Diaphorina citri psyllid: psy12449

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MVKFGTKELKEAMTLDEFKKKVLDGRQLALKISANSVYGFTGAQVGKLPCQLWTQCQTCQGSLHEQVICTSRDCPIFYMRKKVQIELISQDQIIQRFGTIAW
cccHHHHHHHHHccccHHHHHHHccHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccHHHHHHcccccc
***************DEFKKKVLDGRQLALKISANSVYGFTGAQVGKLPCQLWTQCQTCQGSLHEQVICTSRDCPIFYMRKKVQIELISQDQIIQRFGTIAW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKFGTKELKEAMTLDEFKKKVLDGRQLALKISANSVYGFTGAQVGKLPCQLWTQCQTCQGSLHEQVICTSRDCPIFYMRKKVQIELISQDQIIQRFGTIAW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA polymerase delta catalytic subunit Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex.confidentP28339
DNA polymerase delta catalytic subunit Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex.confidentP28340
DNA polymerase delta catalytic subunit Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex.confidentO54747

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006287 [BP]base-excision repair, gap-fillingprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006284, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0044763
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0000109 [CC]nucleotide-excision repair complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000084 [BP]S phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0051539 [MF]4 iron, 4 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0035188 [BP]hatchingprobableGO:0071684, GO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0006283 [BP]transcription-coupled nucleotide-excision repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0019985 [BP]translesion synthesisprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901362, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0018130, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0044238, GO:0044271, GO:0006301, GO:0050896, GO:0044763, GO:0006950, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0019438, GO:0071897
GO:0009411 [BP]response to UVprobableGO:0008150, GO:0009314, GO:0050896, GO:0009416, GO:0009628
GO:0043137 [BP]DNA replication, removal of RNA primerprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0033567, GO:0071704, GO:0006260, GO:0006261, GO:0006401, GO:0022616, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0006259, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0016070, GO:0044248, GO:0044270, GO:0006273, GO:0006271, GO:0044237, GO:0043170, GO:0019439
GO:0006297 [BP]nucleotide-excision repair, DNA gap fillingprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006289, GO:0006974, GO:0006950, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0044763
GO:0007346 [BP]regulation of mitotic cell cycleprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000722 [BP]telomere maintenance via recombinationprobableGO:0060249, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0000723, GO:0006139, GO:0044260, GO:0071840, GO:0016043, GO:0071704, GO:0042592, GO:0065007, GO:0044699, GO:0065008, GO:0006996, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006310, GO:0044238, GO:0006312, GO:0051276, GO:0032200, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0000731 [BP]DNA synthesis involved in DNA repairprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901362, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0008150, GO:0071704, GO:0044699, GO:0018130, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0034654, GO:0046483, GO:0044238, GO:0044271, GO:0050896, GO:0006950, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0019438, GO:0071897
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0043625 [CC]delta DNA polymerase complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0042575, GO:0005575, GO:0031981, GO:0005634, GO:0043226, GO:0044454, GO:0005657, GO:0005694, GO:0030894, GO:0032991, GO:0043231, GO:0043234, GO:0043601, GO:0043232, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043596, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0045004 [BP]DNA replication proofreadingprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0009059, GO:0044763, GO:0008152, GO:0046483, GO:0045005, GO:0044238, GO:0044699, GO:0050896, GO:0009058, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0003887 [MF]DNA-directed DNA polymerase activityprobableGO:0016779, GO:0016772, GO:0034061, GO:0003824, GO:0016740, GO:0003674
GO:0032201 [BP]telomere maintenance via semi-conservative replicationprobableGO:0044238, GO:0060249, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0000723, GO:0006139, GO:0044260, GO:0071840, GO:0016043, GO:0071704, GO:0006260, GO:0006261, GO:0065007, GO:0065008, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0044763, GO:0010833, GO:0008152, GO:0046483, GO:0006996, GO:0042592, GO:0044699, GO:0051276, GO:0032200, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0008296 [MF]3'-5'-exodeoxyribonuclease activityprobableGO:0016787, GO:0008408, GO:0016796, GO:0004529, GO:0003824, GO:0004536, GO:0004527, GO:0016788, GO:0004518, GO:0003674, GO:0016895

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IAY, chain A
Confidence level:confident
Coverage over the Query: 3-49
View the alignment between query and template
View the model in PyMOL