Diaphorina citri psyllid: psy12450


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MLRHVTWRDGLETVRRDNSPLVANMINTCLQKLLINRDPDGAVTQKNFIIPTYHGGQGEDQFEGATVIEPKKGYYADPIATLDFSSLYPSIMMAHNLCYTTLLTPQTITKLELTPDQYSKTPCGNFFLKSSLRKGLLPEILENLLSARKQAKNDLKKETDELTQVLYC
cccccccccEEEEEEECccccccHHHHHHcEEEHHHccccHHHHHccccccccccccccccccccEEcccccccccccEEEEEcccccHHHHHHHccccccccccccccccccccccEEEcccccEEcccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHccc
**R*VTWRDGLETVRRDNSPLVANMINTCLQKLLINRDPDGAVTQKNFIIPTYHGGQGEDQFEGATVIEPKKGYYADPIATLDFSSLYPSIMMAHNLCYTTLLTPQTITKLELTPDQYSKTPCGNFFLKSSLRKGLLPEILENLLSARKQAKNDLKKETDE*TQVLYC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRHVTWRDGLETVRRDNSPLVANMINTCLQKLLINRDPDGAVTQKNFIIPTYHGGQGEDQFEGATVIEPKKGYYADPIATLDFSSLYPSIMMAHNLCYTTLLTPQTITKLELTPDQYSKTPCGNFFLKSSLRKGLLPEIxxxxxxxxxxxxxxxxxxxxxLTQVLYC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA polymerase delta catalytic subunit Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex.confidentP52431
DNA polymerase delta catalytic subunit Possesses two enzymatic activities: DNA synthesis (polymerase) and an exonucleolytic activity that degrades single stranded DNA in the 3'- to 5'-direction. Required with its accessory proteins (proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) or activator 1) for leading strand synthesis. Also involved in completing Okazaki fragments initiated by the DNA polymerase alpha/primase complex.confidentP28339
DNA polymerase delta catalytic subunit DNA polymerase delta (DNA polymerase III) participates in chromosomal DNA replication. It is required during synthesis of the leading and lagging DNA strands at the replication fork and binds at/or near replication origins and moves along DNA with the replication fork. It has 3'-5' proofreading exonuclease activity that correct errors arising during DNA replication. It is also involved in DNA synthesis during DNA repair. POL3 contains the polymerase active site and most likely the active site for the 3'-5' exonuclease activity.confidentP15436

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006287 [BP]base-excision repair, gap-fillingprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006284, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0044763
GO:0006278 [BP]RNA-dependent DNA replicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0006260, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0043601 [CC]nuclear replisomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005657, GO:0005694, GO:0030894, GO:0043231, GO:0032991, GO:0043232, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0043596, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0042575 [CC]DNA polymerase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0016779 [MF]nucleotidyltransferase activityprobableGO:0016772, GO:0016740, GO:0003674, GO:0003824
GO:0000731 [BP]DNA synthesis involved in DNA repairprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901362, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0008150, GO:0071704, GO:0044699, GO:0018130, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0034654, GO:0046483, GO:0044238, GO:0044271, GO:0050896, GO:0006950, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0019438, GO:0071897
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0045004 [BP]DNA replication proofreadingprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0009059, GO:0044763, GO:0008152, GO:0046483, GO:0045005, GO:0044238, GO:0044699, GO:0050896, GO:0009058, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0043137 [BP]DNA replication, removal of RNA primerprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0033567, GO:0071704, GO:0006260, GO:0006261, GO:0006401, GO:0022616, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0006259, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0016070, GO:0044248, GO:0044270, GO:0006273, GO:0006271, GO:0044237, GO:0043170, GO:0019439
GO:0000109 [CC]nucleotide-excision repair complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0008296 [MF]3'-5'-exodeoxyribonuclease activityprobableGO:0016787, GO:0008408, GO:0016796, GO:0004529, GO:0003824, GO:0004536, GO:0004527, GO:0016788, GO:0004518, GO:0003674, GO:0016895

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IAY, chain A
Confidence level:very confident
Coverage over the Query: 2-167
View the alignment between query and template
View the model in PyMOL