Query         psy12464
Match_columns 67
No_of_seqs    101 out of 171
Neff          3.7 
Searched_HMMs 29240
Date          Fri Aug 16 20:01:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12464.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/12464hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 4en6_A Hemagglutinin component  51.5    0.63 2.1E-05   33.5  -3.6   17   44-60    153-169 (224)
  2 3tx3_A Uncharacterized protein  31.0      19 0.00064   25.2   1.3   31   16-46    202-232 (249)
  3 4en6_B Hemagglutinin component  25.7     3.4 0.00011   31.8  -3.5   18   44-61    118-135 (420)
  4 3agc_A RED chlorophyll catabol  22.8      15 0.00051   26.9  -0.4   20   34-53    248-267 (276)
  5 3iq1_A DPS family protein; csg  17.7      33  0.0011   21.6   0.4    9   46-54     69-77  (159)
  6 3kwo_A Putative bacterioferrit  17.2      34  0.0012   21.4   0.4    9   46-54     56-64  (152)
  7 2pyb_A NAPA, neutrophil activa  16.7      36  0.0012   21.2   0.4    9   46-54     56-64  (151)
  8 2bk6_A Non-heme iron-containin  16.5      36  0.0012   21.3   0.4    9   46-54     59-67  (156)
  9 2chp_A MRGA, metalloregulation  16.3      37  0.0013   21.2   0.4    9   46-54     63-71  (153)
 10 2fjc_A Antigen TPF1; mini ferr  16.0      38  0.0013   21.2   0.4    9   46-54     64-72  (156)

No 1  
>4en6_A Hemagglutinin components HA-22/23/53; carbohydrate/sugar binding, sugar binding protein; HET: SIA GAL BGC; 2.56A {Clostridium botulinum} PDB: 4en7_A* 4en8_A* 4en9_A* 2z5a_A 2zoe_A* 2zs6_A
Probab=51.50  E-value=0.63  Score=33.49  Aligned_cols=17  Identities=41%  Similarity=0.850  Sum_probs=12.7

Q ss_pred             heehhhhhhhhhhHHHH
Q psy12464         44 GFVIAERVLYIPSMGFC   60 (67)
Q Consensus        44 GfviAERvLYlPSvGfc   60 (67)
                      |.+.-.-++|+||.|+|
T Consensus       153 g~I~e~A~~YvPSLGy~  169 (224)
T 4en6_A          153 NTVTERAVLYVPSLGYV  169 (224)
T ss_dssp             SBEEEEEEEEEEEEEEE
T ss_pred             CccccceeEEccccceE
Confidence            44445558999999987


No 2  
>3tx3_A Uncharacterized protein involved in cysteine BIOS; structural genomics, PSI-biology, NEW YORK consortium on MEM protein structure, nycomps; HET: LDA; 2.30A {Idiomarina loihiensis}
Probab=31.03  E-value=19  Score=25.19  Aligned_cols=31  Identities=23%  Similarity=0.256  Sum_probs=23.5

Q ss_pred             ccchhhHHHHHHHhhhccccccccccchhee
Q psy12464         16 GIKKTFLIEGLGFLIVPFLPASNLFFPVGFV   46 (67)
Q Consensus        16 ~~~~~~~~~~l~~~~ipflPaSNl~~~vGfv   46 (67)
                      +++.....+|........+|.-|+++....+
T Consensus       202 ~~r~~~~~fG~~~~ll~~IP~vnl~~~p~av  232 (249)
T 3tx3_A          202 QQRSKTLGFGFGVTVLTMIPLINLIIMPLAV  232 (249)
T ss_dssp             TTHHHHHHHHHHHHHHTTSTTGGGTHHHHHH
T ss_pred             HhhhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3334567788999999999999998765544


No 3  
>4en6_B Hemagglutinin components HA-22/23/53; carbohydrate/sugar binding, sugar binding protein; HET: SIA GAL BGC; 2.56A {Clostridium botulinum} PDB: 2zoe_B* 2zs6_B 2z5a_B* 4en7_B* 4en8_B* 4en9_B*
Probab=25.73  E-value=3.4  Score=31.78  Aligned_cols=18  Identities=33%  Similarity=0.689  Sum_probs=12.4

Q ss_pred             heehhhhhhhhhhHHHHH
Q psy12464         44 GFVIAERVLYIPSMGFCM   61 (67)
Q Consensus        44 GfviAERvLYlPSvGfcl   61 (67)
                      |.+.-+-.+|+||.|+|=
T Consensus       118 gnI~drA~~YlPSLG~~e  135 (420)
T 4en6_B          118 GNIDDKAEYYLPSLGKCE  135 (420)
T ss_dssp             SCEEEEEEEEEECCCEEE
T ss_pred             CccccceeEEccccccee
Confidence            333334579999999883


No 4  
>3agc_A RED chlorophyll catabolite reductase, chloroplast; chlorophyll degradation, substrate-bound enzyme, chlorophyll catabolism, NADP; HET: RCC; 2.00A {Arabidopsis thaliana} PDB: 3agb_A* 3aga_A* 2zxl_A 2zxk_A
Probab=22.77  E-value=15  Score=26.93  Aligned_cols=20  Identities=15%  Similarity=-0.038  Sum_probs=17.9

Q ss_pred             ccccccccchheehhhhhhh
Q psy12464         34 LPASNLFFPVGFVIAERVLY   53 (67)
Q Consensus        34 lPaSNl~~~vGfviAERvLY   53 (67)
                      =|++|++-..|--+|||+++
T Consensus       248 Dpa~~l~r~FG~E~sdr~l~  267 (276)
T 3agc_A          248 DLDLQFPRMFGEEVSSRVVH  267 (276)
T ss_dssp             HTTTTHHHHHCHHHHHHHHH
T ss_pred             CchhchHhhhCHHHHHHHHH
Confidence            48999999999999999985


No 5  
>3iq1_A DPS family protein; csgid, SAD, niaid, metal transport, STRU genomics, center for structural genomics of infectious DISE; 1.67A {Vibrio cholerae o1 biovar el tor}
Probab=17.68  E-value=33  Score=21.63  Aligned_cols=9  Identities=44%  Similarity=0.726  Sum_probs=6.6

Q ss_pred             ehhhhhhhh
Q psy12464         46 VIAERVLYI   54 (67)
Q Consensus        46 viAERvLYl   54 (67)
                      -+|||++.+
T Consensus        69 ~lAERI~~L   77 (159)
T 3iq1_A           69 ELAERILTL   77 (159)
T ss_dssp             HHHHHHHHT
T ss_pred             HHHHHHHHc
Confidence            478888765


No 6  
>3kwo_A Putative bacterioferritin; alpha-helix, bacterial ferritin fold, structural genomics, center for structural genomics of infectious diseases; 1.99A {Campylobacter jejuni} SCOP: a.25.1.0
Probab=17.18  E-value=34  Score=21.37  Aligned_cols=9  Identities=56%  Similarity=0.634  Sum_probs=6.8

Q ss_pred             ehhhhhhhh
Q psy12464         46 VIAERVLYI   54 (67)
Q Consensus        46 viAERvLYl   54 (67)
                      -+|||++.+
T Consensus        56 ~iAERI~~L   64 (152)
T 3kwo_A           56 SCAERVLQL   64 (152)
T ss_dssp             HHHHHHHHT
T ss_pred             HHHHHHHHc
Confidence            478888875


No 7  
>2pyb_A NAPA, neutrophil activating protein; ferritin, DPS, four-helix bundle, metal transport; 2.60A {Borrelia burgdorferi}
Probab=16.66  E-value=36  Score=21.19  Aligned_cols=9  Identities=33%  Similarity=0.604  Sum_probs=6.5

Q ss_pred             ehhhhhhhh
Q psy12464         46 VIAERVLYI   54 (67)
Q Consensus        46 viAERvLYl   54 (67)
                      -+|||++.+
T Consensus        56 ~lAERI~~L   64 (151)
T 2pyb_A           56 IVAERSRML   64 (151)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHC
Confidence            478888765


No 8  
>2bk6_A Non-heme iron-containing ferritin; DPS (DNA binding protein from starved cells), ferroxidase center, mutagenesis study; 2.19A {Listeria innocua} SCOP: a.25.1.1 PDB: 1qgh_A 2bjy_A 2iy4_A 2bkc_A
Probab=16.48  E-value=36  Score=21.27  Aligned_cols=9  Identities=56%  Similarity=0.722  Sum_probs=6.6

Q ss_pred             ehhhhhhhh
Q psy12464         46 VIAERVLYI   54 (67)
Q Consensus        46 viAERvLYl   54 (67)
                      .+|||++++
T Consensus        59 ~lAERI~~L   67 (156)
T 2bk6_A           59 EVAERLLAI   67 (156)
T ss_dssp             HHHHHHHHT
T ss_pred             HHHHHHHHC
Confidence            478888875


No 9  
>2chp_A MRGA, metalloregulation DNA-binding stress protein; DNA-binding protein, DPS, dodecameric, ferritin; 2.0A {Bacillus subtilis}
Probab=16.26  E-value=37  Score=21.22  Aligned_cols=9  Identities=67%  Similarity=0.826  Sum_probs=6.5

Q ss_pred             ehhhhhhhh
Q psy12464         46 VIAERVLYI   54 (67)
Q Consensus        46 viAERvLYl   54 (67)
                      -+|||++.+
T Consensus        63 ~lAERI~~L   71 (153)
T 2chp_A           63 TIAERLLAI   71 (153)
T ss_dssp             HHHHHHHHT
T ss_pred             HHHHHHHHC
Confidence            478888765


No 10 
>2fjc_A Antigen TPF1; mini ferritin, iron binding protein, metal transport; 2.50A {Treponema pallidum} SCOP: a.25.1.1
Probab=16.03  E-value=38  Score=21.25  Aligned_cols=9  Identities=56%  Similarity=0.800  Sum_probs=6.4

Q ss_pred             ehhhhhhhh
Q psy12464         46 VIAERVLYI   54 (67)
Q Consensus        46 viAERvLYl   54 (67)
                      -+|||++.+
T Consensus        64 ~lAERI~~L   72 (156)
T 2fjc_A           64 TIAERLLQL   72 (156)
T ss_dssp             HHHHHHHHT
T ss_pred             HHHHHHHHc
Confidence            468888765


Done!