%)

Query: 1  WFHGKISRETAESLL--APKEDGLFLVRESTNFPQDFMCVCFESKVEHYRV-KYKEAHLT 57
          WFHGKISRE +E +L    K +G FL+RE  N     +C+  + KV HYR+ K K   L+
Sbjct: 5  WFHGKISREESEQILLIGSKTNGKFLIRERDNNGSYALCLLHDGKVLHYRIDKDKTGKLS 64

Query: 58 IDDEEFFENLAQLV 71
          I D + F+ L QLV
Sbjct: 65 IPDGKKFDTLWQLV 78


>gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth
          factor receptor-bound protein 2 (Grb2) and similar
          proteins.  The adaptor proteins here include homologs
          Grb2 in humans, Sex muscle abnormal protein 5 (Sem-5)
          in Caenorhabditis elegans, and Downstream of receptor
          kinase (drk) in Drosophila melanogaster. They are
          composed of one SH2 and two SH3 domains. Grb2/Sem-5/drk
          regulates the Ras pathway by linking the tyrosine
          kinases to the Ras guanine nucleotide releasing protein
          Sos, which converts Ras to the active GTP-bound state.
          The SH2 domain of Grb2/Sem-5/drk binds class II
          phosphotyrosyl peptides while its SH3 domain binds to
          Sos and Sos-derived, proline-rich peptides. Besides it
          function in Ras signaling, Grb2 is also thought to play
          a role in apoptosis. Unlike most SH2 structures in
          which the peptide binds in an extended conformation
          (such that the +3 peptide residue occupies a
          hydrophobic pocket in the protein, conferring a modest
          degree of selectivity), Grb2 forms several hydrogen
          bonds via main chain atoms with the side chain of +2
          Asn. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 95

 Score = 56.9 bits (138), Expect = 9e-13
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 1  WFHGKISRETAESLL-APKEDGLFLVRESTNFPQDFM-CVCFESKVEHYRV-KYKEAHLT 57
          WFHGKISR  AE +L   + DG FL+RES + P DF   V F + V+H++V +       
Sbjct: 5  WFHGKISRAEAEEILMNQRPDGAFLIRESESSPGDFSLSVKFGNDVQHFKVLRDGAGKYF 64

Query: 58 IDDEEFFENLAQLV 71
          +   +F  +L +LV
Sbjct: 65 LWVVKFN-SLNELV 77


>gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2)
          domain found in SH2 domain Phosphatases (SHP) proteins.
           The SH2 domain phosphatases (SHP-1, SHP-2/Syp,
          Drosophila corkscrew (csw), and Caenorhabditis elegans
          Protein Tyrosine Phosphatase (Ptp-2)) are cytoplasmic
          signaling enzymes. They are both targeted and regulated
          by interactions of their SH2 domains with
          phosphotyrosine docking sites. These proteins contain
          two SH2 domains (N-SH2, C-SH2) followed by a tyrosine
          phosphatase (PTP) domain, and a C-terminal extension.
          Shp1 and Shp2 have two tyrosyl phosphorylation sites in
          their C-tails, which are phosphorylated differentially
          by receptor and nonreceptor PTKs. Csw retains the
          proximal tyrosine and Ptp-2 lacks both sites.
          Shp-binding proteins include receptors, scaffolding
          adapters, and inhibitory receptors. Some of these bind
          both Shp1 and Shp2 while others bind only one. Most
          proteins that bind a Shp SH2 domain contain one or more
          immuno-receptor tyrosine-based inhibitory motifs
          (ITIMs): [SIVL]xpYxx[IVL].  Shp1 N-SH2 domain blocks
          the catalytic domain and keeps the enzyme in the
          inactive conformation, and is thus believed to regulate
          the phosphatase activity of SHP-1. Its C-SH2 domain is
          thought to be involved in searching for phosphotyrosine
          activators.  The SHP2 N-SH2 domain is a conformational
          switch; it either binds and inhibits the phosphatase,
          or it binds phosphoproteins and activates the enzyme.
          The C-SH2 domain contributes binding energy and
          specificity, but it does not have a direct role in
          activation. Csw SH2 domain function is essential, but
          either SH2 domain can fulfill this requirement. The
          role of the csw SH2 domains during Sevenless receptor
          tyrosine kinase (SEV) signaling is to bind Daughter of
          Sevenless rather than activated SEV. Ptp-2 acts in
          oocytes downstream of sheath/oocyte gap junctions to
          promote major sperm protein (MSP)-induced MAP Kinase
          (MPK-1) phosphorylation. Ptp-2 functions in the oocyte
          cytoplasm, not at the cell surface to inhibit multiple
          RasGAPs, resulting in sustained Ras activation. It is
          thought that MSP triggers PTP-2/Ras activation and ROS
          production to stimulate MPK-1 activity essential for
          oocyte maturation and that secreted MSP domains and
          Cu/Zn superoxide dismutases function antagonistically
          to control ROS and MAPK signaling. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 99

 Score = 54.2 bits (131), Expect = 2e-11
 Identities = 28/74 (37%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 1  WFHGKISRETAESLLAPK-EDGLFLVRESTNFPQDFM--CVCFESKVEHYRVKYKEAHLT 57
          WFHG +S + AE LL  K + G FLVRES + P DF+      + KV H  ++ +     
Sbjct: 2  WFHGHLSGKEAEKLLLEKGKPGSFLVRESQSKPGDFVLSVRTDDDKVTHIMIRCQGGKYD 61

Query: 58 IDDEEFFENLAQLV 71
          +   E F++L  LV
Sbjct: 62 VGGGEEFDSLTDLV 75


>gnl|CDD|198276 cd10413, SH2_Grb7, Src homology 2 (SH2) domain found in the
          growth factor receptor bound, subclass 7 (Grb7)
          proteins.  The Grb family binds to the epidermal growth
          factor receptor (EGFR, erbB1) via their SH2 domains.
          Grb7 is part of the Grb7 family of proteins which also
          includes Grb10, and Grb14. They are composed of an
          N-terminal Proline-rich domain, a Ras Associating-like
          (RA) domain, a Pleckstrin Homology (PH) domain, a
          phosphotyrosine interaction region (PIR, BPS) and a
          C-terminal SH2 domain. The SH2 domains of Grb7, Grb10
          and Grb14 preferentially bind to a different RTK. Grb7
          binds strongly to the erbB2 receptor, unlike Grb10 and
          Grb14 which bind weakly to it. Grb7 family proteins are
          phosphorylated on serine/threonine as well as tyrosine
          residues. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 108

 Score = 54.1 bits (130), Expect = 2e-11
 Identities = 33/79 (41%), Positives = 48/79 (60%), Gaps = 8/79 (10%)

Query: 1  WFHGKISRETAESLLAPKE--DGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEA--- 54
          WFHG+ISRE ++ L+  +   DG+FLVRES   PQ F + +C   KV+HY +   E    
Sbjct: 7  WFHGRISREESQRLIGQQGLVDGVFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGR 66

Query: 55 -HLTIDD-EEFFENLAQLV 71
           + ++DD +  F +L QLV
Sbjct: 67 LYFSMDDGQTRFTDLLQLV 85


>gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in
          the growth factor receptor bound, subclass 7 (Grb7)
          proteins.  The Grb family binds to the epidermal growth
          factor receptor (EGFR, erbB1) via their SH2 domains.
          There are 3 members of the Grb7 family of proteins:
          Grb7, Grb10, and Grb14. They are composed of an
          N-terminal Proline-rich domain, a Ras Associating-like
          (RA) domain, a Pleckstrin Homology (PH) domain, a
          phosphotyrosine interaction region (PIR, BPS) and a
          C-terminal SH2 domain. The SH2 domains of Grb7, Grb10
          and Grb14 preferentially bind to a different RTK. Grb7
          binds strongly to the erbB2 receptor, unlike Grb10 and
          Grb14 which bind weakly to it. Grb14 binds to
          Fibroblast Growth Factor Receptor (FGFR). Grb10 has
          been shown to interact with many different proteins,
          including the insulin and IGF1 receptors,
          platelet-derived growth factor (PDGF) receptor-beta,
          Ret, Kit, Raf1 and MEK1, and Nedd4.  Grb7 family
          proteins are phosphorylated on serine/threonine as well
          as tyrosine residues. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 108

 Score = 53.6 bits (129), Expect = 3e-11
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 8/79 (10%)

Query: 1  WFHGKISRETAESLLAPK--EDGLFLVRESTNFPQDF-MCVCFESKVEHYRV----KYKE 53
          WFHG ISR+ A  L+  +   DG+FLVRES + P  F + +    K++HY++       +
Sbjct: 7  WFHGGISRDEAARLIRQQGLVDGVFLVRESQSNPGAFVLSLKHGQKIKHYQIIPIEDEGQ 66

Query: 54 AHLTIDD-EEFFENLAQLV 71
           + T+DD    F +L QLV
Sbjct: 67 WYFTLDDGVTKFYDLLQLV 85


>gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2
          adaptor protein C (SHC).  SHC is involved in a wide
          variety of pathways including regulating proliferation,
          angiogenesis, invasion and metastasis, and bone
          metabolism. An adapter protein, SHC has been implicated
          in Ras activation following the stimulation of a number
          of different receptors, including growth factors
          [insulin, epidermal growth factor (EGF), nerve growth
          factor, and platelet derived growth factor (PDGF)],
          cytokines [interleukins 2, 3, and 5], erythropoietin,
          and granulocyte/macrophage colony-stimulating factor,
          and antigens [T-cell and B-cell receptors]. SHC has
          been shown to bind to tyrosine-phosphorylated
          receptors, and receptor stimulation leads to tyrosine
          phosphorylation of SHC. Upon phosphorylation, SHC
          interacts with another adapter protein, Grb2, which
          binds to the Ras GTP/GDP exchange factor mSOS which
          leads to Ras activation. SHC is composed of an
          N-terminal domain that interacts with proteins
          containing phosphorylated tyrosines, a
          (glycine/proline)-rich collagen-homology domain that
          contains the phosphorylated binding site, and a
          C-terminal SH2 domain. SH2 has been shown to interact
          with the tyrosine-phosphorylated receptors of EGF and
          PDGF and with the tyrosine-phosphorylated C chain of
          the T-cell receptor, providing one of the mechanisms of
          T-cell-mediated Ras activation. In general SH2 domains
          are involved in signal transduction.  They typically
          bind pTyr-containing ligands via two surface pockets, a
          pTyr and hydrophobic binding pocket, allowing proteins
          with SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 104

 Score = 52.7 bits (127), Expect = 6e-11
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 2/35 (5%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF 35
          W+HGK+SR  AESLL  + DG FLVREST  P  +
Sbjct: 9  WYHGKMSRRDAESLL--QTDGDFLVRESTTTPGQY 41


>gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain
          found in alpha2-chimerin and beta2-chimerin proteins.
          Chimerins are a family of phorbol ester- and
          diacylglycerol-responsive GTPase-activating proteins.
          Alpha1-chimerin (formerly known as n-chimerin) and
          alpha2-chimerin are alternatively spliced products of a
          single gene, as are beta1- and beta2-chimerin. alpha1-
          and beta1-chimerin have a relatively short N-terminal
          region that does not encode any recognizable domains,
          whereas alpha2- and beta2-chimerin both include a
          functional SH2 domain that can bind to phosphotyrosine
          motifs within receptors. All of the isoforms contain a
          GAP domain with specificity in vitro for Rac1 and a
          diacylglycerol (DAG)-binding C1 domain which allows
          them to translocate to membranes in response to DAG
          signaling and anchors them in close proximity to
          activated Rac. Other C1 domain-containing
          diacylglycerol receptors including: PKC, Munc-13
          proteins, phorbol ester binding scaffolding proteins
          involved in Ca2+-stimulated exocytosis, and RasGRPs,
          diacylglycerol-activated guanine-nucleotide exchange
          factors (GEFs) for Ras and Rap1. In general SH2 domains
          are involved in signal transduction. They typically
          bind pTyr-containing ligands via two surface pockets, a
          pTyr and hydrophobic binding pocket, allowing proteins
          with SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 91

 Score = 52.0 bits (125), Expect = 9e-11
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 2  FHGKISRETAESLLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYK-EAHLTID 59
          +HG ISRE AE LL+   DG +L+RES+     + + + F  KV++Y++ Y  + H    
Sbjct: 9  YHGLISREEAEQLLSGASDGSYLIRESSRDDGYYTLSLRFNGKVKNYKLYYDGKNHYHYV 68

Query: 60 DEEFFENLAQLV 71
           E+ F+ +  LV
Sbjct: 69 GEKRFDTIHDLV 80


>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2
          (N-SH2) domain in Phospholipase C gamma.  Phospholipase
          C gamma is a signaling molecule that is recruited to
          the C-terminal tail of the receptor upon
          autophosphorylation of a highly conserved tyrosine.
          PLCgamma is composed of a Pleckstrin homology (PH)
          domain followed by an elongation factor (EF) domain, 2
          catalytic regions of PLC domains that flank 2 tandem
          SH2 domains (N-SH2, C-SH2), and ending with a SH3
          domain and C2 domain. N-SH2 SH2 domain-mediated
          interactions represent a crucial step in transmembrane
          signaling by receptor tyrosine kinases. SH2 domains
          recognize phosphotyrosine (pY) in the context of
          particular sequence motifs in receptor phosphorylation
          sites. Both N-SH2 and C-SH2 have a very similar binding
          affinity to pY. But in growth factor stimulated cells
          these domains bind to different target proteins. N-SH2
          binds to pY containing sites in the C-terminal tails of
          tyrosine kinases and other receptors. Recently it has
          been shown that this interaction is mediated by
          phosphorylation-independent interactions between a
          secondary binding site found exclusively on the N-SH2
          domain and a region of the FGFR1 tyrosine kinase
          domain. This secondary site on the SH2 cooperates with
          the canonical pY site to regulate selectivity in
          mediating a specific cellular process.  C-SH2 binds to
          an intramolecular site on PLCgamma itself which allows
          it to hydrolyze phosphatidylinositol-4,5-bisphosphate
          into diacylglycerol and inositol triphosphate. These
          then activate protein kinase C and release calcium. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 99

 Score = 51.6 bits (124), Expect = 2e-10
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 8/62 (12%)

Query: 1  WFHGKIS--RETAESLLA---PKEDGLFLVRESTNFPQDFMCVCF--ESKVEHYRVKYKE 53
          WFHGK+   R+ AE LL       DG FLVRES  F  D+  + F    KV+H R++ ++
Sbjct: 6  WFHGKLGDGRDEAEKLLLEYCEGGDGTFLVRESETFVGDY-TLSFWRNGKVQHCRIRSRQ 64

Query: 54 AH 55
           +
Sbjct: 65 EN 66


>gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in
          SH2-containing inositol-5'-phosphatase (SHIP) and
          SLAM-associated protein (SAP).  The SH2-containing
          inositol-5'-phosphatase, SHIP (also called
          SHIP1/SHIP1a), is a hematopoietic-restricted
          phosphatidylinositide phosphatase that translocates to
          the plasma membrane after extracellular stimulation and
          hydrolyzes the phosphatidylinositol-3-kinase
          (PI3K)-generated second messenger PI-3,4,5-P3 (PIP3) to
          PI-3,4-P2. As a result, SHIP dampens down PIP3 mediated
          signaling and represses the proliferation,
          differentiation, survival, activation, and migration of
          hematopoietic cells.  PIP3 recruits lipid-binding
          pleckstrin homology(PH) domain-containing proteins to
          the inner wall of the plasma membrane and activates
          them. PH domain-containing downstream effectors include
          the survival/proliferation enhancing serine/threonine
          kinase, Akt (protein kinase B), the tyrosine kinase,
          Btk, the regulator of protein translation, S6K, and the
          Rac and cdc42 guanine nucleotide exchange factor, Vav.
          SHIP is believed to act  as a tumor suppressor during
          leukemogenesis and lymphomagenesis, and may play a role
          in activating the immune system to combat cancer. SHIP
          contains an N-terminal SH2 domain, a centrally located
          phosphatase domain that specifically hydrolyzes the
          5'-phosphate from PIP3, PI-4,5-P2  and
          inositol-1,3,4,5- tetrakisphosphate (IP4), a C2 domain,
          that is an allosteric activating site when bound by
          SHIP's enzymatic product, PI-3,4-P2; 2 NPXY motifs that
          bind proteins with a phosphotyrosine binding (Shc, Dok
          1, Dok 2) or an SH2 (p85a, SHIP2) domain; and a
          proline-rich domain consisting of four PxxP motifs that
          bind a subset of SH3-containing proteins including
          Grb2, Src, Lyn, Hck, Abl, PLCg1, and PIAS1. The SH2
          domain of SHIP binds to the tyrosine phosphorylated
          forms of Shc, SHP-2, Doks, Gabs, CD150,
          platelet-endothelial cell adhesion molecule, Cas,
          c-Cbl, immunoreceptor tyrosine-based inhibitory motifs
          (ITIMs), and immunoreceptor tyrosine-based activation
          motifs (ITAMs). The X-linked lymphoproliferative
          syndrome (XLP) gene encodes SAP (also called
          SH2D1A/DSHP) a protein that consists of a 5 residue
          N-terminus, a single SH2 domain, and a short 25 residue
          C-terminal tail.  XLP is characterized by an extreme
          sensitivity to Epstein-Barr virus.  Both T and natural
          killer (NK) cell dysfunctions have been seen in XLP
          patients. SAP binds the cytoplasmic tail of Signaling
          lymphocytic activation molecule (SLAM), 2B4, Ly-9, and
          CD84. SAP is believed to function as a signaling
          inhibitor, by blocking or regulating binding of other
          signaling proteins. SAP and the SAP-like protein EAT-2
          recognize the sequence motif TIpYXX(V/I), which is
          found in the cytoplasmic domains of a restricted number
          of T, B, and NK cell surface receptors and are proposed
          to be natural inhibitors or regulators of the
          physiological role of a small family of receptors on
          the surface of these cells. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 103

 Score = 51.7 bits (124), Expect = 2e-10
 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 8/79 (10%)

Query: 1  WFHGKISRETAESLLAPK-EDGLFLVRESTNFPQDF-MCVCFESKVEHYRV-KYKEAHLT 57
          W+HG I+R  AE LL+   +DG FLVR+S +    + +CV +++ V  YR+    E  L+
Sbjct: 5  WYHGNITRSKAEELLSKAGKDGSFLVRDSESVSGAYALCVLYQNCVHTYRILPNAEDKLS 64

Query: 58 IDDEE-----FFENLAQLV 71
          +   E     FF  L +L+
Sbjct: 65 VQASEGVPVRFFTTLPELI 83


>gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in
          cancer-related signaling adaptor protein CRK.  SH2
          domain in the CRK proteins.  CRKI (SH2-SH3) and CRKII
          (SH2-SH3-SH3) are splicing isoforms of the oncoprotein
          CRK.  CRKs regulate transcription and cytoskeletal
          reorganization for cell growth and motility by linking
          tyrosine kinases to small G proteins. The SH2 domain of
          CRK associates with tyrosine-phosphorylated receptors
          or components of focal adhesions, such as p130Cas and
          paxillin. CRK transmits signals to small G proteins
          through effectors that bind its SH3 domain, such as
          C3G, the guanine-nucleotide exchange factor (GEF) for
          Rap1 and R-Ras, and DOCK180, the GEF for Rac6. The
          binding of p130Cas to the CRK-C3G complex activates
          Rap1, leading to regulation of cell adhesion, and
          activates R-Ras, leading to JNK-mediated activation of
          cell proliferation, whereas the binding of CRK DOCK180
          induces Rac1-mediated activation of cellular migration.
          The activity of the different splicing isoforms varies
          greatly with CRKI displaying substantial transforming
          activity, CRKII less so, and phosphorylated CRKII with
          no biological activity whatsoever.  CRKII has a linker
          region with a phosphorylated Tyr and an additional
          C-terminal SH3 domain. The phosphorylated Tyr creates a
          binding site for its SH2 domain which disrupts the
          association between CRK and its SH2 target proteins.
          In general SH2 domains are involved in signal
          transduction.  They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 106

 Score = 51.3 bits (123), Expect = 3e-10
 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHY 47
          W+ G +SR+ A+ LL  +  G+FLVR+S+  P D+ + V   S+V HY
Sbjct: 9  WYFGPMSRQEAQELLQGQRHGVFLVRDSSTIPGDYVLSVSENSRVSHY 56


>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain
          found in Ras GTPase-activating protein 1 (GAP).  RasGAP
          is part of the GAP1 family of GTPase-activating
          proteins. The protein is located in the cytoplasm and
          stimulates the GTPase activity of normal RAS p21, but
          not its oncogenic counterpart. Acting as a suppressor
          of RAS function, the protein enhances the weak
          intrinsic GTPase activity of RAS proteins resulting in
          RAS inactivation, thereby allowing control of cellular
          proliferation and differentiation. Mutations leading to
          changes in the binding sites of either protein are
          associated with basal cell carcinomas. Alternative
          splicing results in two isoforms. The shorter isoform
          which lacks the N-terminal hydrophobic region, has the
          same activity, and is expressed in placental tissues.
          In general longer isoform contains 2 SH2 domains, a SH3
          domain, a pleckstrin homology (PH) domain, and a
          calcium-dependent phospholipid-binding C2 domain. The
          C-terminus contains the catalytic domain of RasGap
          which catalyzes the activation of Ras by hydrolyzing
          GTP-bound active Ras into an inactive GDP-bound form of
          Ras. This model contains the C-terminal SH2 domain. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 77

 Score = 49.7 bits (119), Expect = 4e-10
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 4/52 (7%)

Query: 1  WFHGKISRETAESLL-APKEDGLFLVRESTNFPQDFMCVCF--ESKVEHYRV 49
          WFHGKISRE A ++L      G FLVRES N P D+  + F     ++H+++
Sbjct: 2  WFHGKISREEAYNMLVKVGGPGSFLVRESDNTPGDYS-LSFRVNEGIKHFKI 52


>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2
          (C-SH2) domain in Phospholipase C gamma.  Phospholipase
          C gamma is a signaling molecule that is recruited to
          the C-terminal tail of the receptor upon
          autophosphorylation of a highly conserved tyrosine.
          PLCgamma is composed of a Pleckstrin homology (PH)
          domain followed by an elongation factor (EF) domain, 2
          catalytic regions of PLC domains that flank 2 tandem
          SH2 domains (N-SH2, C-SH2), and ending with a SH3
          domain and C2 domain. N-SH2 SH2 domain-mediated
          interactions represent a crucial step in transmembrane
          signaling by receptor tyrosine kinases. SH2 domains
          recognize phosphotyrosine (pY) in the context of
          particular sequence motifs in receptor phosphorylation
          sites. Both N-SH2 and C-SH2 have a very similar binding
          affinity to pY. But in growth factor stimulated cells
          these domains bind to different target proteins. N-SH2
          binds to pY containing sites in the C-terminal tails of
          tyrosine kinases and other receptors. Recently it has
          been shown that this interaction is mediated by
          phosphorylation-independent interactions between a
          secondary binding site found exclusively on the N-SH2
          domain and a region of the FGFR1 tyrosine kinase
          domain. This secondary site on the SH2 cooperates with
          the canonical pY site to regulate selectivity in
          mediating a specific cellular process.  C-SH2 binds to
          an intramolecular site on PLCgamma itself which allows
          it to hydrolyze phosphatidylinositol-4,5-bisphosphate
          into diacylglycerol and inositol triphosphate. These
          then activate protein kinase C and release calcium. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 104

 Score = 50.3 bits (121), Expect = 5e-10
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 5/74 (6%)

Query: 1  WFHGKISRETAESLL-APKEDGLFLVRESTNFPQDFMCVCF--ESKVEHYRVKYKEAHLT 57
          WFH  ++RE AE +L     DG FLVR S   P  F  + F  E K++H R+K +     
Sbjct: 6  WFHANLTREQAEEMLMRVPRDGAFLVRPSETDPNSFA-ISFRAEGKIKHCRIKQEGRLFV 64

Query: 58 IDDEEFFENLAQLV 71
          I   + FE+L +LV
Sbjct: 65 IGTSQ-FESLVELV 77


>gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2)
          domain found in SH2 domains, ANK, and kinase domain
          (shark) proteins.  These non-receptor protein-tyrosine
          kinases contain two SH2 domains, five ankyrin
          (ANK)-like repeats, and a potential tyrosine
          phosphorylation site in its carboxyl-terminal tail
          which resembles the phosphorylation site in members of
          the src family. Like, mammalian non-receptor
          protein-tyrosine kinases, ZAP-70 and syk proteins, they
          do not have SH3 domains. However, the presence of ANK
          makes these unique among protein-tyrosine kinases. Both
          tyrosine kinases and ANK repeats have been shown to
          transduce developmental signals, and SH2 domains are
          known to participate intimately in tyrosine kinase
          signaling. These tyrosine kinases are believed to be
          involved in epithelial cell polarity. The members of
          this family include the shark (SH2 domains, ANK, and
          kinase domain) gene in Drosophila and yellow fever
          mosquitos, as well as the hydra protein HTK16.
          Drosophila Shark is proposed to transduce
          intracellularly the Crumbs, a protein necessary for
          proper organization of ectodermal epithelia,
          intercellular signal. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 86

 Score = 47.8 bits (114), Expect = 3e-09
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 1  WFHGKISRETAESLLAPKE--DGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEA-HL 56
          W HG + R  A  +L  K   DG FLVR S   P  + + + +E+ V H+ ++ ++    
Sbjct: 2  WLHGALDRNEAVEILKQKADADGSFLVRYSRRRPGGYVLTLVYENHVYHFEIQNRDDKWF 61

Query: 57 TIDDEEFFENLAQLV 71
           IDD  +FE+L  L+
Sbjct: 62 YIDDGPYFESLEHLI 76


>gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2
          (SH2) domain found in Zeta-chain-associated protein
          kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk)
          proteins.  ZAP-70 and Syk comprise a family of
          hematopoietic cell specific protein tyrosine kinases
          (PTKs) that are required for antigen and antibody
          receptor function. ZAP-70 is expressed in T and natural
          killer (NK) cells and Syk is expressed in B cells, mast
          cells, polymorphonuclear leukocytes, platelets,
          macrophages, and immature T cells. They are required
          for the proper development of T and B cells, immune
          receptors, and activating NK cells. They consist of two
          N-terminal Src homology 2 (SH2) domains and a
          C-terminal kinase domain separated from the SH2 domains
          by a linker or hinge region. Phosphorylation of both
          tyrosine residues within the Immunoreceptor
          Tyrosine-based Activation Motifs (ITAM; consensus
          sequence Yxx[LI]x(7,8)Yxx[LI]) by the Src-family PTKs
          is required for efficient interaction of ZAP-70 and Syk
          with the receptor subunits and for receptor function.
          ZAP-70 forms two phosphotyrosine binding pockets, one
          of which is shared by both SH2 domains.  In Syk the two
          SH2 domains do not form such a phosphotyrosine-binding
          site.  The SH2 domains here are believed to function
          independently. In addition, the two SH2 domains of Syk
          display flexibility in their relative orientation,
          allowing Syk to accommodate a greater variety of
          spacing sequences between the ITAM phosphotyrosines and
          singly phosphorylated non-classical ITAM ligands. This
          model contains the N-terminus SH2 domains of both Syk
          and Zap70. In general SH2 domains are involved in
          signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 104

 Score = 46.6 bits (111), Expect = 1e-08
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 1  WFHGKISRETAESLL--APKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRV 49
          +F+G I+RE AE  L  A   DGLFL+R+S      + + VC   K  HY +
Sbjct: 3  FFYGSITREEAEEYLKLAGMSDGLFLLRQSLRSLGGYVLSVCHGRKFHHYTI 54


>gnl|CDD|198277 cd10414, SH2_Grb14, Src homology 2 (SH2) domain found in the
          growth factor receptor bound, subclass 14 (Grb14)
          proteins.  The Grb family binds to the epidermal growth
          factor receptor (EGFR, erbB1) via their SH2 domains.
          Grb14 is part of the Grb7 family of proteins which also
          includes Grb7, and Grb14. They are composed of an
          N-terminal Proline-rich domain, a Ras Associating-like
          (RA) domain, a Pleckstrin Homology (PH) domain, a
          phosphotyrosine interaction region (PIR, BPS) and a
          C-terminal SH2 domain. The SH2 domains of Grb7, Grb10
          and Grb14 preferentially bind to a different RTK. Grb14
          binds to Fibroblast Growth Factor Receptor (FGFR) and
          weakly to the erbB2 receptor. In general SH2 domains
          are involved in signal transduction. They typically
          bind pTyr-containing ligands via two surface pockets, a
          pTyr and hydrophobic binding pocket, allowing proteins
          with SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 108

 Score = 46.5 bits (110), Expect = 2e-08
 Identities = 29/79 (36%), Positives = 46/79 (58%), Gaps = 8/79 (10%)

Query: 1  WFHGKISRETAESLLAPKE--DGLFLVRESTNFPQDF-MCVCFESKVEHYRV----KYKE 53
          WFH KISR+ A+ L+  +   DG+FLVR+S + P+ F + +    K++H+++       E
Sbjct: 7  WFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPRTFVLSMSHGQKIKHFQIIPVEDDGE 66

Query: 54 AHLTIDD-EEFFENLAQLV 71
             T+DD    F +L QLV
Sbjct: 67 LFHTLDDGHTRFTDLIQLV 85


>gnl|CDD|198263 cd10400, SH2_SAP1a, Src homology 2 (SH2) domain found in
          SLAM-associated protein (SAP) 1a.  The X-linked
          lymphoproliferative syndrome (XLP) gene encodes SAP
          (also called SH2D1A/DSHP) a protein that consists of a
          5 residue N-terminus, a single SH2 domain, and a short
          25 residue C-terminal tail. XLP is characterized by an
          extreme sensitivity to Epstein-Barr virus.  Both T and
          natural killer (NK) cell dysfunctions have been seen in
          XLP patients. SAP binds the cytoplasmic tail of
          Signaling lymphocytic activation molecule (SLAM), 2B4,
          Ly-9, and CD84. SAP is believed to function as a
          signaling inhibitor, by blocking or regulating binding
          of other signaling proteins. SAP and the SAP-like
          protein EAT-2 recognize the sequence motif TIpYXX[VI],
          which is found in the cytoplasmic domains of a
          restricted number of T, B, and NK cell surface
          receptors and are proposed to be natural inhibitors or
          regulators of the physiological role of a small family
          of receptors on the surface of these cells.  In general
          SH2 domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 103

 Score = 45.2 bits (107), Expect = 6e-08
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 2  FHGKISRETAESLL-APKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEA 54
          +HGKISRET E LL A   DG +L+R+S + P  + +CV ++  V  YRV   E 
Sbjct: 6  YHGKISRETGEKLLLAAGLDGSYLLRDSESVPGVYCLCVLYKGYVYTYRVSQTET 60


>gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in
          SH2 domain-containing adapter proteins B, D, E, and F
          (SHB, SHD, SHE, SHF).  SHB, SHD, SHE, and SHF are SH2
          domain-containing proteins that play various roles
          throughout the cell.  SHB functions in generating
          signaling compounds in response to tyrosine kinase
          activation. SHB contains proline-rich motifs, a
          phosphotyrosine binding (PTB) domain, tyrosine
          phosphorylation sites, and a SH2 domain. SHB mediates
          certain aspects of platelet-derived growth factor
          (PDGF) receptor-, fibroblast growth factor (FGF)
          receptor-, neural growth factor (NGF) receptor TRKA-, T
          cell receptor-, interleukin-2 (IL-2) receptor- and
          focal adhesion kinase- (FAK) signaling. SRC-like
          FYN-Related Kinase FRK/RAK (also named BSK/IYK or GTK)
          and SHB regulate apoptosis, proliferation and
          differentiation. SHB promotes apoptosis and is also
          required for proper mitogenicity, spreading and tubular
          morphogenesis in endothelial cells. SHB also plays a
          role in preventing early cavitation of embryoid bodies
          and reduces differentiation to cells expressing
          albumin, amylase, insulin and glucagon. SHB is a
          multifunctional protein that has difference responses
          in different cells under various conditions. SHE is
          expressed in heart, lung, brain, and skeletal muscle,
          while expression of SHD is restricted to the brain. SHF
          is mainly expressed in skeletal muscle, brain, liver,
          prostate, testis, ovary, small intestine, and colon.
          SHD may be a physiological substrate of c-Abl and may
          function as an adapter protein in the central nervous
          system. It is also thought to be involved in apoptotic
          regulation.  SHD contains five YXXP motifs, a substrate
          sequence preferred by Abl tyrosine kinases, in addition
          to a poly-proline rich region and a C-terminal SH2
          domain. SHE contains two pTry protein binding domains,
          protein interaction domain (PID) and a SH2 domain,
          followed by a glycine-proline rich region, all of which
          are N-terminal to the phosphotyrosine binding (PTB)
          domain. SHF contains  four putative tyrosine
          phosphorylation sites and an SH2 domain. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 98

 Score = 44.7 bits (106), Expect = 7e-08
 Identities = 18/35 (51%), Positives = 25/35 (71%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF 35
          W+HG I+R  AESLL P ++G +LVR S +  QD+
Sbjct: 3  WYHGAITRIEAESLLRPCKEGSYLVRNSESTKQDY 37


>gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast
          Cancer Anti-estrogen Resistance protein 3.  BCAR3 is
          part of a growing family of guanine nucleotide exchange
          factors is responsible for activation of Ras-family
          GTPases, including Sos1 and 2, GRF1 and 2,
          CalDAG-GEF/GRP1-4, C3G, cAMP-GEF/Epac 1 and 2,
          PDZ-GEFs, MR-GEF, RalGDS family members, RalGPS,
          RasGEF, Smg GDS, and phospholipase C(epsilon). 12102558
           21262352  BCAR3 binds to the carboxy-terminus of
          BCAR1/p130Cas, a focal adhesion adapter protein.  Over
          expression of BCAR1 (p130Cas) and BCAR3 induces
          estrogen independent growth in normally
          estrogen-dependent cell lines. They have been linked to
          resistance to anti-estrogens in breast cancer, Rac
          activation, and cell motility, though the BCAR3/p130Cas
          complex is not required for this activity in BCAR3.
          Many BCAR3-mediated signaling events in epithelial and
          mesenchymal cells are independent of p130Cas
          association. Structurally these proteins contain a
          single SH2 domain upstream of their RasGEF domain,
          which is responsible for the ability of BCAR3 to
          enhance p130Cas over-expression-induced migration. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 136

 Score = 45.4 bits (108), Expect = 9e-08
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMCVCF 40
          W+HG+I R+ AESL+  + +G FLVR+S + P D++  C 
Sbjct: 8  WYHGRIPRQVAESLV--QREGDFLVRDSLSSPGDYVLTCR 45


>gnl|CDD|198278 cd10415, SH2_Grb10, Src homology 2 (SH2) domain found in the
          growth factor receptor bound, subclass 10 (Grb10)
          proteins.  The Grb family binds to the epidermal growth
          factor receptor (EGFR, erbB1) via their SH2 domains.
          Grb10 is part of the Grb7 family of proteins which also
          includes Grb7, and Grb14. They are composed of an
          N-terminal Proline-rich domain, a Ras Associating-like
          (RA) domain, a Pleckstrin Homology (PH) domain, a
          phosphotyrosine interaction region (PIR, BPS) and a
          C-terminal SH2 domain. The SH2 domains of Grb7, Grb10
          and Grb14 preferentially bind to a different RTK. Grb10
          has been shown to interact with many different
          proteins, including the insulin and IGF1 receptors,
          platelet-derived growth factor (PDGF) receptor-beta,
          Ret, Kit, Raf1 and MEK1, and Nedd4. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 108

 Score = 44.2 bits (104), Expect = 2e-07
 Identities = 26/79 (32%), Positives = 47/79 (59%), Gaps = 8/79 (10%)

Query: 1  WFHGKISRETAESLLAPKE--DGLFLVRESTNFPQDF-MCVCFESKVEHYRV----KYKE 53
          WFHG+ISRE +  ++  +   DGLFL+R+S + P+ F + +C   K++++++       +
Sbjct: 7  WFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQ 66

Query: 54 AHLTIDD-EEFFENLAQLV 71
             ++DD    F +L QLV
Sbjct: 67 TFFSLDDGNTKFSDLIQLV 85


>gnl|CDD|198220 cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domain found in SH2
          domain-bearing protein kinases D and E (ShkD and ShkE).
           SH2-bearing genes cloned from Dictyostelium include
          two transcription factors, STATa and STATc, and a
          signaling factor, SHK1 (shkA). A database search of the
          Dictyostelium discoideum genome revealed two additional
          putative STAT sequences, dd-STATb and dd-STATd, and
          four additional putative SHK genes, dd-SHK2 (shkB),
          dd-SHK3 (shkC), dd-SHK4 (shkD), and dd-SHK5 (shkE).
          This model contains members of shkD and shkE. All of
          the SHK members are most closely related to the protein
          kinases found in plants.  However these kinases in
          plants are not conjugated to any SH2 or SH2-like
          sequences. Alignment data indicates that the SHK SH2
          domains carry some features of the STAT SH2 domains in
          Dictyostelium. When STATc's linker domain was used for
          a BLAST search, the sequence between the protein kinase
          domain and the SH2 domain (the linker) of SHK was
          recovered, suggesting a close relationship among these
          molecules within this region. SHK's linker domain is
          predicted to contain an alpha-helix which is indeed
          homologous to that of STAT. Based on the phylogenetic
          alignment, SH2 domains can be grouped into two
          categories, STAT-type and Src-type. SHK family members
          are in between, but are closer to the STAT-type which
          indicates a close relationship between SHK and STAT
          families in their SH2 domains and further supports the
          notion that SHKs linker-SH2 domain evolved from STAT or
          STATL (STAT-like Linker-SH2) domain found in plants. In
          SHK, STAT, and SPT6, the linker-SH2 domains all reside
          exclusively in the C-terminal regions.  In general SH2
          domains are involved in signal transduction.  They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 87

 Score = 42.9 bits (101), Expect = 3e-07
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF---MCVCFESKVEHYRVKYKE 53
          WFHG ISR+ AE  L  + +G FL+R S+  P+     +    +SK  H R+   +
Sbjct: 12 WFHGDISRDEAEKRLRGRPEGTFLIRLSSTDPKKTPFTISKKKKSKPVHKRISRID 67


>gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2)
          domain found in p85.  Phosphoinositide 3-kinases
          (PI3Ks) are essential for cell growth, migration, and
          survival. p110, the catalytic subunit, is composed of
          an adaptor-binding domain, a Ras-binding domain, a C2
          domain, a helical domain, and a kinase domain.  The
          regulatory unit is called p85 and is composed of an SH3
          domain, a RhoGap domain, a N-terminal SH2 (nSH2)
          domain, a inter SH2 (iSH2) domain, and C-terminal
          (cSH2) domain.  There are 2 inhibitory interactions
          between p110alpha and p85 of P13K: 1) p85 nSH2 domain
          with the C2, helical, and kinase domains of p110alpha
          and 2) p85 iSH2 domain with C2 domain of p110alpha.
          There are 3 inhibitory interactions between p110beta
          and p85 of P13K: 1) p85 nSH2 domain with the C2,
          helical, and kinase domains of p110beta, 2) p85 iSH2
          domain with C2 domain of p110alpha, and 3) p85 cSH2
          domain with the kinase domain of p110alpha. It is
          interesting to note that p110beta is oncogenic as a
          wild type protein while p110alpha lacks this ability.
          One explanation is the idea that the regulation of
          p110beta by p85 is unique because of the addition of
          inhibitory contacts from the cSH2 domain and the loss
          of contacts in the iSH2 domain. In general SH2 domains
          are involved in signal transduction. They typically
          bind pTyr-containing ligands via two surface pockets, a
          pTyr and hydrophobic binding pocket, allowing proteins
          with SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 104

 Score = 42.8 bits (101), Expect = 5e-07
 Identities = 19/46 (41%), Positives = 24/46 (52%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMCVCFESKVEH 46
          W  G I+R  AE LL  K DG FL+RES+        V    +V+H
Sbjct: 8  WLVGDINRTQAEELLRGKPDGTFLIRESSTQGCYACSVVCNGEVKH 53


>gnl|CDD|198265 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2 (SH2) domain
          found in Zeta-chain-associated protein kinase 70
          (ZAP-70).  ZAP-70 and Syk comprise a family of
          hematopoietic cell specific protein tyrosine kinases
          (PTKs) that are required for antigen and antibody
          receptor function. ZAP-70 is expressed in T and natural
          killer (NK) cells  and Syk is expressed in B cells,
          mast cells, polymorphonuclear leukocytes, platelets,
          macrophages, and immature T cells. They are required
          for the proper development of T and B cells, immune
          receptors, and activating NK cells. They consist of two
          N-terminal Src homology 2 (SH2) domains and a
          C-terminal kinase domain separated from the SH2 domains
          by a linker or hinge region. Phosphorylation of both
          tyrosine residues within the Immunoreceptor
          Tyrosine-based Activation Motifs (ITAM; consensus
          sequence Yxx[LI]x(7,8)Yxx[LI]) by the Src-family PTKs
          is required for efficient interaction of ZAP-70 and Syk
          with the receptor subunits and for receptor function.
          ZAP-70 forms two phosphotyrosine binding pockets, one
          of which is shared by both SH2 domains.  In Syk the two
          SH2 domains do not form such a phosphotyrosine-binding
          site.  The SH2 domains here are believed to function
          independently. In addition, the two SH2 domains of Syk
          display flexibility in their relative orientation,
          allowing Syk to accommodate a greater variety of
          spacing sequences between the ITAM phosphotyrosines and
          singly phosphorylated non-classical ITAM ligands. This
          model contains the C-terminus SH2 domains of Zap70. In
          general SH2 domains are involved in signal
          transduction.  They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 105

 Score = 41.8 bits (98), Expect = 1e-06
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 1  WFHGKISRETAESLL--APKEDGLFLVRESTNFPQDFMCVCFESKVEHYRV-KYKEAHLT 57
          W+HG I+R+ AE  L    + DG FL+RE        + + +   V HYR+ + K    +
Sbjct: 12 WYHGSIARDEAERRLYSGAQPDGKFLLRERKESGTYALSLVYGKTVYHYRIDQDKSGKYS 71

Query: 58 IDDEEFFENLAQLV 71
          I +   F+ L QLV
Sbjct: 72 IPEGTKFDTLWQLV 85


>gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1
          proteins.  Proto-oncogene vav is a member of the Dbl
          family of guanine nucleotide exchange factors (GEF) for
          the Rho family of GTP binding proteins.  All vavs are
          activated by tyrosine phosphorylation leading to their
          activation. There are three Vav mammalian family
          members: Vav1 which is expressed in the hematopoietic
          system, and Vav2 and Vav3 are more ubiquitously
          expressed. Vav1 plays a role in T-cell and B-cell
          development and activation.  It has been identified as
          the specific binding partner of Nef proteins from
          HIV-1, resulting in morphological changes, cytoskeletal
          rearrangements, and the JNK/SAPK signaling cascade,
          leading to increased levels of viral transcription and
          replication. Vav1 has been shown to interact with Ku70,
          PLCG1, Lymphocyte cytosolic protein 2, Janus kinase 2,
          SIAH2, S100B, Abl gene, ARHGDIB, SHB, PIK3R1, PRKCQ,
          Grb2, MAPK1, Syk, Linker of activated T cells, Cbl gene
          and EZH2. Vav proteins are involved in several
          processes that require cytoskeletal reorganization,
          such as the formation of the immunological synapse
          (IS), phagocytosis, platelet aggregation, spreading,
          and transformation.  Vavs function as guanine
          nucleotide exchange factors (GEFs) for the Rho/Rac
          family of GTPases. Vav family members have several
          conserved motifs/domains including: a leucine-rich
          region, a leucine-zipper, a calponin homology (CH)
          domain, an acidic domain, a Dbl-homology (DH) domain, a
          pleckstrin homology (PH) domain, a cysteine-rich
          domain, 2 SH3 domains, a proline-rich region, and a SH2
          domain.  Vavs are the only known Rho GEFs that have
          both the DH/PH motifs and SH2/SH3 domains in the same
          protein. The leucine-rich helix-loop-helix (HLH) domain
          is thought to be involved in protein heterodimerization
          with other HLH proteins and it may function as a
          negative regulator by forming inactive heterodimers.
          The CH domain  is usually involved in the association
          with filamentous actin, but in Vav it controls NFAT
          stimulation, Ca2+ mobilization, and its transforming
          activity. Acidic domains are involved in
          protein-protein interactions and contain regulatory
          tyrosines. The DH domain is a GDP-GTP exchange factor
          on Rho/Rac GTPases. The PH domain in involved in
          interactions with GTP-binding proteins, lipids and/or
          phosphorylated serine/threonine residues.  The SH3
          domain is involved in localization of proteins to
          specific sites within the cell interacting with protein
          with proline-rich sequences. The SH2 domain mediates a
          high affinity interaction with tyrosine phosphorylated
          proteins. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 103

 Score = 41.9 bits (98), Expect = 1e-06
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAHLTID 59
          W+ G + R  AES+LA + DG +LVR+      +F + + +  +V+H ++   E    I 
Sbjct: 7  WYAGPMERAGAESILANRSDGTYLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRIT 66

Query: 60 DEEFFENLAQLV 71
          +++ F  L +LV
Sbjct: 67 EKKAFRGLTELV 78


>gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the
          Src family of non-receptor tyrosine kinases.  The Src
          family kinases are nonreceptor tyrosine kinases that
          have been implicated in pathways regulating
          proliferation, angiogenesis, invasion and metastasis,
          and bone metabolism. It is thought that transforming
          ability of Src is linked to its ability to activate key
          signaling molecules in these pathways, rather than
          through direct activity. As such blocking Src
          activation has been a target for drug companies. Src
          family members can be divided into 3 groups based on
          their expression pattern: 1) Src, Fyn, and Yes; 2)
          Blk, Fgr, Hck, Lck, and Lyn; and 3) Frk-related kinases
          Frk/Rak and Iyk/Bsk Of these, cellular c-Src is the
          best studied and most frequently implicated in
          oncogenesis. The c-Src contains five distinct regions:
          a unique N-terminal domain, an SH3 domain, an SH2
          domain, a kinase domain and a regulatory tail, as do
          the other members of the family. Src exists in both
          active and inactive conformations. Negative regulation
          occurs through phosphorylation of Tyr, resulting in an
          intramolecular association between phosphorylated Tyr
          and the SH2 domain of SRC, which locks the protein in a
          closed conformation. Further stabilization of the
          inactive state occurs through interactions between the
          SH3 domain and a proline-rich stretch of residues
          within the kinase domain. Conversely, dephosphorylation
          of Tyr allows SRC to assume an open conformation. Full
          activity requires additional autophosphorylation of a
          Tyr residue within the catalytic domain. Loss of the
          negative-regulatory C-terminal segment has been shown
          to result in increased activity and transforming
          potential. Phosphorylation of the C-terminal Tyr
          residue by C-terminal Src kinase (Csk) and Csk homology
          kinase results in increased intramolecular interactions
          and consequent Src inactivation. Specific phosphatases,
          protein tyrosine phosphatase a (PTPa) and the
          SH-containing phosphatases SHP1/SHP2, have also been
          shown to take a part in Src activation. Src is also
          activated by direct binding of focal adhesion kinase
          (Fak) and Crk-associated substrate (Cas) to the SH2
          domain. SRC activity can also be regulated by numerous
          receptor tyrosine kinases (RTKs), such as Her2,
          epidermal growth factor receptor (EGFR), fibroblast
          growth factor receptor, platelet-derived growth factor
          receptor (PDGFR), and vascular endothelial growth
          factor receptor (VEGFR). In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 101

 Score = 41.8 bits (99), Expect = 1e-06
 Identities = 29/86 (33%), Positives = 40/86 (46%), Gaps = 21/86 (24%)

Query: 1  WFHGKISRETAES-LLAPK-EDGLFLVRESTNFPQDF-MCV-----CFESKVEHYRVKYK 52
          WF GKI R+ AE  LLAP    G FL+RES   P  + + V          V+HYR++  
Sbjct: 5  WFFGKIKRKDAEKLLLAPGNPRGTFLIRESETTPGAYSLSVRDGDDARGDTVKHYRIR-- 62

Query: 53 EAHLTIDDEEF-------FENLAQLV 71
               +D+  +       F  L +LV
Sbjct: 63 ----KLDNGGYYITTRATFPTLQELV 84


>gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the
          Vav family.  Vav proteins are involved in several
          processes that require cytoskeletal reorganization,
          such as the formation of the immunological synapse
          (IS), phagocytosis, platelet aggregation, spreading,
          and transformation.  Vavs function as guanine
          nucleotide exchange factors (GEFs) for the Rho/Rac
          family of GTPases.  Vav family members have several
          conserved motifs/domains including: a leucine-rich
          region, a leucine-zipper, a calponin homology (CH)
          domain, an acidic domain, a Dbl-homology (DH) domain, a
          pleckstrin homology (PH) domain, a cysteine-rich
          domain, 2 SH3 domains,  a proline-rich region, and a
          SH2 domain.  Vavs are the only known Rho GEFs that have
          both the DH/PH motifs and SH2/SH3 domains in the same
          protein. The leucine-rich helix-loop-helix (HLH) domain
          is thought to be involved in protein heterodimerization
          with other HLH proteins and it may function as a
          negative regulator by forming inactive heterodimers.
          The CH domain  is usually involved in the association
          with filamentous actin, but in Vav it controls NFAT
          stimulation, Ca2+ mobilization, and its transforming
          activity. Acidic domains are involved in
          protein-protein interactions and contain regulatory
          tyrosines. The DH domain is a GDP-GTP exchange factor
          on Rho/Rac GTPases. The PH domain in involved in
          interactions with GTP-binding proteins, lipids and/or
          phosphorylated serine/threonine residues. The SH3
          domain is involved in localization of proteins to
          specific sites within the cell interacting with protein
          with proline-rich sequences.  The SH2 domain mediates a
          high affinity interaction with tyrosine phosphorylated
          proteins.  There are three Vav mammalian family
          members: Vav1 which is expressed in the hematopoietic
          system, Vav2 and Vav3 are more ubiquitously expressed.
          The members here include insect and amphibian Vavs. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 102

 Score = 41.5 bits (98), Expect = 1e-06
 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAHLT-I 58
          WF G++ R+TAE+ L  + DG +LVR        + + + +   V+H +++ +   L  +
Sbjct: 7  WFVGEMERDTAENRLENRPDGTYLVRVRPQGETQYALSIKYNGDVKHMKIEQRSDGLYYL 66

Query: 59 DDEEFFENLAQLV 71
           +   F++L +LV
Sbjct: 67 SESRHFKSLVELV 79


>gnl|CDD|198214 cd10351, SH2_SH2D4B, Src homology 2 domain found in the SH2
          domain containing protein 4B (SH2D4B).  SH2D4B contains
          a single SH2 domain. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 103

 Score = 40.6 bits (95), Expect = 3e-06
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRES 28
          WFHG ISRE AE+LL    +G FLVR S
Sbjct: 9  WFHGIISREEAEALLMNATEGSFLVRVS 36


>gnl|CDD|198253 cd10390, SH2_SHD, Src homology 2 domain found in SH2
          domain-containing adapter proteins D (SHD).  The
          expression of SHD is restricted to the brain. SHD may
          be a physiological substrate of c-Abl and may function
          as an adapter protein in the central nervous system. It
          is also thought to be involved in apoptotic regulation.
          SHD contains five YXXP motifs, a substrate sequence
          preferred by Abl tyrosine kinases, in addition to a
          poly-proline rich region and a C-terminal SH2 domain.
          In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 98

 Score = 40.5 bits (94), Expect = 3e-06
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQD 34
          WFHG +SR  AE+LL+  ++G +LVR S   PQD
Sbjct: 3  WFHGPLSRADAENLLSLCKEGSYLVRLSETRPQD 36


>gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in
          Tensin-like proteins.  SH2 domain found in Tensin-like
          proteins. The Tensins are a family of intracellular
          proteins that interact with receptor tyrosine kinases
          (RTKs), integrins, and actin. They are thought act as
          signaling bridges between the extracellular space and
          the cytoskeleton. There are four homologues: Tensin1,
          Tensin2 (TENC1, C1-TEN), Tensin3 and Tensin4 (cten),
          all of which contain a C-terminal tandem SH2-PTB domain
          pairing, as well as actin-binding regions that may
          localize them to focal adhesions. The isoforms of
          Tensin2 and Tensin3 contain N-terminal C1 domains,
          which are atypical and not expected to bind to phorbol
          esters. Tensins 1-3 contain a phosphatase (PTPase) and
          C2 domain pairing which resembles PTEN (phosphatase and
          tensin homologue deleted on chromosome 10) protein.
          PTEN is a lipid phosphatase that dephosphorylates
          phosphatidylinositol 3,4,5-trisphosphate
          (PtdIns(3,4,5)P3) to yield phosphatidylinositol
          4,5-bisphosphate (PtdIns(4,5)P2). As PtdIns(3,4,5)P3 is
          the product of phosphatidylinositol 3-kinase (PI3K)
          activity, PTEN is therefore a key negative regulator of
          the PI3K pathway. Because of their PTEN-like domains,
          the Tensins may also possess phosphoinositide-binding
          or phosphatase capabilities. However, only Tensin2 and
          Tensin3 have the potential to be phosphatases since
          only their PTPase domains contain a cysteine residue
          that is essential for catalytic activity. In general
          SH2 domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 116

 Score = 40.5 bits (95), Expect = 5e-06
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF 35
          W+   ISR+ A +LL  K  G FLVR+ST +   +
Sbjct: 5  WYKPNISRDQAIALLKDKPPGTFLVRDSTTYKGAY 39


>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the
          Nck family.  Nck proteins are adaptors that modulate
          actin cytoskeleton dynamics by linking proline-rich
          effector molecules to tyrosine kinases or
          phosphorylated signaling intermediates. There are two
          members known in this family: Nck1 (Nckalpha) and Nck2
          (Nckbeta and Growth factor receptor-bound protein 4
          (Grb4)).  They are characterized by having 3 SH3
          domains and a C-terminal SH2 domain. Nck1 and Nck2 have
          overlapping functions as determined by gene knockouts.
          Both bind receptor tyrosine kinases and other
          tyrosine-phosphorylated proteins through their SH2
          domains. In addition they also bind distinct targets.
          Neuronal signaling proteins: EphrinB1, EphrinB2, and
          Disabled-1 (Dab-1) all bind to Nck-2 exclusively. And
          in the case of PDGFR, Tyr(P)751 binds to  Nck1 while
          Tyr(P)1009 binds to Nck2. Nck1 and Nck2 have a role in
          the infection process of enteropathogenic Escherichia
          coli (EPEC). Their SH3 domains are involved in
          recruiting and activating the N-WASP/Arp2/3 complex
          inducing actin polymerization resulting in the
          production of pedestals, dynamic bacteria-presenting
          protrusions of the plasma membrane. A similar thing
          occurs in the vaccinia virus where motile plasma
          membrane projections are formed beneath the virus.
          Recently it has been shown that the SH2 domains of both
          Nck1 and Nck2 bind the G-protein coupled receptor
          kinase-interacting protein 1 (GIT1) in a
          phosphorylation-dependent manner. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 93

 Score = 39.4 bits (92), Expect = 9e-06
 Identities = 19/65 (29%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 1  WFHGKISRETAESLLAPK-EDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAHLTI 58
          W++G+I+R  AE+LL     +G FL+R+S + P D+ + +    + +H++V+  +    I
Sbjct: 3  WYYGRITRHQAETLLNEHGHEGDFLIRDSESNPGDYSVSLKAPGRNKHFKVQVVDNVYCI 62

Query: 59 DDEEF 63
             +F
Sbjct: 63 GQRKF 67


>gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the
          Fyn-related kinase (Frk).  Frk is a member of the Src
          non-receptor type tyrosine kinase family of proteins.
          The Frk subfamily is composed of Frk/Rak and
          Iyk/Bsk/Gst. It is expressed primarily epithelial
          cells.  Frk is a nuclear protein and may function
          during G1 and S phase of the cell cycle and suppress
          growth. Unlike the other Src members it lacks a glycine
          at position 2 of SH4 which is important for addition of
          a myristic acid moiety that is involved in targeting
          Src PTKs to cellular membranes. FRK and SHB exert
          similar effects when overexpressed in rat
          phaeochromocytoma (PC12) and beta-cells, where both
          induce PC12 cell differentiation and beta-cell
          proliferation. Under conditions that cause beta-cell
          degeneration these proteins augment beta-cell
          apoptosis. The FRK-SHB responses involve FAK and
          insulin receptor substrates (IRS) -1 and -2. Frk has
          been demonstrated to interact with retinoblastoma
          protein. Frk regulates PTEN protein stability by
          phosphorylating PTEN, which in turn prevents PTEN
          degradation. Frk also plays a role in regulation of
          embryonal pancreatic beta cell formation. Frk has a
          unique N-terminal domain, an SH3 domain, an SH2 domain,
          a kinase domain and a regulatory tail, as do the other
          members of the family.  Like the other members of the
          Src family the SH2 domain in addition to binding the
          target, also plays an autoinhibitory role by binding to
          its activation loop. The tryosine involved is at the
          same site as the tyrosine involved in the
          autophosphorylation of Src. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 96

 Score = 39.5 bits (92), Expect = 9e-06
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 9/67 (13%)

Query: 1  WFHGKISRETAE-SLLAPK-EDGLFLVRESTNFPQDFMCVCFESK-VEHYRVKYKEAHLT 57
          WF G I R  AE  LL  + + G FL+RES +   +F     +   V+HYR++       
Sbjct: 5  WFFGAIKRADAEKQLLYSENQTGAFLIRESESQKGEFSLSVLDGGVVKHYRIR------R 58

Query: 58 IDDEEFF 64
          +D+  FF
Sbjct: 59 LDEGGFF 65


>gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck.  Nck
          proteins are adaptors that modulate actin cytoskeleton
          dynamics by linking proline-rich effector molecules to
          tyrosine kinases or phosphorylated signaling
          intermediates. There are two members known in this
          family: Nck1 (Nckalpha) and Nck2 (Nckbeta and Growth
          factor receptor-bound protein 4 (Grb4)). They are
          characterized by having 3 SH3 domains and a C-terminal
          SH2 domain. Nck1 and Nck2 have overlapping functions as
          determined by gene knockouts. Both bind receptor
          tyrosine kinases and other tyrosine-phosphorylated
          proteins through their SH2 domains. In addition they
          also bind distinct targets.  Neuronal signaling
          proteins: EphrinB1, EphrinB2, and Disabled-1 (Dab-1)
          all bind to Nck-2 exclusively. And in the case of
          PDGFR, Tyr(P)751 binds to  Nck1 while Tyr(P)1009 binds
          to Nck2. Nck1 and Nck2 have a role in the infection
          process of enteropathogenic Escherichia coli (EPEC).
          Their SH3 domains are involved in recruiting and
          activating the N-WASP/Arp2/3 complex inducing actin
          polymerization resulting in the production of
          pedestals, dynamic bacteria-presenting protrusions of
          the plasma membrane. A similar thing occurs in the
          vaccinia virus where motile plasma membrane projections
          are formed beneath the virus. Recently it has been
          shown that the SH2 domains of both Nck1 and Nck2 bind
          the G-protein coupled receptor kinase-interacting
          protein 1 (GIT1) in a phosphorylation-dependent manner.
          In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 97

 Score = 39.2 bits (91), Expect = 1e-05
 Identities = 22/65 (33%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 1  WFHGKISRETAESLLAPK-EDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAHLTI 58
          W++GK++R  AE  L  +  +G FL+R+S + P DF + +  + K +H++V+ KE    I
Sbjct: 3  WYYGKVTRHQAEMALNERGNEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKECVYCI 62

Query: 59 DDEEF 63
             +F
Sbjct: 63 GQRKF 67


>gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in
          Src-related kinase lacking C-terminal regulatory
          tyrosine and N-terminal myristoylation sites (srm).
          Srm is a nonreceptor protein kinase that has two SH2
          domains, a SH3 domain, and a kinase domain with a
          tyrosine residue for autophosphorylation.  However it
          lacks an N-terminal glycine for myristoylation and a
          C-terminal tyrosine which suppresses kinase activity
          when phosphorylated.  Srm is most similar to members of
          the Tec family who other members include: Tec, Btk/Emb,
          and Itk/Tsk/Emt. However Srm differs in its N-terminal
          unique domain it being much smaller than in the Tec
          family and is closer to Src. Srm is thought to be a new
          family of nonreceptor tyrosine kinases that may be
          redundant in function. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 79

 Score = 38.8 bits (90), Expect = 1e-05
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 1  WFHGKISRETAESLL--APKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRV-KYKEAHL 56
          W+   ISR  A+ LL   P E G FL+R S +    + + V  ++KV HYR+       L
Sbjct: 2  WYFSGISRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRICMAPSGSL 61

Query: 57 TIDDEEFFENLAQLV 71
           +     F  L +L+
Sbjct: 62 YLQKGRLFPGLEELL 76


>gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2
          domain-bearing protein kinases A and C (ShkA and ShkC).
           SH2-bearing genes cloned from Dictyostelium include
          two transcription factors, STATa and STATc, and a
          signaling factor, SHK1 (shkA). A database search of the
          Dictyostelium discoideum genome revealed two additional
          putative STAT sequences, dd-STATb and dd-STATd, and
          four additional putative SHK genes, dd-SHK2 (shkB),
          dd-SHK3 (shkC), dd-SHK4 (shkD), and dd-SHK5 (shkE).
          This model contains members of shkA and shkC.  All of
          the SHK members are most closely related to the protein
          kinases found in plants.  However these kinases in
          plants are not conjugated to any SH2 or SH2-like
          sequences. Alignment data indicates that the SHK SH2
          domains carry some features of the STAT SH2 domains in
          Dictyostelium. When STATc's linker domain was used for
          a BLAST search, the sequence between the protein kinase
          domain and the SH2 domain (the linker) of SHK was
          recovered, suggesting a close relationship among these
          molecules within this region. SHK's linker domain is
          predicted to contain an alpha-helix which is indeed
          homologous to that of STAT. Based on the phylogenetic
          alignment, SH2 domains can be grouped into two
          categories, STAT-type and Src-type. SHK family members
          are in between, but are closer to the STAT-type which
          indicates a close relationship between SHK and STAT
          families in their SH2 domains and further supports the
          notion that SHKs linker-SH2 domain evolved from STAT or
          STATL (STAT-like Linker-SH2) domain found in plants. In
          SHK, STAT, and SPT6, the linker-SH2 domains all reside
          exclusively in the C-terminal regions. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 113

 Score = 39.5 bits (92), Expect = 1e-05
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMC--VCFESKVEHYRV 49
          WFHG IS   +E+ L  K +G FLVR ST+ P  +    V     + H R+
Sbjct: 12 WFHGDISTSESENRLNGKPEGTFLVRFSTSEPGAYTISKVSKNGGISHQRI 62


>gnl|CDD|198199 cd09946, SH2_HSH2_like, Src homology 2 domain found in
          hematopoietic SH2 (HSH2) protein.  HSH2 is thought to
          function as an adapter protein involved in tyrosine
          kinase signaling. It may also be involved in regulating
          cytokine signaling and cytoskeletal reorganization in
          hematopoietic cells. HSH2 contains several putative
          protein-binding motifs, SH3-binding proline-rich
          regions, and phosphotyrosine sites, but lacks enzymatic
          motifs. HSH2 was found to interact with
          cytokine-regulated tyrosine kinase c-FES and an
          activated Cdc42-associated tyrosine kinase ACK1. HSH2
          binds c-FES through both its C-terminal region and its
          N-terminal region including the SH2 domain and binds
          ACK1 via its N-terminal proline-rich region. Both
          kinases bound and tyrosine-phosphorylated HSH2 in
          mammalian cells.  In general SH2 domains are involved
          in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 102

 Score = 39.1 bits (91), Expect = 1e-05
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRES 28
          WFHG ISRE AE++L  +  G FL+R S
Sbjct: 9  WFHGAISREAAENMLESQPLGSFLIRVS 36


>gnl|CDD|198269 cd10406, SH2_Vav2, Src homology 2 (SH2) domain found in the Vav2
          proteins.  Proto-oncogene vav is a member of the Dbl
          family of guanine nucleotide exchange factors (GEF) for
          the Rho family of GTP binding proteins. All vavs are
          activated by tyrosine phosphorylation leading to their
          activation. There are three Vav mammalian family
          members: Vav1 which is expressed in the hematopoietic
          system, and Vav2 and Vav3 are more ubiquitously
          expressed. Vav2 is a GEF for RhoA, RhoB and RhoG and
          may activate Rac1 and Cdc42. Vav2 has been shown to
          interact with CD19 and Grb2. Alternatively spliced
          transcript variants encoding different isoforms have
          been found for Vav2. Vav proteins are involved in
          several processes that require cytoskeletal
          reorganization, such as the formation of the
          immunological synapse (IS), phagocytosis, platelet
          aggregation, spreading, and transformation. Vavs
          function as guanine nucleotide exchange factors (GEFs)
          for the Rho/Rac family of GTPases. Vav family members
          have several conserved motifs/domains including: a
          leucine-rich region, a leucine-zipper, a calponin
          homology (CH) domain, an acidic domain, a Dbl-homology
          (DH) domain, a pleckstrin homology (PH) domain, a
          cysteine-rich domain, 2 SH3 domains, a proline-rich
          region, and a SH2 domain.  Vavs are the only known Rho
          GEFs that have both the DH/PH motifs and SH2/SH3
          domains in the same protein. The leucine-rich
          helix-loop-helix (HLH) domain is thought to be involved
          in protein heterodimerization with other HLH proteins
          and it may function as a negative regulator by forming
          inactive heterodimers. The CH domain  is usually
          involved in the association with filamentous actin, but
          in Vav it controls NFAT stimulation, Ca2+ mobilization,
          and its transforming activity. Acidic domains are
          involved in protein-protein interactions and contain
          regulatory tyrosines. The DH domain is a GDP-GTP
          exchange factor on Rho/Rac GTPases. The PH domain in
          involved in interactions with GTP-binding proteins,
          lipids and/or phosphorylated serine/threonine residues.
          The SH3 domain is involved in localization of proteins
          to specific sites within the cell interacting with
          protein with proline-rich sequences. The SH2 domain
          mediates a high affinity interaction with tyrosine
          phosphorylated proteins. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 103

 Score = 39.3 bits (91), Expect = 1e-05
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAHLTID 59
          WF G + R+  ++LL     G +L+RE     + F + + F  +V+H +V  K+  + I 
Sbjct: 7  WFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIHIT 66

Query: 60 DEEFFENLAQLV 71
          + + FE+L +LV
Sbjct: 67 EAKKFESLLELV 78


>gnl|CDD|199830 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain found in the SH2
          domain containing protein 2A and 7 (SH2D2A and SH2D7). 
          SH2D2A and SH7 both contain a single SH2 domain. In
          general SH2 domains are involved in signal
          transduction.  They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 77

 Score = 38.3 bits (89), Expect = 2e-05
 Identities = 17/28 (60%), Positives = 19/28 (67%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRES 28
          WFHG I+R  AE LL PK  G +LVR S
Sbjct: 2  WFHGFITRREAERLLEPKPQGCYLVRFS 29


>gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2)
          domain found in SH2 domain Phosphatases (SHP) proteins.
           The SH2 domain phosphatases (SHP-1, SHP-2/Syp,
          Drosophila corkscrew (csw), and Caenorhabditis elegans
          Protein Tyrosine Phosphatase (Ptp-2)) are cytoplasmic
          signaling enzymes. They are both targeted and regulated
          by interactions of their SH2 domains with
          phosphotyrosine docking sites. These proteins contain
          two SH2 domains (N-SH2, C-SH2) followed by a tyrosine
          phosphatase (PTP) domain, and a C-terminal extension.
          Shp1 and Shp2 have two tyrosyl phosphorylation sites in
          their C-tails, which are phosphorylated differentially
          by receptor and nonreceptor PTKs. Csw retains the
          proximal tyrosine and Ptp-2 lacks both sites.
          Shp-binding proteins include receptors, scaffolding
          adapters, and inhibitory receptors. Some of these bind
          both Shp1 and Shp2 while others bind only one. Most
          proteins that bind a Shp SH2 domain contain one or more
          immuno-receptor tyrosine-based inhibitory motifs
          (ITIMs): [IVL]xpYxx[IVL].  Shp1 N-SH2 domain blocks the
          catalytic domain and keeps the enzyme in the inactive
          conformation, and is thus believed to regulate the
          phosphatase activity of SHP-1. Its C-SH2 domain is
          thought to be involved in searching for phosphotyrosine
          activators. The SHP2 N-SH2 domain is a conformational
          switch; it either binds and inhibits the phosphatase,
          or it binds phosphoproteins and activates the enzyme.
          The C-SH2 domain contributes binding energy and
          specificity, but it does not have a direct role in
          activation. Csw SH2 domain function is essential, but
          either SH2 domain can fulfill this requirement. The
          role of the csw SH2 domains during Sevenless receptor
          tyrosine kinase (SEV) signaling is to bind Daughter of
          Sevenless rather than activated SEV.  Ptp-2 acts in
          oocytes downstream of sheath/oocyte gap junctions to
          promote major sperm protein (MSP)-induced MAP Kinase
          (MPK-1) phosphorylation. Ptp-2 functions in the oocyte
          cytoplasm, not at the cell surface to inhibit multiple
          RasGAPs, resulting in sustained Ras activation. It is
          thought that MSP triggers PTP-2/Ras activation and ROS
          production to stimulate MPK-1 activity essential for
          oocyte maturation and that secreted MSP domains and
          Cu/Zn superoxide dismutases function antagonistically
          to control ROS and MAPK signaling. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 99

 Score = 38.5 bits (90), Expect = 2e-05
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 1  WFHGKISRETAESLLAPK-EDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAHLTI 58
          WFH  IS   AE+LL  +  DG FL R S + P DF + V    +V H +++    +  +
Sbjct: 2  WFHPVISGIEAENLLKTRGVDGSFLARPSKSNPGDFTLSVRRGDEVTHIKIQNTGDYYDL 61

Query: 59 DDEEFFENLAQLV 71
             E F  L++LV
Sbjct: 62 YGGEKFATLSELV 74


>gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B
          adapter proteins (SH2B1, SH2B2, SH2B3).  SH2B2 (APS),
          like other members of the SH2B adapter protein family,
          contains a pleckstrin homology domain, at least one
          dimerization domain, and a C-terminal SH2 domain which
          binds to phosphorylated tyrosines in a variety of
          tyrosine kinases. SH2B1 and SH2B2  function in
          signaling pathways found downstream of growth hormone
          receptor and receptor tyrosine kinases, including the
          insulin, insulin-like growth factor-I (IGF-I),
          platelet-derived growth factor (PDGF), nerve growth
          factor, hepatocyte growth factor, and fibroblast growth
          factor receptors. SH2B2beta, a new isoform of SH2B2, is
          an endogenous inhibitor of SH2B1 and/or SH2B2
          (SH2B2alpha), negatively regulating insulin signaling
          and/or JAK2-mediated cellular responses. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 97

 Score = 38.1 bits (88), Expect = 3e-05
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 1  WFHGKISRETAESLL---APKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEA 54
          WFHG +SR  A  L+    P+  GLF++R+S   P ++ +   F+ K +H R+     
Sbjct: 10 WFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGH 67


>gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain
          found in Ras GTPase-activating protein 1 (GAP).  RasGAP
          is part of the GAP1 family of GTPase-activating
          proteins. The protein is located in the cytoplasm and
          stimulates the GTPase activity of normal RAS p21, but
          not its oncogenic counterpart. Acting as a suppressor
          of RAS function, the protein enhances the weak
          intrinsic GTPase activity of RAS proteins resulting in
          RAS inactivation, thereby allowing control of cellular
          proliferation and differentiation. Mutations leading to
          changes in the binding sites of either protein are
          associated with basal cell carcinomas. Alternative
          splicing results in two isoforms. The shorter isoform
          which lacks the N-terminal hydrophobic region, has the
          same activity, and is expressed in placental tissues.
          In general the longer isoform contains 2 SH2 domains, a
          SH3 domain, a pleckstrin homology (PH) domain, and a
          calcium-dependent phospholipid-binding C2 domain. The
          C-terminus contains the catalytic domain of RasGap
          which catalyzes the activation of Ras by hydrolyzing
          GTP-bound active Ras into an inactive GDP-bound form of
          Ras. This model contains the N-terminal SH2 domain. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 103

 Score = 38.3 bits (89), Expect = 3e-05
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 1  WFHGKISRETAES-LLAPKEDGLFLVRESTNFPQDFMCVCFESK--VEHYRV 49
          W+HG++ R  AE  L    + G +L+RES   P  F+ + F S+  V H+R+
Sbjct: 21 WYHGRLDRTIAEERLRQAGKLGSYLIRESDRRPGSFV-LSFLSRTGVNHFRI 71


>gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in
          suppressor of cytokine signaling (SOCS) family.  SH2
          domain found in SOCS proteins. SOCS was first
          recognized as a group of cytokine-inducible SH2 (CIS)
          domain proteins comprising eight family members in
          human (CIS and SOCS1-SOCS7). In addition to the SH2
          domain, SOCS proteins have a variable N-terminal domain
          and a conserved SOCS box in the C-terminal domain. SOCS
          proteins bind to a substrate via their SH2 domain. The
          prototypical members, CIS and SOCS1-SOCS3, have been
          shown to regulate growth hormone signaling in vitro and
          in a classic negative feedback response compete for
          binding at phosphotyrosine sites in JAK kinase and
          receptor pathways to displace effector proteins and
          target bound receptors for proteasomal degradation.
          Loss of SOCS activity results in excessive cytokine
          signaling associated with a variety of hematopoietic,
          autoimmune, and inflammatory diseases and certain
          cancers. Members (SOCS4-SOCS7) were identified by their
          conserved SOCS box, an adapter motif of 3 helices that
          associates substrate binding domains, such as the SOCS
          SH2 domain, ankryin, and WD40 with ubiquitin ligase
          components. These show limited cytokine induction. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 81

 Score = 37.2 bits (87), Expect = 4e-05
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRES 28
          W+ G I+R  AE LLA K +G FLVR+S
Sbjct: 2  WYWGGITRYEAEELLAGKPEGTFLVRDS 29


>gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in
          suppressor of cytokine signaling (SOCS) proteins.  SH2
          domain found in SOCS proteins. SOCS was first
          recognized as a group of cytokine-inducible SH2 (CIS)
          domain proteins comprising eight family members in
          human (CIS and SOCS1-SOCS7). In addition to the SH2
          domain, SOCS proteins have a variable N-terminal domain
          and a conserved SOCS box in the C-terminal domain. SOCS
          proteins bind to a substrate via their SH2 domain. The
          prototypical members, CIS and SOCS1-SOCS3, have been
          shown to regulate growth hormone signaling in vitro and
          in a classic negative feedback response compete for
          binding at phosphotyrosine sites in JAK kinase and
          receptor pathways to displace effector proteins and
          target bound receptors for proteasomal degradation.
          Loss of SOCS activity results in excessive cytokine
          signaling associated with a variety of hematopoietic,
          autoimmune, and inflammatory diseases and certain
          cancers. Members (SOCS4-SOCS7) were identified by their
          conserved SOCS box, an adapter motif of 3 helices that
          associates substrate binding domains, such as the SOCS
          SH2 domain, ankryin, and WD40 with ubiquitin ligase
          components. These show limited cytokine induction. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 36.9 bits (86), Expect = 7e-05
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMCVCF--ESKVEHYRVKYKE 53
          W+ G +S E AE +L+ K DG FLVR+S++  +    + F  +  V H R++  +
Sbjct: 12 WYWGPMSWEDAEKVLSNKPDGSFLVRDSSD-DRYIFSLSFRSQGSVHHTRIEQYQ 65


>gnl|CDD|198254 cd10391, SH2_SHE, Src homology 2 domain found in SH2
          domain-containing adapter protein E (SHE).  SHE is
          expressed in heart, lung, brain, and skeletal muscle.
          SHE contains two pTry protein binding domains, protein
          interaction domain (PID) and a SH2 domain, followed by
          a glycine-proline rich region, all of which are
          N-terminal to the phosphotyrosine binding (PTB) domain.
          In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 98

 Score = 36.9 bits (85), Expect = 8e-05
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRES 28
          W+HG ISR  AES L P ++  +LVR S
Sbjct: 3  WYHGSISRAEAESRLQPCKEASYLVRNS 30


>gnl|CDD|198205 cd10342, SH2_SAP1, Src homology 2 (SH2) domain found in
          SLAM-associated protein (SAP)1.  The X-linked
          lymphoproliferative syndrome (XLP) gene encodes SAP
          (also called SH2D1A/DSHP) a protein that consists of a
          5 residue N-terminus, a single SH2 domain, and a short
          25 residue C-terminal tail.  XLP is characterized by an
          extreme sensitivity to Epstein-Barr virus.  Both T and
          natural killer (NK) cell dysfunctions have been seen in
          XLP patients. SAP binds the cytoplasmic tail of
          Signaling lymphocytic activation molecule (SLAM), 2B4,
          Ly-9, and CD84. SAP is believed to function as a
          signaling inhibitor, by blocking or regulating binding
          of other signaling proteins. SAP and the SAP-like
          protein EAT-2 recognize the sequence motif TIpYXX[VI],
          which is found in the cytoplasmic domains of a
          restricted number of T, B, and NK cell surface
          receptors and are proposed to be natural inhibitors or
          regulators of the physiological role of a small family
          of receptors on the surface of these cells.  In general
          SH2 domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 103

 Score = 36.5 bits (84), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 8/79 (10%)

Query: 1  WFHGKISRETAESLLAPKE-DGLFLVRESTNFPQDF-MCVCFESKVEHYRV-KYKEAHLT 57
           +HGKISRET E LL     DG +L+R+S + P  + +CV +   +  YRV + +    +
Sbjct: 5  VYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWS 64

Query: 58 IDDE-----EFFENLAQLV 71
           +        +F  +  L+
Sbjct: 65 AETAPGVHKRYFRKIKNLI 83


>gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in
          SH2B adapter protein family.  The SH2B adapter protein
          family  has 3 members:  SH2B1 (SH2-B, PSM), SH2B2
          (APS), and SH2B3 (Lnk). SH2B family members contain a
          pleckstrin homology domain, at least one dimerization
          domain, and a C-terminal SH2 domain which binds to
          phosphorylated tyrosines in a variety of tyrosine
          kinases.  SH2B1 and SH2B2  function in signaling
          pathways found downstream of growth hormone receptor
          and receptor tyrosine kinases, including the insulin,
          insulin-like growth factor-I (IGF-I), platelet-derived
          growth factor (PDGF), nerve growth factor, hepatocyte
          growth factor, and fibroblast growth factor receptors.
          SH2B2beta, a new isoform of SH2B2, is an endogenous
          inhibitor of SH2B1 and/or SH2B2 (SH2B2alpha),
          negatively regulating insulin signaling and/or
          JAK2-mediated cellular responses. SH2B3 negatively
          regulates lymphopoiesis and early hematopoiesis. The
          lnk-deficiency results in enhanced production of B
          cells, and expansion as well as enhanced function of
          hematopoietic stem cells (HSCs), demonstrating negative
          regulatory functions of Sh2b3/Lnk in cytokine
          signaling. Sh2b3/Lnk also functions in responses
          controlled by cell adhesion and in crosstalk between
          integrin- and cytokine-mediated signaling. In general
          SH2 domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 97

 Score = 36.2 bits (84), Expect = 1e-04
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 1  WFHGKISRETAESLL---APKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRV 49
          WFHG +SR  A  L+        G+FLVR+S     +F +   F+ + +H R+
Sbjct: 10 WFHGTLSRSDAAQLVLHSGADGHGVFLVRQSETRRGEFVLTFNFQGRAKHLRL 62


>gnl|CDD|198279 cd10416, SH2_SH2D2A, Src homology 2 domain found in the SH2
          domain containing protein 2A (SH2D2A).  SH2D2A contains
          a single SH2 domain. In general SH2 domains are
          involved in signal transduction.  They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 102

 Score = 36.6 bits (84), Expect = 1e-04
 Identities = 17/28 (60%), Positives = 19/28 (67%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRES 28
          WFHG I+R  AE LL PK  G +LVR S
Sbjct: 9  WFHGFITRREAERLLEPKPQGCYLVRFS 36


>gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the
          Src oncogene at 42A (Src42).  Src42 is a member of the
          Src non-receptor type tyrosine kinase family of
          proteins. The integration of receptor tyrosine
          kinase-induced RAS and Src42 signals by Connector
          eNhancer of KSR (CNK) as a two-component input is
          essential for RAF activation in Drosophila. Src42 is
          present in a wide variety of organisms including:
          California sea hare, pea aphid, yellow fever mosquito,
          honey bee, Panamanian leafcutter ant, and sea urchin.
          Src42 has a unique N-terminal domain, an SH3 domain, an
          SH2 domain, a kinase domain and a regulatory tail, as
          do the other members of the family. Like the other
          members of the Src family the SH2 domain in addition to
          binding the target, also plays an autoinhibitory role
          by binding to its C-terminal tail.  In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 96

 Score = 36.3 bits (84), Expect = 1e-04
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 1  WFHGKISRETAES--LLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVK-YKEAHL 56
          W+ GKI R  AE   LL   E G FL+R+S +   D+ + V     V+HYR++   E   
Sbjct: 5  WYFGKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDYSLSVRDGDTVKHYRIRQLDEGGF 64

Query: 57 TIDDEEFFENLAQLV 71
           I     F  L +LV
Sbjct: 65 FIARRTTFRTLQELV 79


>gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in
          Tec-like proteins.  The Tec protein tyrosine kinase is
          the founding member of a family that includes Btk, Itk,
          Bmx, and Txk. The members have a PH domain, a
          zinc-binding motif, a SH3 domain, a SH2 domain, and a
          protein kinase catalytic domain. Btk is involved in
          B-cell receptor signaling with mutations in Btk
          responsible for X-linked agammaglobulinemia (XLA) in
          humans and X-linked immunodeficiency (xid) in mice. Itk
          is involved in T-cell receptor signaling. Tec is
          expressed in both T and B cells, and is thought to
          function in activated and effector T lymphocytes to
          induce the expression of genes regulated by NFAT
          transcription factors. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 104

 Score = 36.2 bits (84), Expect = 1e-04
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 1  WFHGKISRETAESLLAPK-EDGLFLVRESTNFP----QDFMCVCFESKVEHYRVK 50
          W+ G +SR+ AESLL  + ++G F+VR S+         F  V     V+HY +K
Sbjct: 8  WYVGDMSRQRAESLLKQEDKEGCFVVRNSSTKGLYTVSLFTKVPGSPHVKHYHIK 62


>gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2)
          domain found in p85.  Phosphoinositide 3-kinases
          (PI3Ks) are essential for cell growth, migration, and
          survival. p110, the catalytic subunit, is composed of
          an adaptor-binding domain, a Ras-binding domain, a C2
          domain, a helical domain, and a kinase domain.  The
          regulatory unit is called p85 and is composed of an SH3
          domain, a RhoGap domain, a N-terminal SH2 (nSH2)
          domain, an internal SH2 (iSH2) domain, and C-terminal
          (cSH2) domain.  There are 2 inhibitory interactions
          between p110alpha and p85 of P13K: (1) p85 nSH2 domain
          with the C2, helical, and kinase domains of p110alpha
          and (2) p85 iSH2 domain with C2 domain of p110alpha.
          There are 3 inhibitory interactions between p110beta
          and p85 of P13K: (1) p85 nSH2 domain with the C2,
          helical, and kinase domains of p110beta, (2) p85 iSH2
          domain with C2 domain of p110alpha, and (3) p85 cSH2
          domain with the kinase domain of p110alpha. It is
          interesting to note that p110beta is oncogenic as a
          wild type protein while p110alpha lacks this ability.
          One explanation is the idea that the regulation of
          p110beta by p85 is unique because of the addition of
          inhibitory contacts from the cSH2 domain and the loss
          of contacts in the iSH2 domain. In general SH2 domains
          are involved in signal transduction. They typically
          bind pTyr-containing ligands via two surface pockets, a
          pTyr and hydrophobic binding pocket, allowing proteins
          with SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 110

 Score = 36.1 bits (84), Expect = 2e-04
 Identities = 13/35 (37%), Positives = 19/35 (54%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF 35
          W+ G ISRE     +    DG FLVR+++    D+
Sbjct: 9  WYWGDISREEVNEKMRDTPDGTFLVRDASTMKGDY 43


>gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in
          feline sarcoma, Fujinami poultry sarcoma, and
          fes-related (Fes/Fps/Fer) proteins.  The Fps family
          consists of members Fps/Fes and Fer/Flk/Tyk3. They are
          cytoplasmic protein-tyrosine kinases implicated in
          signaling downstream from cytokines, growth factors and
          immune receptors.  Fes/Fps/Fer contains three
          coiled-coil regions, an SH2 (Src-homology-2) and a TK
          (tyrosine kinase catalytic) domain signature. Members
          here include: Fps/Fes, Fer, Kin-31, and  In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 90

 Score = 35.6 bits (83), Expect = 2e-04
 Identities = 20/75 (26%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRES---TNFPQDFM-CVCFESKVEHYRVKYKEAHL 56
          ++HG + RE AE LL  K DG FLVR++       +  +  V ++ K+ H+ +   +   
Sbjct: 8  YYHGLLPREDAEELL--KNDGDFLVRKTEPKGGGKRKLVLSVRWDGKIRHFVINRDDGGK 65

Query: 57 TIDDEEFFENLAQLV 71
             + + F+++++L+
Sbjct: 66 YYIEGKSFKSISELI 80


>gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in
          dual adaptor for phosphotyrosine and
          3-phosphoinositides ( DAPP1)/B lymphocyte adaptor
          molecule of 32 kDa (Bam32)-like proteins.  DAPP1/Bam32
          contains a putative myristoylation site at its
          N-terminus, followed by a SH2 domain, and a pleckstrin
          homology (PH) domain at its C-terminus. DAPP1 could
          potentially be recruited to the cell membrane by any of
          these domains. Its putative myristoylation site could
          facilitate the interaction of DAPP1 with the lipid
          bilayer. Its SH2 domain may also interact with
          phosphotyrosine residues on membrane-associated
          proteins such as activated tyrosine kinase receptors.
          And finally its PH domain exhibits a high-affinity
          interaction with the PtdIns(3,4,5)P(3) PtdIns(3,4)P(2)
          second messengers produced at the cell membrane
          following the activation of PI 3-kinases. DAPP1 is
          thought to interact with both tyrosine phosphorylated
          proteins and 3-phosphoinositides and therefore may play
          a role in regulating the location and/or activity of
          such proteins(s) in response to agonists that elevate
          PtdIns(3,4,5)P(3) and PtdIns(3,4)P(2). This protein is
          likely to play an important role in triggering signal
          transduction pathways that lie downstream from receptor
          tyrosine kinases and PI 3-kinase. It is likely that
          DAPP1 functions as an adaptor to recruit other proteins
          to the plasma membrane in response to extracellular
          signals. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 92

 Score = 35.1 bits (81), Expect = 3e-04
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 1  WFHGKISRETAES-LLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAHLTI 58
          W+HG ++R  AE+ LL+   DG +L+R S      F + V  +  V+H+ V+Y       
Sbjct: 8  WYHGNLTRHAAEALLLSNGVDGSYLLRNSNEGTGLFSLSVRAKDSVKHFHVEYTGYSFKF 67

Query: 59 DDEEF 63
             EF
Sbjct: 68 GFNEF 72


>gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2
          domain-containing adapter protein F (SHF).  SHF is
          thought to play a role in PDGF-receptor signaling and
          regulation of apoptosis. SHF is mainly expressed in
          skeletal muscle, brain, liver, prostate, testis, ovary,
          small intestine, and colon. SHF contains  four putative
          tyrosine phosphorylation sites and an SH2 domain. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 98

 Score = 35.0 bits (80), Expect = 4e-04
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF 35
          W+HG ISR  AE+LL   ++  +LVR S     DF
Sbjct: 3  WYHGAISRTDAENLLRLCKEASYLVRNSETSKNDF 37


>gnl|CDD|199832 cd10417, SH2_SH2D7, Src homology 2 domain found in the SH2 domain
          containing protein 7 (SH2D7).  SH2D7 contains a single
          SH2 domain. In general SH2 domains are involved in
          signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 102

 Score = 35.3 bits (81), Expect = 4e-04
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRES 28
          WFHG I+R+  E LL  K  G FL+R S
Sbjct: 9  WFHGFITRKQTEQLLRDKALGSFLIRLS 36


>gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in
          B-cell linker (BLNK) protein and SH2 domain-containing
          leukocyte protein of 76 kDa (SLP-76).  BLNK (also known
          as SLP-65 or BASH) is an important adaptor protein
          expressed in B-lineage cells. BLNK consists of a
          N-terminal sterile alpha motif (SAM) domain and a
          C-terminal SH2 domain.  BLNK is a cytoplasmic protein,
          but a part of it is bound to the plasma membrane
          through an N-terminal leucine zipper motif and
          transiently bound to a cytoplasmic domain of Iga
          through its C-terminal SH2 domain upon B cell antigen
          receptor (BCR)-stimulation. A non-ITAM phosphotyrosine
          in Iga is necessary for the binding with the BLNK SH2
          domain and/or for normal BLNK function in signaling and
          B cell activation. Upon phosphorylation BLNK binds Btk
          and PLCgamma2 through their SH2 domains and mediates
          PLCgamma2 activation by Btk. BLNK also binds other
          signaling molecules such as Vav, Grb2, Syk, and HPK1.
          BLNK has been shown to be necessary for BCR-mediated
          Ca2+ mobilization, for the activation of
          mitogen-activated protein kinases such as ERK, JNK, and
          p38 in a chicken B cell line DT40, and for activation
          of transcription factors such as NF-AT and NF-kappaB in
          human or mouse B cells. BLNK is involved in B cell
          development, B cell survival, activation,
          proliferation, and T-independent immune responses. BLNK
          is structurally homologous to SLP-76. SLP-76 and
          (linker for activation of T cells) LAT are
          adaptor/linker proteins in T cell antigen receptor
          activation and T cell development. BLNK interacts with
          many downstream signaling proteins that interact
          directly with both SLP-76 and  LAT.  New data suggest
          functional complementation of SLP-76 and LAT in T cell
          antigen receptor function with BLNK in BCR function. In
          general SH2 domains are involved in signal
          transduction.  They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 121

 Score = 34.6 bits (80), Expect = 9e-04
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query: 1  WFHGKISRETAES-LLAPKEDGLFLVRES----TNFPQDFMCVCFESKVEHYRVKYKEA 54
          W+ G I R+ AE  L    +DG FLVR+S    ++ P   M V +  KV + ++++ E 
Sbjct: 13 WYAGNIDRKEAEEALRRSNKDGTFLVRDSSGKDSSQPYTLM-VLYNDKVYNIQIRFLEN 70


>gnl|CDD|198275 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain found in SH2B
          adapter proteins (SH2B1, SH2B2, SH2B3).  SH2B3 (Lnk),
          like other members of the SH2B adapter protein family,
          contains a pleckstrin homology domain, at least one
          dimerization domain, and a C-terminal SH2 domain which
          binds to phosphorylated tyrosines in a variety of
          tyrosine kinases.  SH2B3 negatively regulates
          lymphopoiesis and early hematopoiesis. The
          lnk-deficiency results in enhanced production of B
          cells, and expansion as well as enhanced function of
          hematopoietic stem cells (HSCs), demonstrating negative
          regulatory functions of Sh2b3/Lnk in cytokine
          signaling. Sh2b3/Lnk also functions in responses
          controlled by cell adhesion and in crosstalk between
          integrin- and cytokine-mediated signaling. In general
          SH2 domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 97

 Score = 34.1 bits (78), Expect = 9e-04
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 1  WFHGKISRETAESLL---APKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKE 53
          WFHG ISR  A  L+    P   G+FLVR+S     ++ +   F+ + +H R+   E
Sbjct: 10 WFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGRAKHLRLSLTE 66


>gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found  in Tec
          protein, Bmx.  A member of the Tec protein tyrosine
          kinase Bmx is expressed in the endothelium of large
          arteries, fetal endocardium, adult endocardium of the
          left ventricle, bone marrow, lung, testis,
          granulocytes, myeloid cell lines, and prostate cell
          lines. Bmx is involved in the regulation of Rho and
          serum response factor (SRF). Bmx has been shown to
          interact with PAK1, PTK2, PTPN21, and RUFY1. Most of
          the Tec family members have a PH domain (Txk and the
          short (type 1) splice variant of Drosophila Btk29A are
          exceptions), a Tec homology (TH) domain, a SH3 domain,
          a SH2 domain, and a protein kinase catalytic domain.
          The TH domain consists of a Zn2+-binding Btk motif and
          a proline-rich region. The Btk motif is found in Tec
          kinases, Ras GAP, and IGBP.  It is crucial for the
          function of Tec PH domains. It is not present in Txk
          and the type 1 splice form of the Drosophila homolog.
          The proline-rich regions are highly conserved for the
          most part with the exception of Bmx whose residues
          surrounding the PXXP motif are not conserved (TH-like)
          and Btk29A  which is entirely unique with large numbers
          of glycine residues (TH-extended). Tec family members
          all lack a C-terminal tyrosine having an autoinhibitory
          function in its phosphorylated state. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 106

 Score = 33.8 bits (77), Expect = 0.001
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 8/79 (10%)

Query: 1  WFHGKISRETAESLLAPK-EDGLFLVRESTN---FPQDFMCVCFESK---VEHYRV-KYK 52
          WF G ISR  +E LL  K ++G F+VR S+    +           K   V+HY V    
Sbjct: 8  WFAGNISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNA 67

Query: 53 EAHLTIDDEEFFENLAQLV 71
          E  L + +   F+++ +L+
Sbjct: 68 ENKLYLAENYCFDSIPKLI 86


>gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in
          tyrosine kinase sarcoma (Src).  Src is a member of the
          Src non-receptor type tyrosine kinase family of
          proteins. Src is thought to play a role in the
          regulation of embryonic development and cell growth.
          Members here include v-Src and c-Src. v-Src lacks the
          C-terminal inhibitory phosphorylation site and is
          therefore constitutively active as opposed to normal
          cellular src (c-Src) which is only activated under
          certain circumstances where it is required (e.g. growth
          factor signaling). v-Src is an oncogene whereas c-Src
          is a proto-oncogene. c-Src consists of three domains,
          an N-terminal SH3 domain, a central SH2 domain and a
          tyrosine kinase domain. The SH2 and SH3 domains work
          together in the auto-inhibition of the kinase domain.
          The phosphorylation of an inhibitory tyrosine near the
          c-terminus of the protein produces a binding site for
          the SH2 domain which then facilitates binding of the
          SH3 domain to a polyproline site within the linker
          between the SH2 domain and the kinase domain. Binding
          of the SH3 domain inactivates the enzyme. This allows
          for multiple mechanisms for c-Src activation:
          dephosphorylation of the C-terminal tyrosine by a
          protein tyrosine phosphatase, binding of the SH2 domain
          by a competitive phospho-tyrosine residue, or
          competitive binding of a polyproline binding site to
          the SH3 domain.  Unlike most other Src members Src
          lacks cysteine residues in the SH4 domain that undergo
          palmitylation. Serine and threonine phosphorylation
          sites have also been identified in the unique domains
          of Src and are believed to modulate protein-protein
          interactions or regulate catalytic activity.
          Alternatively spliced forms of Src, which contain 6- or
          11-amino acid insertions in the SH3 domain, are
          expressed in CNS neurons. c-Src has a unique N-terminal
          domain, an SH3 domain, an SH2 domain, a kinase domain
          and a regulatory tail, as do the other members of the
          family. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 33.5 bits (76), Expect = 0.002
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 11/81 (13%)

Query: 1  WFHGKISRETAESLLAPKED--GLFLVRESTNFPQDFMCVCFES-------KVEHYRV-K 50
          W+ GKI+R  +E LL   E+  G FLVRES      + C+            V+HY++ K
Sbjct: 5  WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAY-CLSVSDFDNAKGLNVKHYKIRK 63

Query: 51 YKEAHLTIDDEEFFENLAQLV 71
                 I     F +L QLV
Sbjct: 64 LDSGGFYITSRTQFNSLQQLV 84


>gnl|CDD|198252 cd10389, SH2_SHB, Src homology 2 domain found in SH2
          domain-containing adapter protein B (SHB).  SHB
          functions in generating signaling compounds in response
          to tyrosine kinase activation. SHB contains
          proline-rich motifs, a phosphotyrosine binding (PTB)
          domain, tyrosine phosphorylation sites, and a SH2
          domain. SHB mediates certain aspects of
          platelet-derived growth factor (PDGF) receptor-,
          fibroblast growth factor (FGF) receptor-, neural growth
          factor (NGF) receptor TRKA-, T cell receptor-,
          interleukin-2 (IL-2) receptor- and focal adhesion
          kinase- (FAK) signaling. SRC-like FYN-Related Kinase
          FRK/RAK (also named BSK/IYK or GTK) and SHB regulate
          apoptosis, proliferation and differentiation. SHB
          promotes apoptosis and is also required for proper
          mitogenicity, spreading and tubular morphogenesis in
          endothelial cells. SHB also plays a role in preventing
          early cavitation of embryoid bodies and reduces
          differentiation to cells expressing albumin, amylase,
          insulin and glucagon. SHB is a multifunctional protein
          that has difference responses in different cells under
          various conditions. In general SH2 domains are involved
          in signal transduction.  They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 97

 Score = 33.1 bits (75), Expect = 0.002
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF 35
          W+HG ISR  AE+LL   ++  +LVR S     D+
Sbjct: 3  WYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDY 37


>gnl|CDD|198250 cd10387, SH2_SOCS6, Src homology 2 (SH2) domain found in
          suppressor of cytokine signaling (SOCS) proteins.  SH2
          domain found in SOCS proteins. SOCS was first
          recognized as a group of cytokine-inducible SH2 (CIS)
          domain proteins comprising eight family members in
          human (CIS and SOCS1-SOCS7). In addition to the SH2
          domain, SOCS proteins have a variable N-terminal domain
          and a conserved SOCS box in the C-terminal domain. SOCS
          proteins bind to a substrate via their SH2 domain. The
          prototypical members, CIS and SOCS1-SOCS3, have been
          shown to regulate growth hormone signaling in vitro and
          in a classic negative feedback response compete for
          binding at phosphotyrosine sites in JAK kinase and
          receptor pathways to displace effector proteins and
          target bound receptors for proteasomal degradation.
          Loss of SOCS activity results in excessive cytokine
          signaling associated with a variety of hematopoietic,
          autoimmune, and inflammatory diseases and certain
          cancers. Members (SOCS4-SOCS7) were identified by their
          conserved SOCS box, an adapter motif of 3 helices that
          associates substrate binding domains, such as the SOCS
          SH2 domain, ankryin, and WD40 with ubiquitin ligase
          components. These show limited cytokine induction. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 100

 Score = 33.3 bits (76), Expect = 0.002
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTN 30
          W+ G I+R  AE  LA   DG FLVR+S++
Sbjct: 12 WYWGPITRWEAEGKLANVPDGSFLVRDSSD 41


>gnl|CDD|198213 cd10350, SH2_SH2D4A, Src homology 2 domain found in the SH2
          domain containing protein 4A (SH2D4A).  SH2D4A contains
          a single SH2 domain. In general SH2 domains are
          involved in signal transduction.  They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 103

 Score = 33.4 bits (76), Expect = 0.002
 Identities = 14/47 (29%), Positives = 21/47 (44%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMCVCFESKVEHY 47
          WFHG ++ + A  LL     G FL+R S       +    E   +H+
Sbjct: 9  WFHGILTLKKANELLLSTMPGSFLIRVSEKIKGYALSYLSEEGCKHF 55


>gnl|CDD|198270 cd10407, SH2_Vav3, Src homology 2 (SH2) domain found in the Vav3
          proteins.  Proto-oncogene vav is a member of the Dbl
          family of guanine nucleotide exchange factors (GEF) for
          the Rho family of GTP binding proteins. All vavs are
          activated by tyrosine phosphorylation leading to their
          activation. There are three Vav mammalian family
          members: Vav1 which is expressed in the hematopoietic
          system, and Vav2 and Vav3 are more ubiquitously
          expressed. Vav3 preferentially activates RhoA, RhoG
          and, to a lesser extent, Rac1.  Alternatively spliced
          transcript variants encoding different isoforms have
          been described for this gene.  VAV3 has been shown to
          interact with Grb2. Vav proteins are involved in
          several processes that require cytoskeletal
          reorganization, such as the formation of the
          immunological synapse (IS), phagocytosis, platelet
          aggregation, spreading, and transformation. Vavs
          function as guanine nucleotide exchange factors (GEFs)
          for the Rho/Rac family of GTPases. Vav family members
          have several conserved motifs/domains including: a
          leucine-rich region, a leucine-zipper, a calponin
          homology (CH) domain, an acidic domain, a Dbl-homology
          (DH) domain, a pleckstrin homology (PH) domain, a
          cysteine-rich domain, 2 SH3 domains,  a proline-rich
          region, and a SH2 domain. Vavs are the only known Rho
          GEFs that have both the DH/PH motifs and SH2/SH3
          domains in the same protein. The leucine-rich
          helix-loop-helix (HLH) domain is thought to be involved
          in protein heterodimerization with other HLH proteins
          and it may function as a negative regulator by forming
          inactive heterodimers. The CH domain  is usually
          involved in the association with filamentous actin, but
          in Vav it controls NFAT stimulation, Ca2+ mobilization,
          and its transforming activity. Acidic domains are
          involved in protein-protein interactions and contain
          regulatory tyrosines.  The DH domain is a GDP-GTP
          exchange factor on Rho/Rac GTPases. The PH domain in
          involved in interactions with GTP-binding proteins,
          lipids and/or phosphorylated serine/threonine residues.
           The SH3 domain is involved in localization of proteins
          to specific sites within the cell interacting with
          protein with proline-rich sequences. The SH2 domain
          mediates a high affinity interaction with tyrosine
          phosphorylated proteins. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 103

 Score = 33.1 bits (75), Expect = 0.003
 Identities = 17/72 (23%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAHLTID 59
          W+ G + R  AE+ L  + +  +LVR  T    ++ + + + ++V+H ++  ++    I 
Sbjct: 7  WYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEVKHIKILTRDGFFHIA 66

Query: 60 DEEFFENLAQLV 71
          +   F++L +LV
Sbjct: 67 ENRKFKSLMELV 78


>gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck.  Nck
          proteins are adaptors that modulate actin cytoskeleton
          dynamics by linking proline-rich effector molecules to
          tyrosine kinases or phosphorylated signaling
          intermediates.  There are two members known in this
          family: Nck1 (Nckalpha) and Nck2 (Nckbeta and Growth
          factor receptor-bound protein 4 (Grb4)).  They are
          characterized by having 3 SH3 domains and a C-terminal
          SH2 domain. Nck1 and Nck2 have overlapping functions as
          determined by gene knockouts. Both bind receptor
          tyrosine kinases and other tyrosine-phosphorylated
          proteins through their SH2 domains. In addition they
          also bind distinct targets.  Neuronal signaling
          proteins: EphrinB1, EphrinB2, and Disabled-1 (Dab-1)
          all bind to Nck-2 exclusively. And in the case of
          PDGFR, Tyr(P)751 binds to  Nck1 while Tyr(P)1009 binds
          to Nck2. Nck1 and Nck2 have a role in the infection
          process of enteropathogenic Escherichia coli (EPEC).
          Their SH3 domains are involved in recruiting and
          activating the N-WASP/Arp2/3 complex inducing actin
          polymerization resulting in the production of
          pedestals, dynamic bacteria-presenting protrusions of
          the plasma membrane. A similar thing occurs in the
          vaccinia virus where motile plasma membrane projections
          are formed beneath the virus.  Recently it has been
          shown that the SH2 domains of both Nck1 and Nck2 bind
          the G-protein coupled receptor kinase-interacting
          protein 1 (GIT1) in a phosphorylation-dependent manner.
          In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 98

 Score = 32.7 bits (74), Expect = 0.003
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 1  WFHGKISRETAESLLAPKE-DGLFLVRESTNFPQDF-MCVCFESKVEHYRVKYKEAHLTI 58
          W++G ++R  AE  L  +  +G FL+R+S + P DF + +    K +H++V+  +    I
Sbjct: 3  WYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKAVGKNKHFKVQLVDNVYCI 62

Query: 59 DDEEF 63
              F
Sbjct: 63 GQRRF 67


>gnl|CDD|198202 cd10339, SH2_RIN_family, Src homology 2 (SH2) domain found in Ras
          and Rab interactor (RIN)-family.  The RIN (AKA Ras
          interaction/interference) family is composed of RIN1,
          RIN2 and RIN3. These proteins have multifunctional
          domains including SH2 and proline-rich (PR) domains in
          the N-terminal region, and RIN-family homology (RH),
          VPS9 and Ras-association (RA) domains in the C-terminal
          region. RIN proteins function as Rab5-GEFs, and RIN3
          specifically functions as a Rab31-GEF. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 101

 Score = 32.5 bits (74), Expect = 0.004
 Identities = 16/77 (20%), Positives = 33/77 (42%), Gaps = 6/77 (7%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMCVCFESK-----VEHYRVKYKEAH 55
          W   +++   A  +L  +  G FLVR+S       +C+          V  + +K     
Sbjct: 12 WLQLQLNAAEAAHMLQTEPPGTFLVRKSNTRQCQVLCMRLPEASGPAFVSEHYIKESPGG 71

Query: 56 LTIDDEEF-FENLAQLV 71
          ++++  E  F +L +L+
Sbjct: 72 VSLEGSELMFPDLFRLI 88


>gnl|CDD|198273 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain found in SH2B
          adapter proteins (SH2B1, SH2B2, SH2B3).  SH2B1 (SH2-B,
          PSM), like other members of the SH2B adapter protein
          family, contains a pleckstrin homology domain, at least
          one dimerization domain, and a C-terminal SH2 domain
          which binds to phosphorylated tyrosines in a variety of
          tyrosine kinases.  SH2B1 and SH2B2  function in
          signaling pathways found downstream of growth hormone
          receptor and receptor tyrosine kinases, including the
          insulin, insulin-like growth factor-I (IGF-I),
          platelet-derived growth factor (PDGF), nerve growth
          factor, hepatocyte growth factor, and fibroblast growth
          factor receptors. SH2B2beta, a new isoform of SH2B2, is
          an endogenous inhibitor of SH2B1 and/or SH2B2
          (SH2B2alpha), negatively regulating insulin signaling
          and/or JAK2-mediated cellular responses. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 97

 Score = 31.9 bits (72), Expect = 0.006
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1  WFHGKISRETAESLL---APKEDGLFLVRES-TNFPQDFMCVCFESKVEHYRVKYKE 53
          WFHG +SR  A  L+        G+FLVR+S T   +  +   F+ K +H R+   E
Sbjct: 10 WFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNE 66


>gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found  in Tec
          protein, Txk.  A member of the Tec protein tyrosine
          kinase Txk is expressed in thymus, spleen, lymph node,
          T lymphocytes, NK cells, mast cell lines, and myeloid
          cell line. Txk plays a role in TCR signal transduction,
          T cell development, and selection which is analogous to
          the function of Itk. Txk has been shown to interact
          with IFN-gamma. Unlike most of the Tec family members
          Txk lacks a  PH domain. Instead Txk has a unique region
          containing a palmitoylated cysteine string which has a
          similar membrane tethering function as the PH domain.
          Txk also has a zinc-binding motif, a SH3 domain, a SH2
          domain, and a protein kinase catalytic domain. The TH
          domain consists of a Zn2+-binding Btk motif and a
          proline-rich region. The Btk motif is found in Tec
          kinases, Ras GAP, and IGBP and crucial to the function
          of the PH domain. It is not present in Txk which is not
          surprising since it lacks a PH domain. The type 1
          splice form of the Drosophila homolog also lacks both
          the PH domain and the Btk motif. The proline-rich
          regions are highly conserved for the most part with the
          exception of Bmx whose residues surrounding the PXXP
          motif are not conserved (TH-like) and Btk29A  which is
          entirely unique with large numbers of glycine residues
          (TH-extended).  Tec family members all lack a
          C-terminal tyrosine having an autoinhibitory function
          in its phosphorylated state. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 106

 Score = 31.8 bits (72), Expect = 0.009
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 7/57 (12%)

Query: 1  WFHGKISRETAESLLAPK-EDGLFLVRESTNFPQDFMCVCFESK------VEHYRVK 50
          W+H  I+R  AE LL  + ++G F+VR+S +     + V   ++      ++HY++K
Sbjct: 8  WYHKNITRNQAERLLRQESKEGAFIVRDSRHLGSYTISVFTRARRSTEASIKHYQIK 64


>gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in
          Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene
          homolog, Fgr.  Fgr is a member of the Src non-receptor
          type tyrosine kinase family of proteins. The protein
          contains N-terminal sites for myristoylation and
          palmitoylation, a PTK domain, and SH2 and SH3 domains
          which are involved in mediating protein-protein
          interactions with phosphotyrosine-containing and
          proline-rich motifs, respectively. Fgr is expressed in
          B-cells and myeloid cells, localizes to plasma membrane
          ruffles, and functions as a negative regulator of cell
          migration and adhesion triggered by the beta-2 integrin
          signal transduction pathway. Multiple alternatively
          spliced variants, encoding the same protein, have been
          identified  Fgr has been shown to interact with
          Wiskott-Aldrich syndrome protein. Fgr has a unique
          N-terminal domain, an SH3 domain, an SH2 domain, a
          kinase domain and a regulatory tail, as do the other
          members of the family. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 101

 Score = 31.0 bits (70), Expect = 0.013
 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 2/30 (6%)

Query: 1  WFHGKISRETAE-SLLAP-KEDGLFLVRES 28
          W+ GKI R+ AE  LL+P    G FL+RES
Sbjct: 5  WYFGKIGRKDAERQLLSPGNPRGAFLIRES 34


>gnl|CDD|198208 cd10345, SH2_C-SH2_Zap70_Syk_like, C-terminal Src homology 2
          (SH2) domain found in Zeta-chain-associated protein
          kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk)
          proteins.  ZAP-70 and Syk comprise a family of
          hematopoietic cell specific protein tyrosine kinases
          (PTKs) that are required for antigen and antibody
          receptor function. ZAP-70 is expressed in T and natural
          killer (NK) cells and Syk is expressed in B cells, mast
          cells, polymorphonuclear leukocytes, platelets,
          macrophages, and immature T cells. They are required
          for the proper development of T and B cells, immune
          receptors, and activating NK cells. They consist of two
          N-terminal Src homology 2 (SH2) domains and a
          C-terminal kinase domain separated from the SH2 domains
          by a linker or hinge region. Phosphorylation of both
          tyrosine residues within the Immunoreceptor
          Tyrosine-based Activation Motifs (ITAM; consensus
          sequence Yxx[LI]x(7,8)Yxx[LI]) by the Src-family PTKs
          is required for efficient interaction of ZAP-70 and Syk
          with the receptor subunits and for receptor function.
          ZAP-70 forms two phosphotyrosine binding pockets, one
          of which is shared by both SH2 domains. In Syk the two
          SH2 domains do not form such a phosphotyrosine-binding
          site. The SH2 domains here are believed to function
          independently. In addition, the two SH2 domains of Syk
          display flexibility in their relative orientation,
          allowing Syk to accommodate a greater variety of
          spacing sequences between the ITAM phosphotyrosines and
          singly phosphorylated non-classical ITAM ligands. This
          model contains the C-terminus SH2 domains of both Syk
          and Zap70. In general SH2 domains are involved in
          signal transduction.  They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 95

 Score = 30.8 bits (69), Expect = 0.018
 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 1  WFHGKISRETAESLL--APKEDGLFLVRESTNFPQDFMCVCFESKVEHYRVKYKEA-HLT 57
          WFHGKISRE +E ++    K +G FL+R   N     +C+  E KV HYR+   +   L+
Sbjct: 2  WFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLS 61

Query: 58 IDDEEFFENLAQLV 71
          I + + F+ L QLV
Sbjct: 62 IPEGKKFDTLWQLV 75


>gnl|CDD|198285 cd10718, SH2_CIS, Src homology 2 (SH2) domain found in
          cytokine-inducible SH2-containing protein (CIS).  CIS
          family members are known to be cytokine-inducible
          negative regulators of cytokine signaling. The
          expression of the CIS gene can be induced by IL2, IL3,
          GM-CSF and EPO in hematopoietic cells.
          Proteasome-mediated degradation of this protein has
          been shown to be involved in the inactivation of the
          erythropoietin receptor. Suppressor of cytokine
          signalling (SOCS) was first recognized as a group of
          cytokine-inducible SH2 (CIS) domain proteins comprising
          eight family members in human (CIS and SOCS1-SOCS7).
          In addition to the SH2 domain, SOCS proteins have a
          variable N-terminal domain and a conserved SOCS box in
          the C-terminal domain. SOCS proteins bind to a
          substrate via their SH2 domain. The prototypical
          members, CIS and SOCS1-SOCS3, have been shown to
          regulate growth hormone signaling in vitro and in a
          classic negative feedback response compete for binding
          at phosphotyrosine sites in JAK kinase and receptor
          pathways to displace effector proteins and target bound
          receptors for proteasomal degradation. Loss of SOCS
          activity results in excessive cytokine signaling
          associated with a variety of hematopoietic, autoimmune,
          and inflammatory diseases and certain cancers. In
          general SH2 domains are involved in signal
          transduction.  They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 88

 Score = 29.7 bits (67), Expect = 0.034
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVREST 29
          W+ G I+   A   L    +G FLVR+S+
Sbjct: 6  WYWGSITASEAHQALQKAPEGTFLVRDSS 34


>gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes.
          Yes is a member of the Src non-receptor type tyrosine
          kinase family of proteins. Yes is the cellular homolog
          of the Yamaguchi sarcoma virus oncogene. In humans it
          is encoded by the YES1 gene which maps to chromosome 18
          and is in close proximity to thymidylate synthase. A
          corresponding Yes pseudogene has been found on
          chromosome 22. YES1 has been shown to interact with
          Janus kinase 2, CTNND1,RPL10, and Occludin. Yes1 has a
          unique N-terminal domain, an SH3 domain, an SH2 domain,
          a kinase domain and a regulatory tail, as do the other
          members of the family. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 101

 Score = 30.0 bits (67), Expect = 0.042
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 9/80 (11%)

Query: 1  WFHGKISRETAESLL--APKEDGLFLVRESTNFPQDFMCVCFE------SKVEHYRV-KY 51
          W+ GK+ R+ AE LL     + G+FLVRES      +     +        V+HY++ K 
Sbjct: 5  WYFGKMGRKDAERLLLNPGNQRGIFLVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKL 64

Query: 52 KEAHLTIDDEEFFENLAQLV 71
                I     F+ L +LV
Sbjct: 65 DNGGYYITTRAQFDTLQKLV 84


>gnl|CDD|198222 cd10359, SH2_SH3BP2, Src homology 2 domain found in c-Abl SH3
          domain-binding protein-2 (SH3BP2).  The adaptor protein
          3BP2/SH3BP2 plays a regulatory role in signaling from
          immunoreceptors. The protein-tyrosine kinase Syk
          phosphorylates 3BP2 which results in the activation of
          Rac1 through the interaction with the SH2 domain of
          Vav1 and induces the binding to the SH2 domain of the
          upstream protein-tyrosine kinase Lyn and enhances its
          kinase activity. 3BP2 has a positive regulatory role in
          IgE-mediated mast cell activation. In lymphocytes,
          engagement of T cell or B cell receptors triggers
          tyrosine phosphorylation of 3BP2. Suppression of the
          3BP2 expression by siRNA results in the inhibition of T
          cell or B cell receptor-mediated activation of NFAT.
          3BP2 is required for the proliferation of B cells and B
          cell receptor signaling. Mutations in the 3BP2 gene are
          responsible for cherubism resulting in excessive bone
          resorption in the jaw.  In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 101

 Score = 29.6 bits (66), Expect = 0.055
 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 9/73 (12%)

Query: 7  SRETAESLL---APK---EDGLFLVRESTNFPQDFMCVCFES--KVEHYRVKYKEAHLTI 58
          SRE  E L    +PK   +DGL+ +R S+      + V      KV +YR+  K+    +
Sbjct: 9  SRE-VERLFKATSPKGGPQDGLYCIRNSSTKGGKVLVVWDGGAEKVRNYRIFEKDCKFYL 67

Query: 59 DDEEFFENLAQLV 71
           + E F +L  LV
Sbjct: 68 HEREVFSSLGSLV 80


>gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like
          adaptor proteins.  SLAP belongs to the subfamily of
          adapter proteins that negatively regulate cellular
          signaling initiated by tyrosine kinases. It has a
          myristylated N-terminus, SH3 and SH2 domains with high
          homology to Src family tyrosine kinases, and a unique
          C-terminal tail, which is important for c-Cbl binding.
          SLAP negatively regulates platelet-derived growth
          factor (PDGF)-induced mitogenesis in fibroblasts and
          regulates F-actin assembly for dorsal ruffles
          formation. c-Cbl mediated SLAP inhibition towards actin
          remodeling. Moreover, SLAP enhanced PDGF-induced c-Cbl
          phosphorylation by SFK. In contrast, SLAP mitogenic
          inhibition was not mediated by c-Cbl, but it rather
          involved a competitive mechanism with SFK for
          PDGF-receptor (PDGFR) association and mitogenic
          signaling. Accordingly, phosphorylation of the Src
          mitogenic substrates Stat3 and Shc were reduced by
          SLAP. Thus, we concluded that SLAP regulates PDGFR
          signaling by two independent mechanisms: a competitive
          mechanism for PDGF-induced Src mitogenic signaling and
          a non-competitive mechanism for dorsal ruffles
          formation mediated by c-Cbl. SLAP is a hematopoietic
          adaptor containing Src homology (SH)3 and SH2 motifs
          and a unique carboxy terminus. Unlike c-Src, SLAP lacks
          a tyrosine kinase domain. Unlike c-Src, SLAP does not
          impact resorptive function of mature osteoclasts but
          induces their early apoptosis. SLAP negatively
          regulates differentiation of osteoclasts and
          proliferation of their precursors. Conversely, SLAP
          decreases osteoclast death by inhibiting activation of
          caspase 3. In general SH2 domains are involved in
          signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 104

 Score = 29.4 bits (66), Expect = 0.056
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 8/57 (14%)

Query: 1  WFHGKISRETAESLLA--PKEDGLFLVRESTNFPQDF-MCV-----CFESKVEHYRV 49
          W    +SRE AE LL     + G FL+RES      + + V          V+HYR+
Sbjct: 12 WLFEGLSREKAEELLMLPGNQVGSFLIRESETRRGCYSLSVRHRGSQSRDSVKHYRI 68


>gnl|CDD|198175 cd09919, SH2_STAT_family, Src homology 2 (SH2) domain found in
          signal transducer and activator of transcription (STAT)
          family.  STAT proteins mediate the signaling of
          cytokines and a number of growth factors from the
          receptors of these extracellular signaling molecules to
          the cell nucleus.  STATs are specifically
          phosphorylated by receptor-associated Janus kinases,
          receptor tyrosine kinases, or cytoplasmic tyrosine
          kinases. The phosphorylated STAT molecules dimerize by
          reciprocal binding of their SH2 domains to the
          phosphotyrosine residues. These dimeric STATs
          translocate into the nucleus, bind to specific DNA
          sequences, and regulate the transcription of their
          target genes.  However there are a number of
          unphosphorylated STATs that travel between the
          cytoplasm and nucleus and some STATs that exist as
          dimers in unstimulated cells that can exert biological
          functions independent of being activated by a receptor.
          There are seven mammalian STAT family members which
          have been identified: STAT1, STAT2, STAT3, STAT4, STAT5
          (STAT5A and STAT5B), and STAT6. There are 6 conserved
          domains in STAT: N-terminal domain (NTD), coiled-coil
          domain (CCD), DNA-binding domain (DBD), alpha-helical
          linker domain (LD), SH2 domain, and transactivation
          domain (TAD).  NTD is involved in dimerization of
          unphosphorylated STATs monomers and for the
          tetramerization between STAT1, STAT3, STAT4 and STAT5
          on promoters with two or more tandem STAT binding
          sites.  It also plays a role in promoting interactions
          with transcriptional co-activators such as CREB binding
          protein (CBP)/p300, as well as being important for
          nuclear import and deactivation of STATs involving
          tyrosine de-phosphorylation. The CCD interacts with
          other proteins, such as IFN regulatory protein 9
          (IRF-9/p48) with STAT1 and c-JUN with STAT3 and is also
          thought to participate in the negative regulation of
          these proteins. Distinct genes are bound to STATs via
          their DBD domain. This domain is also involved in
          nuclear translocation of activated STAT1 and STAT3
          phosphorylated dimers upon cytokine stimulation.  LD
          links the DNA-binding and SH2 domains and is important
          for the transcriptional activation of STAT1 in response
          to IFN-gamma. It also plays a role in protein-protein
          interactions and has also been implicated in the
          constitutive nucleocytoplasmic shuttling of
          unphosphorylated STATs in resting cells.  The SH2
          domain is necessary for receptor association and
          tyrosine phosphodimer formation. Residues within this
          domain may be particularly important for some cellular
          functions mediated by the STATs as well as residues
          adjacent to this domain.  The TAD interacts with
          several proteins, namely minichromosome maintenance
          complex component 5 (MCM5), breast cancer 1 (BRCA1) and
          CBP/p300. TAD also contains a modulatory
          phosphorylation site that regulates STAT activity and
          is necessary for maximal transcription of a number of
          target genes. The conserved tyrosine residue present in
          the C-terminus is crucial for dimerization via
          interaction with the SH2 domain upon the interaction of
          the ligand with the receptor. STAT activation by
          tyrosine phosphorylation also determines nuclear import
          and retention, DNA binding to specific DNA elements in
          the promoters of responsive genes, and transcriptional
          activation of STAT dimers. In addition to the SH2
          domain there is a coiled-coil domain, a DNA binding
          domain, and a transactivation domain in the STAT
          proteins. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 115

 Score = 29.1 bits (66), Expect = 0.091
 Identities = 14/25 (56%), Positives = 16/25 (64%)

Query: 4  GKISRETAESLLAPKEDGLFLVRES 28
          G IS+E AE LL  K  G FL+R S
Sbjct: 24 GFISKEEAEDLLKKKPPGTFLLRFS 48


>gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain
          found in Fyn isoform a like proteins.  Fyn is a member
          of the Src non-receptor type tyrosine kinase family of
          proteins. This cd contains the SH2 domain found in Fyn
          isoform a type proteins.  Fyn is involved in the
          control of cell growth and is required in the following
          pathways: T and B cell receptor signaling,
          integrin-mediated signaling, growth factor and cytokine
          receptor signaling, platelet activation, ion channel
          function, cell adhesion, axon guidance, fertilization,
          entry into mitosis, and differentiation of natural
          killer cells, oligodendrocytes and keratinocytes. The
          protein associates with the p85 subunit of
          phosphatidylinositol 3-kinase and interacts with the
          Fyn-binding protein. Alternatively spliced transcript
          variants encoding distinct isoforms exist. Fyn is
          primarily localized to the cytoplasmic leaflet of the
          plasma membrane. Tyrosine phosphorylation of target
          proteins by Fyn serves to either regulate target
          protein activity, and/or to generate a binding site on
          the target protein that recruits other signaling
          molecules. FYN has been shown to interact with a number
          of proteins including: BCAR1, Cbl, Janus kinase,
          nephrin, Sky, tyrosine kinase, Wiskott-Aldrich syndrome
          protein, and Zap-70. Fyn has a unique N-terminal
          domain, an SH3 domain, an SH2 domain, a kinase domain
          and a regulatory tail, as do the other members of the
          family. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 28.4 bits (63), Expect = 0.13
 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 9/80 (11%)

Query: 1  WFHGKISRETAESLLAPKED--GLFLVRESTNFPQDFMCVCFE------SKVEHYRV-KY 51
          W+ GK+ R+ AE  L    +  G FL+RES      +     +        V+HY++ K 
Sbjct: 5  WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKL 64

Query: 52 KEAHLTIDDEEFFENLAQLV 71
                I     FE L QLV
Sbjct: 65 DNGGYYITTRAQFETLQQLV 84


>gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain
          found in Fyn isoform b like proteins.  Fyn is a member
          of the Src non-receptor type tyrosine kinase family of
          proteins. This cd contains the SH2 domain found in Fyn
          isoform b type proteins. Fyn is involved in the control
          of cell growth and is required in the following
          pathways: T and B cell receptor signaling,
          integrin-mediated signaling, growth factor and cytokine
          receptor signaling, platelet activation, ion channel
          function, cell adhesion, axon guidance, fertilization,
          entry into mitosis, and differentiation of natural
          killer cells, oligodendrocytes and keratinocytes. The
          protein associates with the p85 subunit of
          phosphatidylinositol 3-kinase and interacts with the
          Fyn-binding protein. Alternatively spliced transcript
          variants encoding distinct isoforms exist. Fyn is
          primarily localized to the cytoplasmic leaflet of the
          plasma membrane. Tyrosine phosphorylation of target
          proteins by Fyn serves to either regulate target
          protein activity, and/or to generate a binding site on
          the target protein that recruits other signaling
          molecules. FYN has been shown to interact with a number
          of proteins including: BCAR1, Cbl, Janus kinase,
          nephrin, Sky, tyrosine kinase, Wiskott-Aldrich syndrome
          protein, and Zap-70. Fyn has a unique N-terminal
          domain, an SH3 domain, an SH2 domain, a kinase domain
          and a regulatory tail, as do the other members of the
          family. In general SH2 domains are involved in signal
          transduction.  They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 28.1 bits (62), Expect = 0.21
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 9/80 (11%)

Query: 1  WFHGKISRETAESLLAP--KEDGLFLVRESTNFPQDFMCVCFE------SKVEHYRV-KY 51
          W+ GK+ R+ AE  L       G FL+RES      +     +        V+HY++ K 
Sbjct: 5  WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKL 64

Query: 52 KEAHLTIDDEEFFENLAQLV 71
                I     FE L QLV
Sbjct: 65 DNGGYYITTRAQFETLQQLV 84


>gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn.
          Fyn is a member of the Src non-receptor type tyrosine
          kinase family of proteins. Fyn is involved in the
          control of cell growth and is required in the following
          pathways: T and B cell receptor signaling,
          integrin-mediated signaling, growth factor and cytokine
          receptor signaling, platelet activation, ion channel
          function, cell adhesion, axon guidance, fertilization,
          entry into mitosis, and differentiation of natural
          killer cells, oligodendrocytes and keratinocytes. The
          protein associates with the p85 subunit of
          phosphatidylinositol 3-kinase and interacts with the
          Fyn-binding protein. Alternatively spliced transcript
          variants encoding distinct isoforms exist. Fyn is
          primarily localized to the cytoplasmic leaflet of the
          plasma membrane. Tyrosine phosphorylation of target
          proteins by Fyn serves to either regulate target
          protein activity, and/or to generate a binding site on
          the target protein that recruits other signaling
          molecules. FYN has been shown to interact with a number
          of proteins including: BCAR1, Cbl, Janus kinase,
          nephrin, Sky, tyrosine kinase, Wiskott-Aldrich syndrome
          protein, and Zap-70. Fyn has a unique N-terminal
          domain, an SH3 domain, an SH2 domain, a kinase domain
          and a regulatory tail, as do the other members of the
          family. In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 28.1 bits (62), Expect = 0.22
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 9/80 (11%)

Query: 1  WFHGKISRETAESLLAP--KEDGLFLVRESTNFPQDFMCVCFE------SKVEHYRV-KY 51
          W+ GK+ R+ AE  L       G FL+RES      +     +        V+HY++ K 
Sbjct: 5  WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKL 64

Query: 52 KEAHLTIDDEEFFENLAQLV 71
                I     FE L QLV
Sbjct: 65 DNGGYYITTRAQFETLQQLV 84


>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x)
           SDRs.  Ketoreductase, a module of the multidomain
           polyketide synthase (PKS), has 2 subdomains, each
           corresponding  to a SDR family monomer. The C-terminal
           subdomain catalyzes the NADPH-dependent reduction of the
           beta-carbonyl of a polyketide to a hydroxyl group, a
           step in the biosynthesis of polyketides, such as
           erythromycin. The N-terminal subdomain, an interdomain
           linker, is a truncated Rossmann fold which acts to
           stabilizes the catalytic subdomain. Unlike typical SDRs,
           the isolated domain does not oligomerize but is composed
           of 2 subdomains, each resembling an SDR monomer. The
           active site resembles that of typical SDRs, except that
           the usual positions of the catalytic Asn and Tyr are
           swapped, so that the canonical YXXXK motif changes to
           YXXXN. Modular PKSs are multifunctional structures in
           which the makeup recapitulates that found in (and may
           have evolved from) FAS. Polyketide synthesis also
           proceeds via the addition of 2-carbon units as in fatty
           acid synthesis. The complex SDR NADP-binding motif,
           GGXGXXG, is often present, but is not strictly conserved
           in each instance of the module. This subfamily includes
           both KR domains of the Bacillus subtilis Pks J,-L, and
           PksM, and all three KR domains of PksN, components of
           the megacomplex bacillaene synthase, which synthesizes
           the antibiotic bacillaene. SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet),
           an NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Classical SDRs are typically about
           250 residues long, while extended SDRs are approximately
           350 residues. Sequence identity between different SDR
           enzymes are typically in the 15-30% range, but the
           enzymes share the Rossmann fold NAD-binding motif and
           characteristic NAD-binding and catalytic sequence
           patterns. These enzymes catalyze a wide range of
           activities including the metabolism of steroids,
           cofactors, carbohydrates, lipids, aromatic compounds,
           and amino acids, and act in redox sensing. Classical
           SDRs have an TGXXX[AG]XG cofactor binding motif and a
           YXXXK active site motif, with the Tyr residue of the
           active site motif serving as a critical catalytic
           residue (Tyr-151, human prostaglandin dehydrogenase
           (PGDH) numbering). In addition to the Tyr and Lys, there
           is often an upstream Ser (Ser-138, PGDH numbering)
           and/or an Asn (Asn-107, PGDH numbering) contributing to
           the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type KRs have a TGXXXGX(1-2)G
           NAD(P)-binding motif. Some atypical SDRs have lost
           catalytic activity and/or have an unusual NAD(P)-binding
           motif and missing or unusual active site residues.
           Reactions catalyzed within the SDR family include
           isomerization, decarboxylation, epimerization, C=N bond
           reduction, dehydratase activity, dehalogenation,
           Enoyl-CoA reduction, and carbonyl-alcohol
           oxidoreduction.
          Length = 436

 Score = 28.1 bits (63), Expect = 0.32
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 6   ISRETAESL---LAPKEDGLF-LVRESTNFPQDFMCVCFES 42
           ++++TAE     LAPK DGL  L +   + P DF  V F S
Sbjct: 304 LAQKTAEDFEAVLAPKVDGLLNLAQALADEPLDF-FVLFSS 343


>gnl|CDD|198258 cd10395, SH2_RIN3, Src homology 2 (SH2) domain found in Ras and
          Rab interactor 3 (RIN3)-like proteins.  RIN3, a member
          of the RIN (AKA Ras interaction/interference) family,
          have multifunctional domains including SH2 and
          proline-rich (PR) domains in the N-terminal region, and
          RIN-family homology (RH), VPS9 and Ras-association (RA)
          domains in the C-terminal region. RIN proteins function
          as Rab5-GEFs. RIN3 stimulated the formation of
          GTP-bound Rab31, a Rab5-subfamily GTPase, and formed
          enlarged vesicles and tubular structures, where it
          colocalized with Rab31. Transferrin appeared to be
          transported partly through the RIN3-positive vesicles
          to early endosomes. RIN3 interacts via its Pro-rich
          domain with amphiphysin II, which contains SH3 domain
          and participates in receptor-mediated endocytosis.
          RIN3, a Rab5 and Rab31 GEF, plays an important role in
          the transport pathway from plasma membrane to early
          endosomes. Mutations in the region between the SH2 and
          RH domain of RIN3 specifically abolished its GEF action
          on Rab31, but not Rab5. RIN3 was also found to
          partially translocate the cation-dependent mannose
          6-phosphate receptor from the trans-Golgi network to
          peripheral vesicles and that this is dependent on its
          Rab31-GEF activity. These data indicate that RIN3
          specifically acts as a GEF for Rab31. In general SH2
          domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 101

 Score = 26.7 bits (59), Expect = 0.56
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMCVCFESK-----VEHYRVKYKEAH 55
          W    +++  A  +L  +  G+FLVR  +N  Q  +CV F S      V  Y +K +++ 
Sbjct: 12 WLQLGMNQAEAARILHKEVAGMFLVRRDSNSKQMVLCVHFPSNESSAEVLEYPIKEEKSI 71

Query: 56 LTIDDEEF-FENLAQLV 71
          L ++     FE++ +L+
Sbjct: 72 LYLEGSVLVFEDIFKLI 88


>gnl|CDD|198237 cd10374, SH2_STAT3, Src homology 2 (SH2) domain found in signal
          transducer and activator of transcription (STAT) 3
          proteins.  STAT3 encoded by this gene is a member of
          the STAT protein family. STAT3 mediates the expression
          of a variety of genes in response to cell stimuli, and
          plays a key role in many cellular processes such as
          cell growth and apoptosis. The small GTPase Rac1
          regulates the activity of STAT3 and PIAS3 inhibits it.
          Three alternatively spliced transcript variants
          encoding distinct isoforms have been described. STAT 3
          activation is required for self-renewal of embryonic
          stem cells (ESCs) and is essential for the
          differentiation of the TH17 helper T cells. Mutations
          in the STAT3 gene result in Hyperimmunoglobulin E
          syndrome and human cancers. STAT3 has been shown to
          interact with Androgen receptor, C-jun, ELP2, EP300,
          Epidermal growth factor receptor, Glucocorticoid
          receptor, HIF1A, Janus kinase 1, KHDRBS1, Mammalian
          target of rapamycin, MyoD, NDUFA13, NFKB1, Nuclear
          receptor coactivator 1, Promyelocytic leukemia protein,
          RAC1, RELA, RET proto-oncogene, RPA2, Src, STAT1, and
          TRIP10. STAT proteins mediate the signaling of
          cytokines and a number of growth factors from the
          receptors of these extracellular signaling molecules to
          the cell nucleus. STATs are specifically phosphorylated
          by receptor-associated Janus kinases, receptor tyrosine
          kinases, or cytoplasmic tyrosine kinases. The
          phosphorylated STAT molecules dimerize by reciprocal
          binding of their SH2 domains to the phosphotyrosine
          residues. These dimeric STATs translocate into the
          nucleus, bind to specific DNA sequences, and regulate
          the transcription of their target genes.  However there
          are a number of unphosphorylated STATs that travel
          between the cytoplasm and nucleus and some STATs that
          exist as dimers in unstimulated cells that can exert
          biological functions independent of being activated.
          There are seven mammalian STAT family members which
          have been identified: STAT1, STAT2, STAT3, STAT4, STAT5
          (STAT5A and STAT5B), and STAT6. There are 6 conserved
          domains in STAT: N-terminal domain (NTD), coiled-coil
          domain (CCD), DNA-binding domain (DBD), alpha-helical
          linker domain (LD), SH2 domain, and transactivation
          domain (TAD).  NTD is involved in dimerization of
          unphosphorylated STATs monomers and for the
          tetramerization between STAT1, STAT3, STAT4 and STAT5
          on promoters with two or more tandem STAT binding
          sites.  It also plays a role in promoting interactions
          with transcriptional co-activators such as CREB binding
          protein (CBP)/p300, as well as being important for
          nuclear import and deactivation of STATs involving
          tyrosine de-phosphorylation. CCD interacts with other
          proteins, such as IFN regulatory protein 9 (IRF-9/p48)
          with STAT1 and c-JUN with STAT3 and is also thought to
          participate in the negative regulation of these
          proteins. Distinct genes are bound to STATs via their
          DBD domain. This domain is also involved in nuclear
          translocation of activated STAT1 and STAT3
          phosphorylated dimers upon cytokine stimulation.  LD
          links the DNA-binding and SH2  domains and is important
          for the transcriptional activation of STAT1 in response
          to IFN-gamma. It also plays a role in protein-protein
          interactions and has also been implicated in the
          constitutive nucleocytoplasmic shuttling of
          unphosphorylated STATs in resting cells. The SH2 domain
          is necessary for receptor association and tyrosine
          phosphodimer formation. Residues within this domain may
          be particularly important for some cellular functions
          mediated by the STATs as well as residues adjacent to
          this domain.  The TAD interacts with several proteins,
          namely minichromosome maintenance complex component 5
          (MCM5), breast cancer 1 (BRCA1) and CBP/p300. TAD also
          contains a modulatory phosphorylation site that
          regulates STAT activity and is necessary for maximal
          transcription of a number of target genes. The
          conserved tyrosine residue present in the C-terminus is
          crucial for dimerization via interaction with the SH2
          domain upon the interaction of the ligand with the
          receptor. STAT activation by tyrosine phosphorylation
          also determines nuclear import and retention, DNA
          binding to specific DNA elements in the promoters of
          responsive genes, and transcriptional activation of
          STAT dimers. In addition to the SH2 domain there is a
          coiled-coil domain, a DNA binding domain, and a
          transactivation domain in the STAT proteins. In general
          SH2 domains are involved in signal transduction.  They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 162

 Score = 26.5 bits (58), Expect = 0.90
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 4  GKISRETAESLLAPKEDGLFLVRES 28
          G IS+E   ++L+ K  G FL+R S
Sbjct: 34 GFISKERERAILSTKPPGTFLLRFS 58


>gnl|CDD|198259 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain found in Tec
          protein, IL2-inducible T-cell kinase (Itk).  A member
          of the Tec protein tyrosine kinase Itk is expressed
          thymus, spleen, lymph node, T lymphocytes, NK and mast
          cells. It plays a role in T-cell proliferation and
          differentiation, analogous to Tec family kinases Txk.
          Itk  has been shown to interact with Fyn,
          Wiskott-Aldrich syndrome protein, KHDRBS1, PLCG1,
          Lymphocyte cytosolic protein 2, Linker of activated T
          cells, Karyopherin alpha 2, Grb2, and Peptidylprolyl
          isomerase A. Most of the Tec family members have a PH
          domain (Txk and the short (type 1) splice variant of
          Drosophila Btk29A are exceptions), a Tec homology (TH)
          domain, a SH3 domain, a SH2 domain, and a protein
          kinase catalytic domain. The TH domain consists of a
          Zn2+-binding Btk motif and a proline-rich region. The
          Btk motif is found in Tec kinases, Ras GAP, and IGBP.
          It is crucial for the function of Tec PH domains and
          it's lack of presence in Txk is not surprising since it
          lacks a PH domain. The type 1 splice form of the
          Drosophila homolog also lacks both the PH domain and
          the Btk motif. The proline-rich regions are highly
          conserved for the most part with the exception of Bmx
          whose residues surrounding the PXXP motif are not
          conserved (TH-like) and Btk29A  which is entirely
          unique with large numbers of glycine residues
          (TH-extended).  Tec family members all lack a
          C-terminal tyrosine having an autoinhibitory function
          in its phosphorylated state. In general SH2 domains are
          involved in signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 108

 Score = 26.3 bits (58), Expect = 1.1
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 3/32 (9%)

Query: 1  WFHGKISRETAESLLAPKED--GLFLVRESTN 30
          W++  I+R  AE LL   E   G F+VR+S+ 
Sbjct: 8  WYNKNINRSKAEKLLR-DEGKEGGFMVRDSSQ 38


>gnl|CDD|187658 cd08955, KR_2_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of
           fatty acid synthase (FAS), subgroup 2, complex (x).
           Ketoreductase, a module of the multidomain polyketide
           synthase, has 2 subdomains, each corresponding  to a
           short-chain dehydrogenases/reductase (SDR) family
           monomer. The C-terminal subdomain catalyzes the
           NADPH-dependent reduction of the beta-carbonyl of a
           polyketide to a hydroxyl group, a step in the
           biosynthesis of polyketides, such as erythromycin.  The
           N-terminal subdomain, an interdomain linker, is a
           truncated Rossmann fold which acts to stabilizes the
           catalytic subdomain. Unlike typical SDRs, the isolated
           domain does not oligomerizes but is composed of 2
           subdomains, each resembling an SDR monomer.  In some
           instances,  as in porcine FAS, an enoyl reductase (a
           Rossman fold NAD binding domain of the MDR family)
           module is inserted between the sub-domains.  The active
           site resembles that of typical SDRs, except that the
           usual positions of the catalytic asparagine and tyrosine
           are swapped, so that the canonical YXXXK motif changes
           to YXXXN. Modular polyketide synthases are
           multifunctional structures in which the makeup
           recapitulates that found in (and may have evolved from)
           fatty acid synthase.   In some instances, such as
           porcine FAS , an enoyl reductase module is inserted
           between the sub-domains. Fatty acid synthesis occurs via
           the stepwise elongation of a chain (which is attached to
           acyl carrier protein, ACP) with 2-carbon units.
           Eukaryotic systems consists of large, multifunctional
           synthases (type I) while bacterial, type II systems, use
           single function proteins. Fungal fatty acid synthesis
           uses dodecamer of 6 alpha and 6 beta subunits. In
           mammalian type FAS cycles,  ketoacyl synthase forms
           acetoacetyl-ACP which is reduced by the NADP-dependent
           beta-ketoacyl reductase (KR), forming
           beta-hydroxyacyl-ACP, which is in turn dehydrated by
           dehydratase to a beta-enoyl intermediate, which is
           reduced by NADP-dependent beta-enoyl reductase (ER).
           Polyketide syntheses also proceeds via the addition of
           2-carbon units as in fatty acid synthesis.  The complex
           SDR NADP binding motif, GGXGXXG, is often present, but
           is not strictly conserved in each instance of the
           module. This subfamily includes the KR domain of the
           Lyngbya majuscule Jam J, -K, and #L  which are encoded
           on the jam gene cluster and are involved in the
           synthesis of the Jamaicamides (neurotoxins); Lyngbya
           majuscule Jam P belongs to a different KR_FAS_SDR_x
           subfamily. SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRs are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes catalyze a wide range of activities including
           the metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           prostaglandin dehydrogenase (PGDH) numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107,
           PGDH numbering) contributing to the active site; while
           substrate binding is in the C-terminal region, which
           determines specificity. The standard reaction mechanism
           is a 4-pro-S hydride transfer and proton relay involving
           the conserved Tyr and Lys, a water molecule stabilized
           by Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type KRs have
           a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 376

 Score = 26.5 bits (59), Expect = 1.3
 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 2/38 (5%)

Query: 6   ISRETAESLLAPKEDGLFLVREST-NFPQDFMCVCFES 42
              E    +LAPK  G + + + T + P DF  V F S
Sbjct: 248 QDWERFRKVLAPKVQGAWNLHQLTQDLPLDFF-VLFSS 284


>gnl|CDD|198266 cd10403, SH2_STAP1, Src homology 2 domain found in
          Signal-transducing adaptor protein 1 (STAP1).  STAP1 is
          a signal-transducing adaptor protein. It is composed of
          a Pleckstrin homology (PH) and SH2 domains along with
          several tyrosine phosphorylation sites. STAP-1 is an
          ortholog of BRDG1 (BCR downstream signaling 1). STAP1
          protein functions as a docking protein acting
          downstream of Tec tyrosine kinase in B cell antigen
          receptor signaling. The protein is phosphorylated by
          Tec and participates in a positive feedback loop,
          increasing Tec activity. STAP1 has been shown to
          interact with C19orf2, an unconventional prefoldin RPB5
          interactor. In general SH2 domains are involved in
          signal transduction. They typically bind
          pTyr-containing ligands via two surface pockets, a pTyr
          and hydrophobic binding pocket, allowing proteins with
          SH2 domains to localize to tyrosine phosphorylated
          sites.
          Length = 94

 Score = 25.8 bits (57), Expect = 1.3
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 5/64 (7%)

Query: 2  FHGKISRETAESLLAP-KEDGLFLVRESTNFPQDFMCVCFE---SKVEHYRVKYKEAHLT 57
          F+ K+SR+ AE LL      G  L+R  ++     +    E    +++HYRV  +    T
Sbjct: 4  FY-KVSRKEAEELLERNPSCGNMLLRPGSDSSNYSITTRQEINKPRIKHYRVMSRGQGYT 62

Query: 58 IDDE 61
          I+ E
Sbjct: 63 IELE 66


>gnl|CDD|198246 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain found in
          suppressor of cytokine signaling (SOCS) proteins.  SH2
          domain found in SOCS proteins. SOCS was first
          recognized as a group of cytokine-inducible SH2 (CIS)
          domain proteins comprising eight family members in
          human (CIS and SOCS1-SOCS7).  In addition to the SH2
          domain, SOCS proteins have a variable N-terminal domain
          and a conserved SOCS box in the C-terminal domain. SOCS
          proteins bind to a substrate via their SH2 domain. The
          prototypical members, CIS and SOCS1-SOCS3, have been
          shown to regulate growth hormone signaling in vitro and
          in a classic negative feedback response compete for
          binding at phosphotyrosine sites in JAK kinase and
          receptor pathways to displace effector proteins and
          target bound receptors for proteasomal degradation.
          Loss of SOCS activity results in excessive cytokine
          signaling associated with a variety of hematopoietic,
          autoimmune, and inflammatory diseases and certain
          cancers. Members (SOCS4-SOCS7) were identified by their
          conserved SOCS box, an adapter motif of 3 helices that
          associates substrate binding domains, such as the SOCS
          SH2 domain, ankryin, and WD40 with ubiquitin ligase
          components. These show limited cytokine induction. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 103

 Score = 25.6 bits (56), Expect = 1.9
 Identities = 15/62 (24%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFM---CVCFESKVEHYRVKYKEAHLT 57
          W+ G ++   A+  L    +G FLVR+S++   D++    V   +   + R++Y++    
Sbjct: 9  WYWGSMTVNEAKEKLQDAPEGTFLVRDSSH--SDYLLTISVKTSAGPTNLRIEYQDGKFR 66

Query: 58 ID 59
          +D
Sbjct: 67 LD 68


>gnl|CDD|198201 cd10338, SH2_SHA, Src homology 2 (SH2) domain found in SH2
          adaptor proteins A (SHA) Signal transducers.  Signal
          transducing adaptor proteins are accessory to main
          proteins in a signal transduction pathway. These
          proteins lack intrinsic enzymatic activity, but mediate
          specific protein-protein interactions that drive the
          formation of protein complexes. Adaptor proteins
          usually contain several domains within their structure
          (e.g. SH2 and SH3 domains) which allow specific
          interactions with several other specific proteins. Not
          much is known about the SHA protein except that it is
          predicted to act as a transcription factor. Arabidopsis
          SHA pulled down a 120-kD tyrosine-phosphorylated
          protein in vitro. In addition to the SH2 domain there
          is a coiled-coil domain, a DNA binding domain, and a
          transactivation domain in the STAT proteins. In general
          SH2 domains are involved in signal transduction. They
          typically bind pTyr-containing ligands via two surface
          pockets, a pTyr and hydrophobic binding pocket,
          allowing proteins with SH2 domains to localize to
          tyrosine phosphorylated sites.
          Length = 106

 Score = 25.3 bits (55), Expect = 2.0
 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 4/32 (12%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFP 32
          W  G I++E AE  L  +  G F++R    FP
Sbjct: 12 WIEGFITKEEAERSLQGQVPGTFILR----FP 39


>gnl|CDD|198256 cd10393, SH2_RIN1, Src homology 2 (SH2) domain found in Ras and
          Rab interactor 1 (RIN1)-like proteins.  RIN1, a member
          of the RIN (AKA Ras interaction/interference) family,
          have multifunctional domains including SH2 and
          proline-rich (PR) domains in the N-terminal region, and
          RIN-family homology (RH), VPS9 and Ras-association (RA)
          domains in the C-terminal region. RIN proteins function
          as Rab5-GEFs. Previous studies showed that RIN1
          interacts with EGF receptors via its SH2 domain and
          regulates trafficking and degradation of EGF receptors
          via its interaction with STAM, indicating a vital role
          for RIN1 in regulating endosomal trafficking of
          receptor tyrosine kinases (RTKs). RIN1 was first
          identified as a Ras-binding protein that suppresses the
          activated RAS2 allele in S. cerevisiae. RIN1 binds to
          the activated Ras through its carboxyl-terminal domain
          and this Ras-binding domain also binds to 14-3-3
          proteins as Raf-1 does. The SH2 domain of RIN1 are
          thought to interact with the phosphotyrosine-containing
          proteins, but the physiological partners for this
          domain are unknown. The proline-rich domain in RIN1 is
          similar to the consensus SH3 binding regions. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 25.2 bits (55), Expect = 2.1
 Identities = 11/38 (28%), Positives = 17/38 (44%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVRESTNFPQDFMCV 38
          W   + +   A  +L  +  G FLVR+S       +CV
Sbjct: 12 WLQLRANAAAALHVLRTEPPGTFLVRKSNTRQCQALCV 49


>gnl|CDD|240276 PTZ00115, PTZ00115, 40S ribosomal protein S12; Provisional.
          Length = 290

 Score = 25.2 bits (55), Expect = 3.2
 Identities = 9/25 (36%), Positives = 12/25 (48%), Gaps = 2/25 (8%)

Query: 41  ESKVEHYRVKYKEAHLTI--DDEEF 63
           E K +    +  E H+TI  D E F
Sbjct: 219 EEKKKKRLERKNEKHITIKKDRELF 243


>gnl|CDD|176883 cd08874, START_STARD9-like, C-terminal START domain of mammalian
           STARD9, and related domains; lipid binding.  This
           subfamily includes the steroidogenic acute regulatory
           protein (StAR)-related lipid transfer (START) domains of
           mammalian STARD9 (also known as KIAA1300), and related
           domains. The START domain family belongs to the SRPBCC
           (START/RHO_alpha_C /PITP /Bet_v1/CoxG/CalC) domain
           superfamily of proteins that bind hydrophobic ligands.
           SRPBCC domains have a deep hydrophobic ligand-binding
           pocket. Some members of this subfamily have N-terminal
           kinesin motor domains. STARD9 interacts with
           supervillin, a protein important for efficient
           cytokinesis, perhaps playing a role in coordinating
           microtubule motors with actin and myosin II functions at
           membranes. The human gene encoding STARD9 lies within a
           target region for LGMD2A, an autosomal recessive form of
           limb-girdle muscular dystrophy.
          Length = 205

 Score = 24.9 bits (54), Expect = 3.6
 Identities = 7/18 (38%), Positives = 10/18 (55%)

Query: 32  PQDFMCVCFESKVEHYRV 49
           P+DF C+  E+K     V
Sbjct: 107 PRDFCCLQVEAKEGELSV 124


>gnl|CDD|218181 pfam04621, ETS_PEA3_N, PEA3 subfamily ETS-domain transcription
          factor N terminal domain.  The N terminus of the PEA3
          transcription factors is implicated in transactivation
          and in inhibition of DNA binding. Transactivation is
          potentiated by activation of the Ras/MAP kinase and
          protein kinase A signalling cascades. The N terminal
          region contains conserved MAP kinase phosphorylation
          sites.
          Length = 336

 Score = 24.8 bits (54), Expect = 4.1
 Identities = 9/21 (42%), Positives = 14/21 (66%)

Query: 50 KYKEAHLTIDDEEFFENLAQL 70
          K+ +  L  D EE F++L+QL
Sbjct: 33 KFVDTELAQDSEELFQDLSQL 53


>gnl|CDD|198238 cd10375, SH2_STAT4, Src homology 2 (SH2) domain found in signal
          transducer and activator of transcription (STAT)
          4proteins.  STAT4 mediate signals from the IL-12
          receptors. STAT4 is mainly phosphorylated by
          IL-12-mediated signaling pathway in T cells. STAT4
          expression is restricted in myeloid cells, thymus and
          testis. L-12 is the major cytokine that can activate
          STAT4, resulting in its tyrosine phosphorylation. The
          IL-12 receptor has two chains, termed IL-12R 1 and
          IL-12R 2, and ligand binding results in heterodimer
          formation and activation of the receptor associated JAK
          kinases, Jak2 and Tyk2. Phosphorylated STAT4
          homo-dimerizes via its SH2 domain, and translocates
          into nucleus where it can recognize traditional N3 STAT
          target sequences in IL-12 responsive genes. STAT4 can
          also be phosphorylated in response to IFN-gamma
          stimulation through activation of Jak1 and Tyk2  in
          human. IL-17 can also activate STAT4 in human monocytic
          leukemia cell lines and IL-2 can induce Jak2 and Stat4
          activation in NK cells but not in T cells. T helper 1
          (Th1) cells produce IL-2 and IFNgamma, whereas Th2
          cells secrete IL-4, IL-5, IL-6 and IL-13. Th1 cells are
          responsible for cell-mediated/inflammatory immunity and
          can enhance defenses against infectious agents and
          cancer, while Th2 cells are essential for humoral
          immunity and the clearance of parasitic antigens. The
          most potent factors that can promote Th1 and Th2
          differentiation are the cytokines IL-12 and IL-4
          respectively Although STAT4 is expressed both in Th1
          and Th2 cells, STAT4 can only be phosphorylated by
          IL-12 which suggests that STAT4 plays an important role
          in Th1 cell function or development. STAT4 activation
          leads to Th1 differentiation, including the target
          genes of STAT4 such as ERM, a transcription factor that
          belongs to the Ets family of transcription factors. The
          expression of ERM is specifically induced by IL-12 in
          wild-type Th1 cells, but not in STAT4-deficient T
          cells. STAT proteins mediate the signaling of cytokines
          and a number of growth factors from the receptors of
          these extracellular signaling molecules to the cell
          nucleus. STATs are specifically phosphorylated by
          receptor-associated Janus kinases, receptor tyrosine
          kinases, or cytoplasmic tyrosine kinases. The
          phosphorylated STAT molecules dimerize by reciprocal
          binding of their SH2 domains to the phosphotyrosine
          residues. These dimeric STATs translocate into the
          nucleus, bind to specific DNA sequences, and regulate
          the transcription of their target genes.  However there
          are a number of unphosphorylated STATs that travel
          between the cytoplasm and nucleus and some STATs that
          exist as dimers in unstimulated cells that can exert
          biological functions independent of being activated.
          There are seven mammalian STAT family members which
          have been identified: STAT1, STAT2, STAT3, STAT4, STAT5
          (STAT5A and STAT5B), and STAT6. There are 6 conserved
          domains in STAT: N-terminal domain (NTD), coiled-coil
          domain (CCD), DNA-binding domain (DBD), alpha-helical
          linker domain (LD), SH2 domain, and transactivation
          domain (TAD).  NTD is involved in dimerization of
          unphosphorylated STATs monomers and for the
          tetramerization between STAT1, STAT3, STAT4 and STAT5
          on promoters with two or more tandem STAT binding
          sites.  It also plays a role in promoting interactions
          with transcriptional co-activators such as CREB binding
          protein (CBP)/p300, as well as being important for
          nuclear import and deactivation of STATs involving
          tyrosine de-phosphorylation. CCD interacts with other
          proteins, such as IFN regulatory protein 9 (IRF-9/p48)
          with STAT1 and c-JUN with STAT3 and is also thought to
          participate in the negative regulation of these
          proteins. Distinct genes are bound to STATs via their
          DBD domain. This domain is also involved in nuclear
          translocation of activated STAT1 and STAT3
          phosphorylated dimers upon cytokine stimulation.  LD
          links the DNA-binding and SH2  domains and is important
          for the transcriptional activation of STAT1 in response
          to IFN-gamma. It also plays a role in protein-protein
          interactions and has also been implicated in the
          constitutive nucleocytoplasmic shuttling of
          unphosphorylated STATs in resting cells.  The SH2
          domain is necessary for receptor association and
          tyrosine phosphodimer formation. Residues within this
          domain may be particularly important for some cellular
          functions mediated by the STATs as well as residues
          adjacent to this domain.  The TAD interacts with
          several proteins, namely minichromosome maintenance
          complex component 5 (MCM5), breast cancer 1 (BRCA1) and
          CBP/p300. TAD also contains a modulatory
          phosphorylation site that regulates STAT activity and
          is necessary for maximal transcription of a number of
          target genes. The conserved tyrosine residue present in
          the C-terminus is crucial for dimerization via
          interaction with the SH2 domain upon the interaction of
          the ligand with the receptor. STAT activation by
          tyrosine phosphorylation also determines nuclear import
          and retention, DNA binding to specific DNA elements in
          the promoters of responsive genes, and transcriptional
          activation of STAT dimers. In addition to the SH2
          domain there is a coiled-coil domain, a DNA binding
          domain, and a transactivation domain in the STAT
          proteins. In general SH2 domains are involved in signal
          transduction.  They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 148

 Score = 24.8 bits (54), Expect = 4.4
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 4  GKISRETAESLLAPKEDGLFLVRES 28
          G +S+E    LL  K  G FL+R S
Sbjct: 24 GFVSKEKERLLLKDKMPGTFLLRFS 48


>gnl|CDD|198257 cd10394, SH2_RIN2, Src homology 2 (SH2) domain found in Ras and
          Rab interactor 2 (RIN2)-like proteins.  RIN2, a member
          of the RIN (AKA Ras interaction/interference) family,
          have multifunctional domains including SH2 and
          proline-rich (PR) domains in the N-terminal region, and
          RIN-family homology (RH), VPS9 and Ras-association (RA)
          domains in the C-terminal region. RIN proteins function
          as Rab5-GEFs. Ras induces activation of Rab5 through
          RIN2, which is a direct downstream target of Ras and a
          direct upstream regulator of Rab5. In other words it is
          the binding of the GTP-bound form of Ras to the RA
          domain of RIN2 that enhances the GEF activity toward
          Rab5. It is thought that the RA domain negatively
          regulates the Rab5 GEF activity. In steady state, RIN2
          is likely to form a closed conformation by an
          intramolecular interaction between the RA domain and
          the Vps9p-like (Rab5 GEF) domain, negatively regulating
          the Rab5 GEF activity. In the active state, the binding
          of Ras to the RA domain may reduce the intramolecular
          interaction and stabilize an open conformation of RIN2.
          In general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 100

 Score = 24.4 bits (53), Expect = 4.9
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 1  WFHGKISRETAESLLAPKEDGLFLVREST 29
          W    +S E A  +L  +  G+FLVR+S+
Sbjct: 12 WLQLSLSEEEAAEVLQAQPPGIFLVRKSS 40


>gnl|CDD|224458 COG1541, PaaK, Coenzyme F390 synthetase [Coenzyme metabolism].
          Length = 438

 Score = 24.6 bits (54), Expect = 5.0
 Identities = 12/27 (44%), Positives = 17/27 (62%)

Query: 44 VEHYRVKYKEAHLTIDDEEFFENLAQL 70
             YR K+KEA +  DD +  E+LA+L
Sbjct: 42 SPFYRKKFKEAGVDPDDIKTLEDLAKL 68


>gnl|CDD|198248 cd10385, SH2_SOCS4, Src homology 2 (SH2) domain found in
          suppressor of cytokine signaling (SOCS) proteins.  SH2
          domain found in SOCS proteins. SOCS was first
          recognized as a group of cytokine-inducible SH2 (CIS)
          domain proteins comprising eight family members in
          human (CIS and SOCS1-SOCS7). In addition to the SH2
          domain, SOCS proteins have a variable N-terminal domain
          and a conserved SOCS box in the C-terminal domain. SOCS
          proteins bind to a substrate via their SH2 domain. The
          prototypical members, CIS and SOCS1-SOCS3, have been
          shown to regulate growth hormone signaling in vitro and
          in a classic negative feedback response compete for
          binding at phosphotyrosine sites in JAK kinase and
          receptor pathways to displace effector proteins and
          target bound receptors for proteasomal degradation.
          Loss of SOCS activity results in excessive cytokine
          signaling associated with a variety of hematopoietic,
          autoimmune, and inflammatory diseases and certain
          cancers. Members (SOCS4-SOCS7) were identified by their
          conserved SOCS box, an adapter motif of 3 helices that
          associates substrate binding domains, such as the SOCS
          SH2 domain, ankryin, and WD40 with ubiquitin ligase
          components. These show limited cytokine induction. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 101

 Score = 23.9 bits (51), Expect = 7.1
 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 2  FHGKISRETAESLLAPKEDGLFLVRESTNFPQDFM-CVCFE--SKVEHYRVKYKEAHLTI 58
          + G + +  AE+LL  K +G FL+R+S    +D++  V F   S+  H R++    + + 
Sbjct: 13 YWGVMDKYAAEALLEGKPEGTFLLRDSAQ--EDYLFSVSFRRYSRSLHARIEQWNHNFSF 70

Query: 59 D 59
          D
Sbjct: 71 D 71


>gnl|CDD|198249 cd10386, SH2_SOCS5, Src homology 2 (SH2) domain found in
          suppressor of cytokine signaling (SOCS) family.  SH2
          domain found in SOCS proteins. SOCS was first
          recognized as a group of cytokine-inducible SH2 (CIS)
          domain proteins comprising eight family members in
          human (CIS and SOCS1-SOCS7).  In addition to the SH2
          domain, SOCS proteins have a variable N-terminal domain
          and a conserved SOCS box in the C-terminal domain. SOCS
          proteins bind to a substrate via their SH2 domain. The
          prototypical members, CIS and SOCS1-SOCS3, have been
          shown to regulate growth hormone signaling in vitro and
          in a classic negative feedback response compete for
          binding at phosphotyrosine sites in JAK kinase and
          receptor pathways to displace effector proteins and
          target bound receptors for proteasomal degradation.
          Loss of SOCS activity results in excessive cytokine
          signaling associated with a variety of hematopoietic,
          autoimmune, and inflammatory diseases and certain
          cancers. Members (SOCS4-SOCS7) were identified by their
          conserved SOCS box, an adapter motif of 3 helices that
          associates substrate binding domains, such as the SOCS
          SH2 domain, ankryin, and WD40 with ubiquitin ligase
          components. These show limited cytokine induction. In
          general SH2 domains are involved in signal
          transduction. They typically bind pTyr-containing
          ligands via two surface pockets, a pTyr and hydrophobic
          binding pocket, allowing proteins with SH2 domains to
          localize to tyrosine phosphorylated sites.
          Length = 81

 Score = 23.5 bits (50), Expect = 8.7
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 2  FHGKISRETAESLLAPKEDGLFLVRES 28
          + G + R  AE+LL  K +G FL+R+S
Sbjct: 3  YWGVMDRYEAEALLEGKPEGTFLLRDS 29


>gnl|CDD|226481 COG3972, COG3972, Superfamily I DNA and RNA helicases [General
           function prediction only].
          Length = 660

 Score = 23.7 bits (51), Expect = 10.0
 Identities = 9/18 (50%), Positives = 13/18 (72%)

Query: 24  LVRESTNFPQDFMCVCFE 41
           L+ ES +FPQ F+ +CF 
Sbjct: 300 LIDESQDFPQSFIDLCFM 317


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.322    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0772    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,515,342
Number of extensions: 252827
Number of successful extensions: 383
Number of sequences better than 10.0: 1
Number of HSP's gapped: 342
Number of HSP's successfully gapped: 100
Length of query: 71
Length of database: 10,937,602
Length adjustment: 41
Effective length of query: 30
Effective length of database: 9,119,088
Effective search space: 273572640
Effective search space used: 273572640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.1 bits)