Diaphorina citri psyllid: psy12428


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MKHDNSTIPLNSSNILDLKYKNGVASLQIQEVFPEDEGVYVCTATNSLGTAETKCKLTVR
ccccccEEcccccccEEEEEEccEEEEEEccccccccCEEEEEEEccccCEEEEEEEEEc
*****STIPLNSSNILDLKYKNGVASLQIQEVFPEDEGVYVCTATNSLGTAETKCKLTVR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKHDNSTIPLNSSNILDLKYKNGVASLQIQEVFPEDEGVYVCTATNSLGTAETKCKLTVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008307 [MF]structural constituent of muscleprobableGO:0003674, GO:0005198
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0007498 [BP]mesoderm developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0045214 [BP]sarcomere organizationprobableGO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692
GO:0005614 [CC]interstitial matrixprobableGO:0044421, GO:0005575, GO:0005576, GO:0005578, GO:0031012
GO:0006936 [BP]muscle contractionprobableGO:0032501, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0017022 [MF]myosin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0030198 [BP]extracellular matrix organizationprobableGO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0043062, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 2-59
View the alignment between query and template
View the model in PyMOL