Query         psy1244
Match_columns 73
No_of_seqs    112 out of 323
Neff          4.8 
Searched_HMMs 46136
Date          Fri Aug 16 19:19:34 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1244.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1244hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02138 Beach:  Beige/BEACH do  98.7 3.7E-09 8.1E-14   78.0   1.2   26    2-27    245-270 (270)
  2 cd06071 Beach BEACH (Beige and  98.7 7.8E-09 1.7E-13   76.7   2.6   26    2-27    250-275 (275)
  3 KOG1787|consensus               98.1 2.6E-06 5.7E-11   73.0   3.5   66    3-68    726-817 (1126)
  4 KOG1786|consensus               92.9   0.058 1.3E-06   46.6   1.7   30    2-31    601-630 (1081)
  5 PF10578 SVS_QK:  Seminal vesic  60.4     1.8   4E-05   18.5  -0.6   11    7-17      1-11  (12)
  6 TIGR02171 Fb_sc_TIGR02171 Fibr  31.9      42 0.00091   29.4   2.6   30   41-70    693-722 (912)
  7 COG4367 Uncharacterized protei  28.1      51  0.0011   21.5   1.9   16    2-17     57-72  (97)
  8 KOG1787|consensus               26.6      21 0.00045   31.9  -0.1   30   44-73   1094-1123(1126)
  9 PF10078 DUF2316:  Uncharacteri  24.1      68  0.0015   20.4   2.0   16    2-17     58-73  (89)
 10 PF00165 HTH_AraC:  Bacterial r  20.4      32  0.0007   17.8  -0.1   10   10-19     31-40  (42)

No 1  
>PF02138 Beach:  Beige/BEACH domain;  InterPro: IPR000409 The BEACH domain is found in eukaryotic proteins that have diverse cellular functions ranging from lysosomal traffic to apoptosis and cytokinesisin vesicle trafficking, membrane dynamics, and receptor signaling. The name BEACH is derived from beige and Chediak-Higashi syndrome (CHS). CHS is a rare, autosomal recessive disorder that can cause severe immunodeficiency and albinism in humans and other mammals, and beige is the name for the CHS disease in mice [, ]. The BEACH domain was first described in the lysosomal-trafficking regulators Beige protein and its human homologue CHS protein Q99698 from SWISSPROT. It is also found in distantly related proteins like, for example, the FAN proteins O35242 from SWISSPROT and Q92636 from SWISSPROT which are factor associated with neutral sphingomyelinase activation []. It has also been described in Dictyostelium proteins Lvs []. The BEACH domain is usually followed by a series of WD repeats (PDOC00574 from PROSITEDOC). The function of the BEACH domain is unknown.; PDB: 1MI1_B 1T77_C.
Probab=98.72  E-value=3.7e-09  Score=78.01  Aligned_cols=26  Identities=65%  Similarity=1.105  Sum_probs=12.2

Q ss_pred             hHHHHHHHHhcCCCccccCCCCCCCC
Q psy1244           2 REAVENQIKNFGQTPSQLLMEPHPPR   27 (73)
Q Consensus         2 r~a~~~qI~~FGQtP~Qlf~~pHp~R   27 (73)
                      +.++++++.+|||+|.|||++|||+|
T Consensus       245 ~~~~~~~~~~~Gq~P~QLF~~pHP~R  270 (270)
T PF02138_consen  245 REAIEAQLKNFGQVPIQLFTKPHPKR  270 (270)
T ss_dssp             HHHHHHHHHHC--------SS-----
T ss_pred             HHHHHHHHHhcCCChHHHhCCCCCCC
Confidence            67899999999999999999999998


No 2  
>cd06071 Beach BEACH (Beige and Chediak-Higashi) domains, implicated in membrane trafficking,  are present in a family of proteins conserved throughout eukaryotes. This group contains human lysosomal trafficking regulator (LYST), LPS-responsive and beige-like anchor (LRBA) and neurobeachin. Disruption of LYST leads to Chediak-Higashi syndrome, characterized by severe immunodeficiency, albinism, poor blood coagulation and neurologic problems. Neurobeachin is a candidate gene linked to autism. LBRA seems to be upregulated in several cancer types. It has been shown that the BEACH domain itself is important for the function of these proteins.
Probab=98.70  E-value=7.8e-09  Score=76.68  Aligned_cols=26  Identities=69%  Similarity=1.132  Sum_probs=25.0

Q ss_pred             hHHHHHHHHhcCCCccccCCCCCCCC
Q psy1244           2 REAVENQIKNFGQTPSQLLMEPHPPR   27 (73)
Q Consensus         2 r~a~~~qI~~FGQtP~Qlf~~pHp~R   27 (73)
                      +.++++++.+|||+|.|||++|||+|
T Consensus       250 ~~~~~~~~~~~Gq~P~QLF~~pHP~R  275 (275)
T cd06071         250 REAIEAQINNFGQTPVQLFTKPHPKR  275 (275)
T ss_pred             HHHHHHHHHhcCCCcchhccCCCCCC
Confidence            67999999999999999999999998


No 3  
>KOG1787|consensus
Probab=98.09  E-value=2.6e-06  Score=73.03  Aligned_cols=66  Identities=44%  Similarity=0.543  Sum_probs=52.0

Q ss_pred             HHHHHHHHhcCCCccccCCCCCCCCCCCCCC---CCccchhhhHH-------H------------hHhhccCCCeEEEE-
Q psy1244           3 EAVENQIKNFGQTPSQLLMEPHPPRSSAMHM---PSSLFGSASAL-------F------------LLAGLATGTVVVFH-   59 (73)
Q Consensus         3 ~a~~~qI~~FGQtP~Qlf~~pHp~R~~~~~~---~~~~f~~~~~K-------f------------~~~~ls~gsVVtV~-   59 (73)
                      ++++.||.+|||||+|+|.++||+|.+...+   ++++|++....       +            .+..+..++++.+. 
T Consensus       726 eai~~~i~~f~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~s~s~~~v~aan~~~~~~~~~~~~~~~  805 (1126)
T KOG1787|consen  726 EAIEAQIASFGQTPSQLLQEQHPPRASESKLALPSALVFEDASQLDVGIVLKRPSNSSVVVVAANTLFELCQPTVLGVRS  805 (1126)
T ss_pred             HHHHHHHhhccccchhhhhhccCCcchhccccccccchhhhhhhhhhhhccccCCCCcceeecccccccccccceeeeee
Confidence            6999999999999999999999999999886   34688774331       1            24566667777664 


Q ss_pred             ---eeeccchhH
Q psy1244          60 ---IDFNRWHHE   68 (73)
Q Consensus        60 ---~avnkW~~~   68 (73)
                         +..|+|+..
T Consensus       806 ~~~~~~n~~~~~  817 (1126)
T KOG1787|consen  806 LLEFPRNISSPS  817 (1126)
T ss_pred             eEEeehhccccc
Confidence               899999874


No 4  
>KOG1786|consensus
Probab=92.87  E-value=0.058  Score=46.64  Aligned_cols=30  Identities=20%  Similarity=0.163  Sum_probs=27.4

Q ss_pred             hHHHHHHHHhcCCCccccCCCCCCCCCCCC
Q psy1244           2 REAVENQIKNFGQTPSQLLMEPHPPRSSAM   31 (73)
Q Consensus         2 r~a~~~qI~~FGQtP~Qlf~~pHp~R~~~~   31 (73)
                      ..++++++++|||+|+|||.++|+.+...+
T Consensus       601 ~~~~~~~~~~~~~~~~~l~~~~h~~~~~~~  630 (1081)
T KOG1786|consen  601 QNILIVSNNHFKQTIKQLFPKKHSVSELTE  630 (1081)
T ss_pred             hhhhHHHhhccccchhhcccccccccccch
Confidence            357888999999999999999999999986


No 5  
>PF10578 SVS_QK:  Seminal vesicle protein repeat;  InterPro: IPR018942  The rat seminal vesicle contains six major androgen-dependent secretory proteins referred to as SVS I-VI. The SVS I-III proteins appear to be components of the rat copulatory plug, with the SVS II protein being the major component [].  This entry represents a repeat that is found in seminal vesical proteins. 
Probab=60.44  E-value=1.8  Score=18.49  Aligned_cols=11  Identities=55%  Similarity=0.715  Sum_probs=8.1

Q ss_pred             HHHHhcCCCcc
Q psy1244           7 NQIKNFGQTPS   17 (73)
Q Consensus         7 ~qI~~FGQtP~   17 (73)
                      +|++.|||.=+
T Consensus         1 ~Q~ksfgQ~Ks   11 (12)
T PF10578_consen    1 SQQKSFGQEKS   11 (12)
T ss_pred             Ccccccchhcc
Confidence            47888999654


No 6  
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171. This model describes a paralogous family of the rumen bacterium Fibrobacter succinogenes. Eleven members are found in Fibrobacter succinogenes S85, averaging over 900 amino acids in length. More than half are predicted lipoproteins. The function is unknown.
Probab=31.90  E-value=42  Score=29.44  Aligned_cols=30  Identities=10%  Similarity=0.174  Sum_probs=24.2

Q ss_pred             hhHHHhHhhccCCCeEEEEeeeccchhHhh
Q psy1244          41 ASALFLLAGLATGTVVVFHIDFNRWHHEFQ   70 (73)
Q Consensus        41 ~~~Kf~~~~ls~gsVVtV~~avnkW~~~~~   70 (73)
                      +.++|.++.+..=..|++.++++.|+++..
T Consensus       693 l~~ny~l~h~~klK~vv~eld~d~~~~~~~  722 (912)
T TIGR02171       693 LLMNYAIPHAKKLKYVVVELSLDFWWNTAT  722 (912)
T ss_pred             HHHHHhhhhcccccEEEEEEecchhcccch
Confidence            445688888888888999999999998743


No 7  
>COG4367 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.08  E-value=51  Score=21.55  Aligned_cols=16  Identities=38%  Similarity=0.598  Sum_probs=13.4

Q ss_pred             hHHHHHHHHhcCCCcc
Q psy1244           2 REAVENQIKNFGQTPS   17 (73)
Q Consensus         2 r~a~~~qI~~FGQtP~   17 (73)
                      |..+..-|.+=||||-
T Consensus        57 Rd~l~~~i~e~GqtP~   72 (97)
T COG4367          57 RDFLVQAIRESGQTPV   72 (97)
T ss_pred             HHHHHHHHHhcCCCCC
Confidence            5677888999999995


No 8  
>KOG1787|consensus
Probab=26.59  E-value=21  Score=31.86  Aligned_cols=30  Identities=40%  Similarity=0.811  Sum_probs=26.3

Q ss_pred             HHhHhhccCCCeEEEEeeeccchhHhhhcC
Q psy1244          44 LFLLAGLATGTVVVFHIDFNRWHHEFQQRY   73 (73)
Q Consensus        44 Kf~~~~ls~gsVVtV~~avnkW~~~~~~~~   73 (73)
                      +.++-+...+.++.+.-++|+|++|++.||
T Consensus      1094 ~~~~~~~~~~~~~~~~~~fn~~~~~~~~r~ 1123 (1126)
T KOG1787|consen 1094 RLLFSGDRSDSISAFESDFNRWHYESRSRY 1123 (1126)
T ss_pred             hhhhcCccccchhccchhhccccccccccc
Confidence            456778888889999999999999999987


No 9  
>PF10078 DUF2316:  Uncharacterized protein conserved in bacteria (DUF2316);  InterPro: IPR018757  Members of this family of hypothetical bacterial proteins have no known function. 
Probab=24.06  E-value=68  Score=20.44  Aligned_cols=16  Identities=31%  Similarity=0.661  Sum_probs=14.6

Q ss_pred             hHHHHHHHHhcCCCcc
Q psy1244           2 REAVENQIKNFGQTPS   17 (73)
Q Consensus         2 r~a~~~qI~~FGQtP~   17 (73)
                      |..+++.|.+=|++|-
T Consensus        58 RdyL~~~i~~~G~eP~   73 (89)
T PF10078_consen   58 RDYLNDKIKEQGKEPV   73 (89)
T ss_pred             HHHHHHHHHHcCCCCC
Confidence            7899999999999994


No 10 
>PF00165 HTH_AraC:  Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A.
Probab=20.36  E-value=32  Score=17.75  Aligned_cols=10  Identities=50%  Similarity=0.680  Sum_probs=6.6

Q ss_pred             HhcCCCcccc
Q psy1244          10 KNFGQTPSQL   19 (73)
Q Consensus        10 ~~FGQtP~Ql   19 (73)
                      ..+|.||+|.
T Consensus        31 ~~~g~tp~~y   40 (42)
T PF00165_consen   31 KETGMTPKQY   40 (42)
T ss_dssp             HHTSS-HHHH
T ss_pred             HHHCcCHHHH
Confidence            4579999874


Done!