Query         psy12486
Match_columns 148
No_of_seqs    105 out of 175
Neff          4.5 
Searched_HMMs 46136
Date          Fri Aug 16 20:34:32 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12486.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12486hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4455|consensus              100.0 2.5E-33 5.3E-38  208.9   4.5  103    5-112     4-110 (110)
  2 PF07019 Rab5ip:  Rab5-interact  99.9 2.3E-24   5E-29  151.3   3.2   76   26-106     6-81  (81)
  3 KOG3415|consensus               98.7 7.9E-09 1.7E-13   78.9   2.3   80   26-110    48-127 (129)
  4 PF06839 zf-GRF:  GRF zinc fing  72.6     1.7 3.7E-05   27.2   0.7   12  136-147    17-28  (45)
  5 PF01102 Glycophorin_A:  Glycop  64.1       5 0.00011   30.8   1.9   12   36-47     68-79  (122)
  6 PRK13682 hypothetical protein;  55.6      23 0.00049   23.6   3.7   20   36-55      8-27  (51)
  7 COG5487 Small integral membran  53.1      34 0.00074   23.0   4.2   18   37-54      9-26  (54)
  8 PF07043 DUF1328:  Protein of u  46.3      51  0.0011   20.7   4.0   22   37-58      4-25  (39)
  9 PHA00024 IX minor coat protein  30.2      36 0.00078   20.8   1.4   17   94-110     8-24  (33)
 10 PF04418 DUF543:  Domain of unk  23.7      81  0.0018   22.2   2.5   11   36-46     36-46  (75)
 11 PF13940 Ldr_toxin:  Toxin Ldr,  23.7      39 0.00084   20.9   0.7   15   31-45     10-26  (35)
 12 PF03613 EIID-AGA:  PTS system   22.2 1.4E+02  0.0029   25.5   4.0   32   36-67    117-148 (264)

No 1  
>KOG4455|consensus
Probab=99.98  E-value=2.5e-33  Score=208.86  Aligned_cols=103  Identities=42%  Similarity=0.791  Sum_probs=96.7

Q ss_pred             CCCCCCCCCccCHHHHHhhhc----cccccccchhhhhHhhhhhhccccchhhHHHHHHHHHHHHHHHHHHhCCCccccc
Q psy12486          5 KSSKPGDHTAYSELACAKQCS----CGRVLPAHLWLPLSGCTAGILGLTGFYGFGFYVLAVIGLWVLLLMRAGSKWNRYF   80 (148)
Q Consensus         5 ~~~~~~~~~~~s~e~v~~N~~----~r~l~~~~d~sll~Gi~AGILGLtgl~GFlfy~i~~ll~sll~~~k~~~~~~~YF   80 (148)
                      .+.+..+++.++++|++.|+|    +|+.+     |+++|++||||||||+.||+||+++.++.++++.+||+++|.+||
T Consensus         4 s~~~~~~~~~~s~aav~nN~kvl~f~Rt~~-----s~i~G~aAGILGltg~~GFi~Y~l~~~i~~il~~~K~~~~~~kyf   78 (110)
T KOG4455|consen    4 SKAEEVFIPIYSTAAVRNNKKVLEFVRTSS-----SAIAGCAAGILGLTGLHGFIFYFLSVLILSILLVLKAGGQWGKYF   78 (110)
T ss_pred             chhhhcCCcchhHHHHhcCHHHHHHHHHHH-----HHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHCCCHHhhc
Confidence            344567889999999999999    66666     999999999999999999999999999889999999999999999


Q ss_pred             cccceeeecCcccchhhhHHHHHhhhhhhhee
Q psy12486         81 LNRKSLLTNGFVGGLCTYVLFWTFFYTMGDKW  112 (148)
Q Consensus        81 ~s~~~i~~~g~~~~L~~FVL~WTl~Y~lVhvy  112 (148)
                      ++|.++|++++++|+++|||+||+.|+|||+|
T Consensus        79 ~s~~~~f~~~f~~Gl~tyVl~Wtf~Y~lv~~~  110 (110)
T KOG4455|consen   79 QSRRNLFTESFLGGLTTYVLAWTFFYGLVHVY  110 (110)
T ss_pred             CchhHHHHHHHhchHHHHHHHHHHHhhhhccC
Confidence            99999999999999999999999999999997


No 2  
>PF07019 Rab5ip:  Rab5-interacting protein (Rab5ip)
Probab=99.89  E-value=2.3e-24  Score=151.25  Aligned_cols=76  Identities=45%  Similarity=0.861  Sum_probs=72.6

Q ss_pred             cccccccchhhhhHhhhhhhccccchhhHHHHHHHHHHHHHHHHHHhCCCccccccccceeeecCcccchhhhHHHHHhh
Q psy12486         26 CGRVLPAHLWLPLSGCTAGILGLTGFYGFGFYVLAVIGLWVLLLMRAGSKWNRYFLNRKSLLTNGFVGGLCTYVLFWTFF  105 (148)
Q Consensus        26 ~r~l~~~~d~sll~Gi~AGILGLtgl~GFlfy~i~~ll~sll~~~k~~~~~~~YF~s~~~i~~~g~~~~L~~FVL~WTl~  105 (148)
                      +||++     |+++|++||||||||+.||++|++++++++.+++.|+++++++||.+++|+++||+++++++|||+||++
T Consensus         6 ~r~~~-----a~~~Gi~aGILgLtg~~Gf~~f~~~~~~~s~~~~~~~~~~~~~~f~~~~~i~~~g~~~~l~~Fvl~Wtl~   80 (81)
T PF07019_consen    6 CRQII-----ALLAGIAAGILGLTGLYGFIFFFLSSFLVSLLYYAKAGFPDEDYFGGPWEIFTEGFFSGLSTFVLFWTLF   80 (81)
T ss_pred             HHHHH-----HHHHHHHhhhcccccHHHHHHHHHHHHHHHHHHHHHhcCChhhhcCCHHHHHHhhhhchHHHHHHHhhee
Confidence            45677     9999999999999999999999999999999988899999999999999999999999999999999998


Q ss_pred             h
Q psy12486        106 Y  106 (148)
Q Consensus       106 Y  106 (148)
                      |
T Consensus        81 Y   81 (81)
T PF07019_consen   81 Y   81 (81)
T ss_pred             C
Confidence            8


No 3  
>KOG3415|consensus
Probab=98.69  E-value=7.9e-09  Score=78.93  Aligned_cols=80  Identities=23%  Similarity=0.409  Sum_probs=68.3

Q ss_pred             cccccccchhhhhHhhhhhhccccchhhHHHHHHHHHHHHHHHHHHhCCCccccccccceeeecCcccchhhhHHHHHhh
Q psy12486         26 CGRVLPAHLWLPLSGCTAGILGLTGFYGFGFYVLAVIGLWVLLLMRAGSKWNRYFLNRKSLLTNGFVGGLCTYVLFWTFF  105 (148)
Q Consensus        26 ~r~l~~~~d~sll~Gi~AGILGLtgl~GFlfy~i~~ll~sll~~~k~~~~~~~YF~s~~~i~~~g~~~~L~~FVL~WTl~  105 (148)
                      .||+.     +++.|++-||+.|+|.-|.+.|...+..+.-+|+.+-..-.++=|-+-.++.-||++..+.+|.+.|+.+
T Consensus        48 ~rQVi-----~l~lGviwGi~pL~G~l~iv~f~~issgIvy~y~~~~~~VDEee~GG~weL~kEGf~asfa~FlvtWIi~  122 (129)
T KOG3415|consen   48 IRQVI-----GLILGVIWGIIPLVGFLGIVLFLGISSGIVYLYYANFLKVDEEEYGGHWELLKEGFMASFALFLVTWIIF  122 (129)
T ss_pred             HHHHH-----HHHHHHHHhhchhhhHHHHHHHHHhhhhHHHHHHHHHHhcCHHHhCcHHHHHHHHHHHHHHHHHHHHHHH
Confidence            78888     9999999999999999999999888777777776555544444455558999999999999999999999


Q ss_pred             hhhhh
Q psy12486        106 YTMGD  110 (148)
Q Consensus       106 Y~lVh  110 (148)
                      |++.|
T Consensus       123 Yt~~h  127 (129)
T KOG3415|consen  123 YTLAH  127 (129)
T ss_pred             Hhhhc
Confidence            99988


No 4  
>PF06839 zf-GRF:  GRF zinc finger;  InterPro: IPR010666 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This presumed zinc-binding domain is found in a variety of DNA-binding proteins. It seems likely that this domain is involved in nucleic acid binding. It is named GRF after three conserved residues in the centre of the alignment of the domain. This zinc finger may be related to IPR000380 from INTERPRO. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=72.55  E-value=1.7  Score=27.18  Aligned_cols=12  Identities=50%  Similarity=1.068  Sum_probs=10.5

Q ss_pred             ccCCCCcccccc
Q psy12486        136 PIPNQGMEFYSC  147 (148)
Q Consensus       136 ~~~~~~~~~~~~  147 (148)
                      .-+|+||.||.|
T Consensus        17 ~~~N~GR~Fy~C   28 (45)
T PF06839_consen   17 TGPNPGRRFYKC   28 (45)
T ss_pred             CCCCCCCcceEC
Confidence            458999999998


No 5  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=64.11  E-value=5  Score=30.76  Aligned_cols=12  Identities=33%  Similarity=0.570  Sum_probs=10.7

Q ss_pred             hhhHhhhhhhcc
Q psy12486         36 LPLSGCTAGILG   47 (148)
Q Consensus        36 sll~Gi~AGILG   47 (148)
                      .+++|+.|||+|
T Consensus        68 ~Ii~gv~aGvIg   79 (122)
T PF01102_consen   68 GIIFGVMAGVIG   79 (122)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             ehhHHHHHHHHH
Confidence            789999999987


No 6  
>PRK13682 hypothetical protein; Provisional
Probab=55.63  E-value=23  Score=23.59  Aligned_cols=20  Identities=25%  Similarity=0.431  Sum_probs=16.6

Q ss_pred             hhhHhhhhhhccccchhhHH
Q psy12486         36 LPLSGCTAGILGLTGFYGFG   55 (148)
Q Consensus        36 sll~Gi~AGILGLtgl~GFl   55 (148)
                      -++..++||++|.+|+.|-.
T Consensus         8 FliiA~iA~~lGF~GiAg~a   27 (51)
T PRK13682          8 FLVIALIAAVLGFGGIAGAA   27 (51)
T ss_pred             HHHHHHHHHHhccchHHHHH
Confidence            45678899999999999843


No 7  
>COG5487 Small integral membrane protein [Function unknown]
Probab=53.14  E-value=34  Score=22.98  Aligned_cols=18  Identities=33%  Similarity=0.473  Sum_probs=14.5

Q ss_pred             hhHhhhhhhccccchhhH
Q psy12486         37 PLSGCTAGILGLTGFYGF   54 (148)
Q Consensus        37 ll~Gi~AGILGLtgl~GF   54 (148)
                      ++.-++||.||..|+.|-
T Consensus         9 lvialIa~~lGFgGiaga   26 (54)
T COG5487           9 LVIALIAGALGFGGIAGA   26 (54)
T ss_pred             HHHHHHHHHhCcccHHHH
Confidence            456778999999999874


No 8  
>PF07043 DUF1328:  Protein of unknown function (DUF1328);  InterPro: IPR009760 This entry represents several hypothetical bacterial proteins of around 50 residues in length. The function of this family is unknown but is thought to be a membrane protein.; GO: 0005886 plasma membrane
Probab=46.30  E-value=51  Score=20.71  Aligned_cols=22  Identities=27%  Similarity=0.422  Sum_probs=17.8

Q ss_pred             hhHhhhhhhccccchhhHHHHH
Q psy12486         37 PLSGCTAGILGLTGFYGFGFYV   58 (148)
Q Consensus        37 ll~Gi~AGILGLtgl~GFlfy~   58 (148)
                      ++..++||++|.+|+.|-..=.
T Consensus         4 liiAliAg~lGF~Giag~a~~i   25 (39)
T PF07043_consen    4 LIIALIAGVLGFGGIAGTAAGI   25 (39)
T ss_pred             HHHHHHHHHcCcccHHHHHHHH
Confidence            5678899999999999875443


No 9  
>PHA00024 IX minor coat protein
Probab=30.21  E-value=36  Score=20.79  Aligned_cols=17  Identities=29%  Similarity=0.604  Sum_probs=13.2

Q ss_pred             chhhhHHHHHhhhhhhh
Q psy12486         94 GLCTYVLFWTFFYTMGD  110 (148)
Q Consensus        94 ~L~~FVL~WTl~Y~lVh  110 (148)
                      -+..|+|-|++.|++..
T Consensus         8 ffgA~ilG~~l~~~Il~   24 (33)
T PHA00024          8 FFGAYILGWALFYGILV   24 (33)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            35678999999998753


No 10 
>PF04418 DUF543:  Domain of unknown function (DUF543);  InterPro: IPR007512 This family of short eukaryotic proteins has no known function. Most of the members of this family are only 80 amino acid residues long. However the Arabidopsis homologue is over 300 residues long. These proteins contain a conserved N-terminal cysteine and a conserved motif GXGXGXG in the carboxy terminal half that may be functionally important.
Probab=23.72  E-value=81  Score=22.20  Aligned_cols=11  Identities=18%  Similarity=-0.085  Sum_probs=6.1

Q ss_pred             hhhHhhhhhhc
Q psy12486         36 LPLSGCTAGIL   46 (148)
Q Consensus        36 sll~Gi~AGIL   46 (148)
                      ++++|+++++|
T Consensus        36 G~~~G~~~s~l   46 (75)
T PF04418_consen   36 GFGIGVVFSLL   46 (75)
T ss_pred             hhhHHHHHHHH
Confidence            55566555544


No 11 
>PF13940 Ldr_toxin:  Toxin Ldr, type I toxin-antitoxin system
Probab=23.71  E-value=39  Score=20.88  Aligned_cols=15  Identities=20%  Similarity=0.078  Sum_probs=10.3

Q ss_pred             ccchh--hhhHhhhhhh
Q psy12486         31 PAHLW--LPLSGCTAGI   45 (148)
Q Consensus        31 ~~~d~--sll~Gi~AGI   45 (148)
                      .-||+  -+++|+++++
T Consensus        10 ~WhDLAAP~iagIi~s~   26 (35)
T PF13940_consen   10 FWHDLAAPIIAGIIASL   26 (35)
T ss_pred             HHHHhHhHHHHHHHHHH
Confidence            34888  5677777765


No 12 
>PF03613 EIID-AGA:  PTS system mannose/fructose/sorbose family IID component;  InterPro: IPR004704 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC []. These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).  The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site.  An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose [, , , ].  Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains.The Man family is unique in several respects among PTS permease families. It is the only PTS family in which members possess a IID protein.  It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue.  Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars.  The mannose permease of Escherichia coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine,N-acetylglucosamine, and other sugars. Other members of this can transport sorbose, fructose and N-acetylglucosamine.  This family is specific for the IID subunits of this family of PTS transporters.; GO: 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system, 0016021 integral to membrane
Probab=22.22  E-value=1.4e+02  Score=25.54  Aligned_cols=32  Identities=13%  Similarity=0.049  Sum_probs=24.4

Q ss_pred             hhhHhhhhhhccccchhhHHHHHHHHHHHHHH
Q psy12486         36 LPLSGCTAGILGLTGFYGFGFYVLAVIGLWVL   67 (148)
Q Consensus        36 sll~Gi~AGILGLtgl~GFlfy~i~~ll~sll   67 (148)
                      -+.+|++++.--=-++.|-++|++.+.+..+.
T Consensus       117 pI~~~i~~~la~~Gn~lGpil~~~~~~~~~~~  148 (264)
T PF03613_consen  117 PILASIAASLALQGNILGPILFLLLYNIIHFF  148 (264)
T ss_pred             HHHHHHHHHHHHcCCccHHHHHHHHHHHHHHH
Confidence            55666777766666888999999998887655


Done!