Query         psy12488
Match_columns 91
No_of_seqs    116 out of 1015
Neff          5.8 
Searched_HMMs 46136
Date          Fri Aug 16 20:36:52 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12488.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12488hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG0234 GroS Co-chaperonin Gro 100.0 4.8E-34   1E-38  187.1   8.4   84    6-89     13-96  (96)
  2 PRK00364 groES co-chaperonin G 100.0 3.4E-32 7.3E-37  178.0   9.4   83    6-88     13-95  (95)
  3 cd00320 cpn10 Chaperonin 10 Kd 100.0   3E-31 6.5E-36  172.8   8.7   82    6-87     12-93  (93)
  4 PTZ00414 10 kDa heat shock pro 100.0 1.8E-30 3.9E-35  171.8   8.3   78    6-88     22-99  (100)
  5 PRK14533 groES co-chaperonin G 100.0 2.7E-30 5.8E-35  168.3   8.6   79    6-89     13-91  (91)
  6 PF00166 Cpn10:  Chaperonin 10  100.0 1.9E-29   4E-34  163.8   8.6   81    7-87     13-93  (93)
  7 KOG1641|consensus               99.9 1.3E-26 2.7E-31  153.4   5.8   82    6-87     21-103 (104)
  8 KOG1197|consensus               93.8    0.06 1.3E-06   42.0   2.9   27   27-62     70-96  (336)
  9 PF08240 ADH_N:  Alcohol dehydr  93.5   0.078 1.7E-06   33.8   2.7   26   28-62     38-63  (109)
 10 COG1062 AdhC Zn-dependent alco  91.7    0.15 3.3E-06   40.6   2.6   23   29-60     63-85  (366)
 11 PF08140 Cuticle_1:  Crustacean  91.0    0.27 5.9E-06   27.6   2.5   34   15-48      2-38  (40)
 12 COG0604 Qor NADPH:quinone redu  89.6    0.49 1.1E-05   36.3   3.7   43   27-83     63-108 (326)
 13 TIGR03366 HpnZ_proposed putati  88.3    0.56 1.2E-05   34.3   3.2   30   29-62      6-36  (280)
 14 KOG0025|consensus               87.1     1.5 3.2E-05   34.8   4.9   43   28-79     84-130 (354)
 15 COG4384 Mu-like prophage prote  86.4     2.7 5.9E-05   31.0   5.7   50   28-83     78-134 (203)
 16 TIGR02819 fdhA_non_GSH formald  86.2    0.86 1.9E-05   35.5   3.3   25   28-61     68-92  (393)
 17 PF06890 Phage_Mu_Gp45:  Bacter  84.4     6.7 0.00015   27.9   6.9   40   17-64     48-87  (162)
 18 cd08230 glucose_DH Glucose deh  83.1     1.2 2.6E-05   33.5   2.8   24   28-61     64-87  (355)
 19 COG1064 AdhP Zn-dependent alco  83.1     1.2 2.6E-05   35.1   2.9   25   28-61     64-88  (339)
 20 KOG0022|consensus               81.9     1.4   3E-05   35.2   2.8   23   28-59     68-90  (375)
 21 PLN02586 probable cinnamyl alc  80.6     1.9 4.1E-05   32.9   3.1   24   28-60     73-96  (360)
 22 cd08281 liver_ADH_like1 Zinc-d  78.3     2.2 4.8E-05   32.4   2.8   24   28-60     68-91  (371)
 23 PRK10309 galactitol-1-phosphat  78.0     2.5 5.5E-05   31.5   3.0   25   28-61     60-84  (347)
 24 TIGR02822 adh_fam_2 zinc-bindi  77.7     2.4 5.2E-05   31.8   2.8   25   28-61     63-87  (329)
 25 TIGR01202 bchC 2-desacetyl-2-h  77.6     2.8 6.1E-05   31.1   3.1   47   28-84     65-115 (308)
 26 PLN02178 cinnamyl-alcohol dehy  77.4     2.7 5.9E-05   32.4   3.1   24   28-60     67-90  (375)
 27 PF02559 CarD_CdnL_TRCF:  CarD-  77.3       4 8.8E-05   25.7   3.4   30   52-81      2-39  (98)
 28 COG1329 Transcriptional regula  77.1       4 8.7E-05   29.4   3.7   38   50-87      3-50  (166)
 29 cd08301 alcohol_DH_plants Plan  76.9     2.5 5.4E-05   32.0   2.7   24   29-61     64-87  (369)
 30 cd08237 ribitol-5-phosphate_DH  76.5       7 0.00015   29.4   5.1   45   28-83     65-128 (341)
 31 PLN02827 Alcohol dehydrogenase  75.9     2.6 5.6E-05   32.4   2.6   24   29-61     71-94  (378)
 32 cd08293 PTGR2 Prostaglandin re  75.8     3.2   7E-05   30.6   3.1   25   28-61     75-99  (345)
 33 cd08269 Zn_ADH9 Alcohol dehydr  75.6     7.2 0.00016   28.0   4.8   26   28-62     58-83  (312)
 34 KOG0024|consensus               75.3     1.2 2.6E-05   35.4   0.7   26   28-62     68-93  (354)
 35 cd08239 THR_DH_like L-threonin  75.2     3.2 6.9E-05   30.7   2.9   26   28-62     61-86  (339)
 36 TIGR02818 adh_III_F_hyde S-(hy  75.1     3.2 6.9E-05   31.6   2.9   25   28-61     62-86  (368)
 37 cd08238 sorbose_phosphate_red   74.6     3.5 7.6E-05   31.9   3.1   25   29-61     70-94  (410)
 38 PLN02740 Alcohol dehydrogenase  74.3     3.2   7E-05   31.7   2.8   25   28-61     72-96  (381)
 39 cd08300 alcohol_DH_class_III c  73.8     3.8 8.3E-05   31.0   3.1   25   28-61     63-87  (368)
 40 TIGR03451 mycoS_dep_FDH mycoth  73.3       4 8.7E-05   30.7   3.1   24   28-60     61-84  (358)
 41 PRK10083 putative oxidoreducta  73.2     4.3 9.3E-05   29.9   3.1   24   29-61     61-84  (339)
 42 PLN02514 cinnamyl-alcohol dehy  72.9     3.8 8.3E-05   31.0   2.9   24   28-60     70-93  (357)
 43 cd08277 liver_alcohol_DH_like   71.8     4.4 9.5E-05   30.7   3.0   25   28-61     62-86  (365)
 44 PF01079 Hint:  Hint module;  I  71.4     8.6 0.00019   28.4   4.4   25   41-65     20-45  (217)
 45 cd08233 butanediol_DH_like (2R  70.6     4.6  0.0001   30.1   2.8   24   28-60     71-94  (351)
 46 TIGR00692 tdh L-threonine 3-de  70.4     5.3 0.00012   29.6   3.1   25   28-61     62-86  (340)
 47 cd08264 Zn_ADH_like2 Alcohol d  69.5     5.8 0.00013   28.9   3.1   25   28-61     61-85  (325)
 48 cd08292 ETR_like_2 2-enoyl thi  69.3       6 0.00013   28.6   3.1   26   28-62     65-90  (324)
 49 cd05278 FDH_like Formaldehyde   69.0     6.1 0.00013   29.0   3.1   24   28-60     61-84  (347)
 50 TIGR02817 adh_fam_1 zinc-bindi  68.6     6.3 0.00014   28.8   3.1   25   28-61     65-89  (336)
 51 cd08291 ETR_like_1 2-enoyl thi  68.0     6.7 0.00015   28.8   3.2   26   28-61     67-92  (324)
 52 cd08287 FDH_like_ADH3 formalde  67.7     6.4 0.00014   29.1   3.0   24   28-60     60-83  (345)
 53 cd08278 benzyl_alcohol_DH Benz  66.8     6.3 0.00014   29.8   2.9   24   28-60     62-85  (365)
 54 cd08235 iditol_2_DH_like L-idi  66.6     7.1 0.00015   28.7   3.1   24   28-60     60-83  (343)
 55 cd05188 MDR Medium chain reduc  66.2     7.1 0.00015   27.0   2.9   26   28-62     36-61  (271)
 56 cd08236 sugar_DH NAD(P)-depend  65.5     7.8 0.00017   28.6   3.1   25   28-61     59-83  (343)
 57 cd08260 Zn_ADH6 Alcohol dehydr  65.5     7.7 0.00017   28.7   3.1   24   28-60     61-84  (345)
 58 cd08261 Zn_ADH7 Alcohol dehydr  65.2     7.5 0.00016   28.6   3.0   24   28-60     60-83  (337)
 59 cd08262 Zn_ADH8 Alcohol dehydr  65.1     7.8 0.00017   28.5   3.1   25   28-61     70-95  (341)
 60 cd05284 arabinose_DH_like D-ar  65.1     7.8 0.00017   28.4   3.1   24   29-61     65-88  (340)
 61 cd08255 2-desacetyl-2-hydroxye  64.9      12 0.00025   26.7   3.8   26   27-61     26-51  (277)
 62 cd08285 NADP_ADH NADP(H)-depen  64.7     7.2 0.00016   29.0   2.8   25   28-61     60-84  (351)
 63 cd08286 FDH_like_ADH2 formalde  64.5     7.7 0.00017   28.7   2.9   24   29-61     62-85  (345)
 64 cd08284 FDH_like_2 Glutathione  64.0     8.5 0.00018   28.3   3.1   24   28-60     60-83  (344)
 65 cd08232 idonate-5-DH L-idonate  63.3       8 0.00017   28.4   2.8   23   29-60     61-83  (339)
 66 cd08283 FDH_like_1 Glutathione  63.2     8.4 0.00018   29.5   3.0   25   28-61     61-85  (386)
 67 cd08258 Zn_ADH4 Alcohol dehydr  62.8     9.5 0.00021   28.1   3.2   25   28-61     62-86  (306)
 68 cd05279 Zn_ADH1 Liver alcohol   62.6     9.2  0.0002   28.9   3.1   25   28-61     60-84  (365)
 69 PLN02702 L-idonate 5-dehydroge  62.4     8.5 0.00019   28.9   2.9   24   28-60     80-103 (364)
 70 COG1063 Tdh Threonine dehydrog  62.1     9.6 0.00021   29.3   3.2   53   28-90     62-141 (350)
 71 PTZ00354 alcohol dehydrogenase  62.0     9.8 0.00021   27.5   3.1   24   28-60     65-88  (334)
 72 COG3450 Predicted enzyme of th  61.9      15 0.00032   24.9   3.7   31   48-78     82-114 (116)
 73 cd08290 ETR 2-enoyl thioester   61.7     9.9 0.00022   27.9   3.1   26   28-62     70-95  (341)
 74 cd08279 Zn_ADH_class_III Class  61.3     8.9 0.00019   28.9   2.8   24   28-60     60-83  (363)
 75 cd05283 CAD1 Cinnamyl alcohol   61.2     9.7 0.00021   28.2   3.0   24   28-60     60-83  (337)
 76 PRK05396 tdh L-threonine 3-deh  60.5      11 0.00024   27.9   3.1   24   29-61     65-88  (341)
 77 cd08231 MDR_TM0436_like Hypoth  60.1     9.7 0.00021   28.4   2.8   30   28-61     61-91  (361)
 78 smart00829 PKS_ER Enoylreducta  59.9      10 0.00022   26.3   2.7   25   28-61     30-54  (288)
 79 cd08282 PFDH_like Pseudomonas   59.5      11 0.00023   28.7   3.0   24   28-60     60-83  (375)
 80 cd08274 MDR9 Medium chain dehy  59.3      11 0.00025   27.6   3.0   24   29-61     85-108 (350)
 81 cd05285 sorbitol_DH Sorbitol d  59.2      11 0.00024   27.9   3.0   24   28-60     61-84  (343)
 82 cd08259 Zn_ADH5 Alcohol dehydr  59.1      12 0.00025   27.1   3.0   25   28-61     61-85  (332)
 83 PRK10754 quinone oxidoreductas  59.0      12 0.00026   27.3   3.1   25   28-61     64-88  (327)
 84 COG2140 Thermophilic glucose-6  59.0      13 0.00029   27.6   3.3   35   43-77    121-156 (209)
 85 cd08246 crotonyl_coA_red croto  58.9      12 0.00025   28.5   3.1   24   29-61     89-112 (393)
 86 cd08240 6_hydroxyhexanoate_dh_  58.6      12 0.00026   27.8   3.1   25   28-61     73-97  (350)
 87 cd08266 Zn_ADH_like1 Alcohol d  57.9      11 0.00025   27.0   2.8   25   28-61     64-88  (342)
 88 cd08297 CAD3 Cinnamyl alcohol   57.8      29 0.00063   25.5   5.0   24   28-60     63-86  (341)
 89 PRK10838 spr outer membrane li  57.7     3.1 6.6E-05   30.2  -0.2   35   15-62    105-139 (190)
 90 PF10844 DUF2577:  Protein of u  57.5     9.8 0.00021   24.6   2.2   22   51-78     76-97  (100)
 91 cd08268 MDR2 Medium chain dehy  57.4      13 0.00029   26.4   3.1   24   28-60     64-87  (328)
 92 TIGR01751 crot-CoA-red crotony  57.1      12 0.00025   28.8   2.9   24   29-61     85-108 (398)
 93 cd07376 PLPDE_III_DSD_D-TA_lik  56.9      22 0.00047   26.9   4.3   37   51-88    305-342 (345)
 94 COG4079 Uncharacterized protei  56.8      19  0.0004   27.9   3.8   28   51-79    261-292 (293)
 95 cd08254 hydroxyacyl_CoA_DH 6-h  56.7      13 0.00028   27.0   2.9   23   29-60     64-86  (338)
 96 PRK09422 ethanol-active dehydr  56.3      13 0.00028   27.3   2.9   24   28-60     60-83  (338)
 97 cd05195 enoyl_red enoyl reduct  55.9      15 0.00032   25.4   3.0   25   28-61     34-58  (293)
 98 cd08234 threonine_DH_like L-th  55.9      15 0.00032   26.9   3.1   24   28-60     59-82  (334)
 99 cd08299 alcohol_DH_class_I_II_  55.7      13 0.00028   28.4   2.9   25   28-61     67-91  (373)
100 cd08245 CAD Cinnamyl alcohol d  55.1      15 0.00032   26.8   3.1   25   28-61     60-84  (330)
101 cd08270 MDR4 Medium chain dehy  55.0      16 0.00035   26.1   3.2   25   28-61     58-82  (305)
102 cd08244 MDR_enoyl_red Possible  54.7      16 0.00034   26.4   3.1   25   28-61     66-90  (324)
103 smart00696 DM9 Repeats found i  54.6      17 0.00037   22.2   2.8   53   20-74     12-66  (71)
104 cd05282 ETR_like 2-enoyl thioe  54.4      16 0.00035   26.3   3.1   26   28-62     63-88  (323)
105 cd08251 polyketide_synthase po  54.3      15 0.00033   25.8   2.9   25   28-61     44-68  (303)
106 TIGR03201 dearomat_had 6-hydro  53.6      16 0.00034   27.4   3.0   24   28-61     60-83  (349)
107 PF10794 DUF2606:  Protein of u  53.4      58  0.0013   22.6   5.5   42   26-69     71-112 (131)
108 PLN03154 putative allyl alcoho  53.3      14  0.0003   28.0   2.7   24   28-60     81-104 (348)
109 cd08265 Zn_ADH3 Alcohol dehydr  53.2      17 0.00036   27.8   3.1   25   28-61     94-118 (384)
110 cd08248 RTN4I1 Human Reticulon  53.0      16 0.00035   26.8   2.9   25   28-61     80-104 (350)
111 cd08273 MDR8 Medium chain dehy  52.2      17 0.00036   26.4   2.9   42   28-83     64-105 (331)
112 KOG0023|consensus               51.9      14  0.0003   29.7   2.5   25   28-61     72-96  (360)
113 PRK11479 hypothetical protein;  51.7     6.7 0.00015   30.2   0.8   39   11-62     37-75  (274)
114 TIGR00074 hypC_hupF hydrogenas  51.6      24 0.00051   22.1   3.1   12   51-62     35-46  (76)
115 cd06555 ASCH_PF0470_like ASC-1  51.4      12 0.00026   24.9   1.9   15   51-65     31-45  (109)
116 cd08249 enoyl_reductase_like e  51.3      19 0.00041   26.8   3.1   25   28-61     61-85  (339)
117 cd08263 Zn_ADH10 Alcohol dehyd  51.1      17 0.00036   27.4   2.8   27   28-60     60-86  (367)
118 cd00148 PROF Profilin binds ac  50.8      32 0.00069   22.9   3.9   20   66-85     60-79  (127)
119 cd08296 CAD_like Cinnamyl alco  50.8      19 0.00041   26.6   3.1   24   28-60     61-84  (333)
120 cd08267 MDR1 Medium chain dehy  50.7      20 0.00043   25.6   3.0   25   28-61     65-89  (319)
121 cd08298 CAD2 Cinnamyl alcohol   50.1      19  0.0004   26.3   2.9   23   29-60     66-88  (329)
122 PF01455 HupF_HypC:  HupF/HypC   50.1      22 0.00048   21.6   2.8   12   51-62     37-48  (68)
123 PRK13771 putative alcohol dehy  49.7      20 0.00044   26.2   3.0   25   28-61     61-85  (334)
124 cd08272 MDR6 Medium chain dehy  49.5      22 0.00047   25.3   3.1   25   28-61     64-88  (326)
125 cd08271 MDR5 Medium chain dehy  49.5      19 0.00042   25.7   2.9   25   28-61     63-87  (325)
126 cd08253 zeta_crystallin Zeta-c  49.3      19 0.00041   25.5   2.7   26   28-62     64-89  (325)
127 TIGR03214 ura-cupin putative a  48.6      32 0.00069   25.7   4.0   49   30-80    202-253 (260)
128 PRK09880 L-idonate 5-dehydroge  48.4      23 0.00049   26.5   3.2   24   28-62     66-89  (343)
129 cd05286 QOR2 Quinone oxidoredu  48.2      24 0.00051   24.8   3.1   25   28-61     61-85  (320)
130 cd08250 Mgc45594_like Mgc45594  47.2      25 0.00055   25.5   3.2   25   28-61     67-91  (329)
131 COG4043 Preprotein translocase  47.0      12 0.00026   25.2   1.3   12   51-62     33-44  (111)
132 cd08256 Zn_ADH2 Alcohol dehydr  46.3      23 0.00051   26.3   2.9   25   29-60     70-94  (350)
133 cd08252 AL_MDR Arginate lyase   45.3      25 0.00054   25.6   2.9   25   28-61     66-90  (336)
134 PRK05889 putative acetyl-CoA c  44.5      44 0.00095   19.7   3.5   29   59-87     42-70  (71)
135 PRK10413 hydrogenase 2 accesso  44.3      42  0.0009   21.3   3.5   12   51-62     42-53  (82)
136 cd05281 TDH Threonine dehydrog  44.3      28 0.00061   25.7   3.1   24   28-60     64-87  (341)
137 TIGR00739 yajC preprotein tran  44.1      66  0.0014   20.2   4.4   25   51-75     37-62  (84)
138 cd05276 p53_inducible_oxidored  44.0      26 0.00055   24.7   2.7   25   28-61     64-88  (323)
139 PF11302 DUF3104:  Protein of u  42.6      16 0.00035   23.1   1.3   15   50-64      4-18  (75)
140 TIGR03784 marine_sortase sorta  42.5      35 0.00075   24.2   3.2   32   51-82    108-139 (174)
141 PF00235 Profilin:  Profilin;    42.1      25 0.00054   22.6   2.3   18   65-82     58-75  (121)
142 cd08275 MDR3 Medium chain dehy  42.0      30 0.00065   24.8   2.9   25   28-61     63-87  (337)
143 PF05203 Hom_end_hint:  Hom_end  41.2      38 0.00083   24.9   3.4   30   35-64      3-33  (215)
144 cd08247 AST1_like AST1 is a cy  41.2      34 0.00074   25.3   3.2   25   28-60     65-89  (352)
145 smart00392 PROF Profilin. Bind  41.1      49  0.0011   22.0   3.6   19   66-84     62-80  (129)
146 TIGR02824 quinone_pig3 putativ  40.4      37 0.00079   24.0   3.1   25   28-61     64-88  (325)
147 cd05289 MDR_like_2 alcohol deh  40.2      32 0.00069   24.1   2.8   26   28-62     66-91  (309)
148 PF01052 SpoA:  Surface present  40.0      59  0.0013   19.3   3.6   26   51-76     28-55  (77)
149 PRK02268 hypothetical protein;  39.5      17 0.00036   25.4   1.2   14   47-60     30-44  (141)
150 cd08276 MDR7 Medium chain dehy  38.5      37 0.00079   24.4   2.9   25   28-61     64-88  (336)
151 PF12791 RsgI_N:  Anti-sigma fa  37.4      34 0.00074   19.3   2.1   12   51-62     25-36  (56)
152 PF07591 PT-HINT:  Pretoxin HIN  37.3      11 0.00024   25.3   0.0   19   43-62      5-24  (130)
153 cd06819 PLPDE_III_LS_D-TA Type  37.2      64  0.0014   24.5   4.1   36   51-87    316-352 (358)
154 cd00165 S4 S4/Hsp/ tRNA synthe  36.9      71  0.0015   17.2   3.6   28   51-78     41-69  (70)
155 cd04451 S1_IF1 S1_IF1: Transla  36.8      25 0.00054   20.5   1.5   11   51-61     40-50  (64)
156 PF13375 RnfC_N:  RnfC Barrel s  36.2      32 0.00069   22.4   2.1   13   49-61     43-55  (101)
157 COG3264 Small-conductance mech  36.1      47   0.001   29.5   3.6   16   51-66    660-675 (835)
158 PF12852 Cupin_6:  Cupin         35.9      23  0.0005   24.4   1.4   32   33-64     40-71  (186)
159 PRK10409 hydrogenase assembly   34.7      26 0.00056   22.7   1.4   12   51-62     41-52  (90)
160 PRK10689 transcription-repair   34.5      64  0.0014   29.4   4.2   32   50-81    475-514 (1147)
161 PRK00276 infA translation init  34.1      30 0.00064   20.9   1.5   14   51-64     46-61  (72)
162 PF09871 DUF2098:  Uncharacteri  34.0   1E+02  0.0023   19.9   4.2   34   51-84      2-40  (91)
163 PF11549 Sec31:  Protein transp  33.9      15 0.00032   21.6   0.1   19   20-38     29-47  (51)
164 cd05288 PGDH Prostaglandin deh  33.6      47   0.001   24.1   2.8   23   28-61     71-93  (329)
165 PF01878 EVE:  EVE domain;  Int  33.6      22 0.00049   23.6   1.0   12   51-62     39-50  (143)
166 KOG3309|consensus               33.2      11 0.00024   27.0  -0.5   22   41-62     49-70  (159)
167 PF13403 Hint_2:  Hint domain    33.2   1E+02  0.0022   21.1   4.3   38   38-75      7-44  (147)
168 cd08242 MDR_like Medium chain   33.1      55  0.0012   23.7   3.1   21   28-60     57-77  (319)
169 cd08243 quinone_oxidoreductase  33.1      55  0.0012   23.3   3.1   23   28-61     63-85  (320)
170 PRK05585 yajC preprotein trans  33.0 1.1E+02  0.0024   20.1   4.3   22   51-72     52-74  (106)
171 PF06560 GPI:  Glucose-6-phosph  33.0      44 0.00095   24.2   2.5   32   46-77    108-140 (182)
172 TIGR03635 S17_bact 30S ribosom  32.8      26 0.00057   21.5   1.2   13   50-62     47-59  (71)
173 TIGR00523 eIF-1A eukaryotic/ar  32.6      22 0.00048   23.3   0.8   17   50-66     56-72  (99)
174 cd08241 QOR1 Quinone oxidoredu  32.5      60  0.0013   22.8   3.2   25   28-61     64-88  (323)
175 PF02699 YajC:  Preprotein tran  32.5      15 0.00032   23.0   0.0   23   51-73     36-59  (82)
176 PF03829 PTSIIA_gutA:  PTS syst  32.5 1.6E+02  0.0034   19.7   5.2   13   29-41      5-17  (117)
177 PRK11165 diaminopimelate decar  32.4      79  0.0017   25.0   4.1   12   51-62    363-374 (420)
178 PF09285 Elong-fact-P_C:  Elong  32.4      41 0.00089   19.9   1.9   19   47-65     33-51  (56)
179 CHL00010 infA translation init  31.9      79  0.0017   19.5   3.3   15   50-64     45-61  (78)
180 TIGR00580 mfd transcription-re  31.8      75  0.0016   28.3   4.2   32   50-81    326-365 (926)
181 TIGR02825 B4_12hDH leukotriene  31.6      45 0.00097   24.5   2.4   21   28-60     64-84  (325)
182 COG0309 HypE Hydrogenase matur  31.3      42 0.00091   26.7   2.3   31   36-66    145-175 (339)
183 PRK06763 F0F1 ATP synthase sub  30.9      64  0.0014   24.1   3.1   35   27-61     40-84  (213)
184 cd06820 PLPDE_III_LS_D-TA_like  30.9      90  0.0019   23.7   4.1   37   51-88    311-348 (353)
185 COG4506 Uncharacterized protei  30.9      47   0.001   23.4   2.3   22   66-87     56-77  (143)
186 COG1465 Predicted alternative   30.7 1.5E+02  0.0032   23.8   5.2   34   47-80    276-316 (376)
187 PF07378 FlbT:  Flagellar prote  30.3      43 0.00094   22.8   2.0   34   50-84      3-42  (126)
188 PF15057 DUF4537:  Domain of un  30.1      49  0.0011   22.1   2.2   14   49-62     53-66  (124)
189 PF02643 DUF192:  Uncharacteriz  30.1      17 0.00038   23.6   0.0   25   32-62     84-108 (108)
190 cd06812 PLPDE_III_DSD_D-TA_lik  29.9      92   0.002   23.8   4.0   36   51-87    331-368 (374)
191 PF03293 Pox_RNA_pol:  Poxvirus  29.9 1.2E+02  0.0025   21.7   4.1   34   51-84     98-131 (160)
192 PRK06531 yajC preprotein trans  29.8 1.2E+02  0.0027   20.3   4.1   33   51-83     36-70  (113)
193 PF13856 Gifsy-2:  ATP-binding   29.6      82  0.0018   19.8   3.1   30   50-81     56-85  (95)
194 PF13464 DUF4115:  Domain of un  29.6 1.2E+02  0.0026   18.1   3.8   24   54-77     38-61  (77)
195 TIGR03102 halo_cynanin halocya  29.6      88  0.0019   20.8   3.4   32   30-61     22-55  (115)
196 PF11901 DUF3421:  Protein of u  29.5      42 0.00091   22.2   1.8   49   20-70     68-118 (119)
197 PF06236 MelC1:  Tyrosinase co-  29.3      75  0.0016   21.9   3.0   18   65-82     70-87  (125)
198 cd05829 Sortase_E Sortase E (S  29.3      67  0.0015   21.7   2.8   41   30-70     49-91  (144)
199 smart00306 HintN Hint (Hedgeho  29.1      49  0.0011   19.8   2.0   22   42-63     11-33  (100)
200 cd08294 leukotriene_B4_DH_like  29.0 1.1E+02  0.0024   22.1   4.1   11   51-61     77-87  (329)
201 PRK04190 glucose-6-phosphate i  28.9 1.2E+02  0.0026   21.9   4.3   34   43-76    115-149 (191)
202 COG0298 HypC Hydrogenase matur  28.7      55  0.0012   21.0   2.2   17   46-62     33-49  (82)
203 PF00278 Orn_DAP_Arg_deC:  Pyri  28.6      51  0.0011   20.7   2.1   34   32-65     59-96  (116)
204 cd03703 aeIF5B_II aeIF5B_II: T  27.8      67  0.0015   21.5   2.6   19   51-69     26-47  (110)
205 PRK05886 yajC preprotein trans  27.8      78  0.0017   21.1   2.9   21   51-71     38-59  (109)
206 PRK13914 invasion associated s  27.4      27 0.00059   29.0   0.7   35   16-63    404-438 (481)
207 PRK06033 hypothetical protein;  27.4 1.5E+02  0.0033   18.5   4.0   27   51-77     27-55  (83)
208 PF00877 NLPC_P60:  NlpC/P60 fa  27.1      27 0.00058   21.8   0.5   30   50-79     50-82  (105)
209 PRK06788 flagellar motor switc  26.8 1.4E+02   0.003   20.2   4.0   47   27-76     33-81  (119)
210 cd04486 YhcR_OBF_like YhcR_OBF  26.7 1.6E+02  0.0034   18.0   4.1   36   16-61     16-54  (78)
211 smart00841 Elong-fact-P_C Elon  26.7      58  0.0013   19.2   1.9   17   47-63     33-49  (56)
212 TIGR01048 lysA diaminopimelate  26.5   1E+02  0.0022   23.9   3.8   32   32-64    339-374 (417)
213 PRK05610 rpsQ 30S ribosomal pr  26.4      38 0.00082   21.5   1.1   12   51-62     53-64  (84)
214 PF05899 Cupin_3:  Protein of u  26.3      79  0.0017   18.9   2.5   28   28-62     31-58  (74)
215 PRK08433 flagellar motor switc  26.2 1.5E+02  0.0033   19.7   4.1   46   29-77     33-80  (111)
216 PF13759 2OG-FeII_Oxy_5:  Putat  26.2      36 0.00078   21.3   1.0   20   45-64     63-82  (101)
217 cd05794 S1_EF-P_repeat_2 S1_EF  26.1      58  0.0013   19.2   1.8   18   47-64     33-50  (56)
218 PRK08666 5'-methylthioadenosin  26.1      63  0.0014   23.9   2.4   26   31-63     77-103 (261)
219 PTZ00316 profilin; Provisional  25.7      99  0.0021   21.9   3.2   15   66-80     60-74  (150)
220 PRK10377 PTS system glucitol/s  25.6 2.1E+02  0.0047   19.2   4.8   14   65-78     55-68  (120)
221 cd06166 Sortase_D_5 Sortase D   25.5      93   0.002   20.4   2.9   51   31-82     43-94  (126)
222 PF01426 BAH:  BAH domain;  Int  25.4      66  0.0014   20.1   2.1   14   51-64      2-15  (119)
223 PF12508 DUF3714:  Protein of u  25.0      72  0.0016   23.4   2.5   27   12-42     78-104 (200)
224 TIGR03595 Obg_CgtA_exten Obg f  24.9      44 0.00094   20.2   1.1   16   48-63     50-65  (69)
225 cd04466 S1_YloQ_GTPase S1_YloQ  24.8      44 0.00096   19.1   1.1   13   50-62     36-48  (68)
226 TIGR02480 fliN flagellar motor  24.8 1.7E+02  0.0036   17.6   4.0   26   51-76     28-55  (77)
227 TIGR01700 PNPH purine nucleosi  24.7      68  0.0015   23.7   2.3   25   32-63     85-110 (249)
228 KOG0276|consensus               24.7 2.6E+02  0.0057   24.6   6.0   48   12-61    305-354 (794)
229 PF05382 Amidase_5:  Bacterioph  24.0   1E+02  0.0022   21.4   3.0   33   51-84     75-107 (145)
230 cd02558 PSRA_1 PSRA_1: Pseudou  24.0      98  0.0021   22.7   3.1   11   51-61     16-26  (246)
231 PF05721 PhyH:  Phytanoyl-CoA d  23.9      38 0.00083   22.4   0.8   18   46-63    178-195 (211)
232 PF11213 DUF3006:  Protein of u  23.7      98  0.0021   18.6   2.6   14   47-60     29-42  (71)
233 TIGR01697 PNPH-PUNA-XAPA inosi  23.6      80  0.0017   23.2   2.6   27   30-63     83-110 (248)
234 TIGR02219 phage_NlpC_fam putat  23.3      46   0.001   22.2   1.1   12   51-62     76-87  (134)
235 COG3061 OapA Cell envelope opa  23.2 1.1E+02  0.0025   23.2   3.3   32   51-82    199-235 (242)
236 PRK10334 mechanosensitive chan  23.2 1.2E+02  0.0027   23.0   3.6   34   51-84    129-171 (286)
237 TIGR01511 ATPase-IB1_Cu copper  22.9 1.3E+02  0.0028   24.8   3.9   32   27-59    124-158 (562)
238 PF00924 MS_channel:  Mechanose  22.8   2E+02  0.0042   19.7   4.3   21   51-71     60-80  (206)
239 COG3794 PetE Plastocyanin [Ene  22.7      86  0.0019   21.5   2.4   13   51-63     57-69  (128)
240 PF02989 DUF228:  Lyme disease   22.7   2E+02  0.0042   21.1   4.3   37   13-64    105-141 (184)
241 COG1829 Predicted archaeal kin  22.7 1.3E+02  0.0028   23.4   3.6   50   15-77     11-60  (283)
242 PF09269 DUF1967:  Domain of un  22.0      46 0.00099   20.1   0.8   15   49-63     51-65  (69)
243 PRK08983 fliN flagellar motor   21.6 2.2E+02  0.0049   19.3   4.3   46   28-76     51-98  (127)
244 PRK03760 hypothetical protein;  21.3      72  0.0016   21.2   1.8   15   48-62    102-116 (117)
245 TIGR02375 pseudoazurin pseudoa  21.2      51  0.0011   21.9   1.0   20   51-70     18-38  (116)
246 PF13533 Biotin_lipoyl_2:  Biot  21.2      59  0.0013   18.1   1.1    9   51-59     23-31  (50)
247 TIGR00849 gutA PTS system, glu  21.1 2.7E+02  0.0059   18.7   4.6   13   65-77     55-67  (121)
248 cd06813 PLPDE_III_DSD_D-TA_lik  21.1 1.2E+02  0.0025   23.8   3.1   37   51-88    342-379 (388)
249 cd06821 PLPDE_III_D-TA Type II  21.0 1.7E+02  0.0037   22.2   4.0   36   51-87    315-351 (361)
250 PF06865 DUF1255:  Protein of u  20.9      86  0.0019   20.5   2.0   30   12-41     23-52  (94)
251 TIGR01694 MTAP 5'-deoxy-5'-met  20.8      88  0.0019   22.8   2.3   13   51-63     91-103 (241)
252 PRK12426 elongation factor P;   20.8 1.5E+02  0.0033   21.4   3.5   40   43-82     45-87  (185)
253 cd05828 Sortase_D_4 Sortase D   20.7 1.3E+02  0.0028   19.7   2.9   48   30-82     43-91  (127)
254 PF15436 PGBA_N:  Plasminogen-b  20.6 2.9E+02  0.0062   20.7   5.0   53   12-64     26-92  (218)
255 PF07883 Cupin_2:  Cupin domain  20.5      98  0.0021   17.2   2.0   29   49-77     38-67  (71)
256 KOG2107|consensus               20.4 1.3E+02  0.0027   22.0   2.9   33   30-62     95-130 (179)
257 PRK11507 ribosome-associated p  20.4 2.1E+02  0.0046   17.6   3.6   15   63-77     54-68  (70)
258 PRK02290 3-dehydroquinate synt  20.4      77  0.0017   25.3   2.0   19   43-61    306-325 (344)
259 PRK08564 5'-methylthioadenosin  20.4 1.1E+02  0.0023   23.2   2.7   13   51-63     99-111 (267)
260 PRK09838 periplasmic copper-bi  20.2 1.6E+02  0.0034   19.7   3.2   23   51-79     88-110 (115)
261 cd00992 PDZ_signaling PDZ doma  20.1 1.9E+02  0.0041   16.4   3.4   39   15-59     13-51  (82)
262 PRK05698 fliN flagellar motor   20.0 2.2E+02  0.0047   20.2   4.0   44   30-76     81-126 (155)
263 PF11963 DUF3477:  Protein of u  20.0      44 0.00095   26.6   0.5   30    4-33     24-53  (355)
264 PRK00529 elongation factor P;   20.0 2.2E+02  0.0048   20.2   4.2   44   15-63    120-177 (186)

No 1  
>COG0234 GroS Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=4.8e-34  Score=187.13  Aligned_cols=84  Identities=38%  Similarity=0.727  Sum_probs=81.0

Q ss_pred             cccccceecceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECCEEEEEEecCcEEE
Q psy12488          6 NKLSIYLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLA   85 (91)
Q Consensus         6 ~k~~~e~~T~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~DIla   85 (91)
                      +++++|++|+|||+||++|++|++.|+|||||+|..+.+|+++|++||+||+|+|++|+|+++++||++|++++++||||
T Consensus        13 k~~e~EekT~gGIvlpdsakeK~~~g~VvAVG~G~~~~~g~~~~~~VkvGD~Vlf~ky~G~evk~dgeeylil~e~DILA   92 (96)
T COG0234          13 KRVEEEEKTAGGIVLPDSAKEKPQEGEVVAVGPGRRDENGELVPLDVKVGDRVLFGKYAGTEVKIDGEEYLILSESDILA   92 (96)
T ss_pred             EEchhhccccCcEEecCccccCCcceEEEEEccceecCCCCEeccccccCCEEEECccCCcEEEECCEEEEEechHHeeE
Confidence            46788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Eeec
Q psy12488         86 VIEK   89 (91)
Q Consensus        86 vi~~   89 (91)
                      ++++
T Consensus        93 iv~~   96 (96)
T COG0234          93 IVEK   96 (96)
T ss_pred             EecC
Confidence            9874


No 2  
>PRK00364 groES co-chaperonin GroES; Reviewed
Probab=99.98  E-value=3.4e-32  Score=177.99  Aligned_cols=83  Identities=40%  Similarity=0.731  Sum_probs=79.7

Q ss_pred             cccccceecceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECCEEEEEEecCcEEE
Q psy12488          6 NKLSIYLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLA   85 (91)
Q Consensus         6 ~k~~~e~~T~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~DIla   85 (91)
                      ++.+.+++|+|||+||+++++|++.|+|+|||||+.+.+|+++|++||+||+|+|++|+|++|++++++|+|+|++||||
T Consensus        13 ~~~~~e~~T~gGI~Lp~~a~~k~~~G~VvaVG~G~~~~~G~~~~~~vk~GD~Vlf~~~~g~ev~~~~~~y~iv~~~DIla   92 (95)
T PRK00364         13 KRLEEEEKTAGGIVLPDSAKEKPQEGEVVAVGPGRRLDNGERVPLDVKVGDKVLFGKYAGTEVKIDGEEYLILRESDILA   92 (95)
T ss_pred             EEcccCccccceEEcCccccCCcceEEEEEECCCeECCCCCEeecccCCCCEEEEcCCCCeEEEECCEEEEEEEHHHEEE
Confidence            45678899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Eee
Q psy12488         86 VIE   88 (91)
Q Consensus        86 vi~   88 (91)
                      +++
T Consensus        93 vi~   95 (95)
T PRK00364         93 IVE   95 (95)
T ss_pred             EeC
Confidence            985


No 3  
>cd00320 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts. It forms heptameric rings with a dome-like structure, forming a lid to the large cavity of the tetradecameric cpn60 cylinder and thereby tightly regulating release and binding of proteins to the cpn60 surface.
Probab=99.97  E-value=3e-31  Score=172.82  Aligned_cols=82  Identities=41%  Similarity=0.782  Sum_probs=79.0

Q ss_pred             cccccceecceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECCEEEEEEecCcEEE
Q psy12488          6 NKLSIYLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLA   85 (91)
Q Consensus         6 ~k~~~e~~T~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~DIla   85 (91)
                      ++.+.+++|+|||+||++++++++.|+|+|||||+.+.+|++.|++|++||+|+|++|+|++|+++|++|+|+|++||||
T Consensus        12 ~~~~~e~~T~~GI~Lp~~~~~k~~~g~VvAVG~g~~~~~g~~~~~~vk~GD~Vl~~~~~g~~v~~~~~~y~i~~~~DIla   91 (93)
T cd00320          12 KRIEAEEKTKGGIILPDSAKEKPQEGKVVAVGPGRRNENGERVPLSVKVGDKVLFPKYAGTEVKLDGEEYLILRESDILA   91 (93)
T ss_pred             EEccccceecceEEeCCCcCCCceEEEEEEECCCeECCCCCCccccccCCCEEEECCCCceEEEECCEEEEEEEHHHEEE
Confidence            45678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Ee
Q psy12488         86 VI   87 (91)
Q Consensus        86 vi   87 (91)
                      ++
T Consensus        92 ~i   93 (93)
T cd00320          92 VI   93 (93)
T ss_pred             EC
Confidence            85


No 4  
>PTZ00414 10 kDa heat shock protein; Provisional
Probab=99.97  E-value=1.8e-30  Score=171.76  Aligned_cols=78  Identities=42%  Similarity=0.726  Sum_probs=73.2

Q ss_pred             cccccceecceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECCEEEEEEecCcEEE
Q psy12488          6 NKLSIYLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLA   85 (91)
Q Consensus         6 ~k~~~e~~T~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~DIla   85 (91)
                      ++.+++++|+|||+||+++++|+++|+|+|||+|..+     .|++||+||+|+|++|+|++|+++|++|++++++||||
T Consensus        22 k~~~~e~kT~gGIiLP~sakekp~~g~VvAVG~G~~~-----~~~~Vk~GD~Vl~~~y~Gtevk~dg~ey~i~~e~DILa   96 (100)
T PTZ00414         22 KRTLAAKQTKAGVLIPEQVAGKVNEGTVVAVAAATKD-----WTPTVKVGDTVLLPEFGGSSVKVEGEEFFLYNEDSLLG   96 (100)
T ss_pred             EEcccccccccCEEcccccccCCceeEEEEECCCCcc-----ccceecCCCEEEEcCCCCcEEEECCEEEEEEEhHHEEE
Confidence            4567899999999999999999999999999999754     48899999999999999999999999999999999999


Q ss_pred             Eee
Q psy12488         86 VIE   88 (91)
Q Consensus        86 vi~   88 (91)
                      +++
T Consensus        97 vi~   99 (100)
T PTZ00414         97 VLQ   99 (100)
T ss_pred             Eec
Confidence            986


No 5  
>PRK14533 groES co-chaperonin GroES; Provisional
Probab=99.97  E-value=2.7e-30  Score=168.32  Aligned_cols=79  Identities=30%  Similarity=0.482  Sum_probs=73.7

Q ss_pred             cccccceecceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECCEEEEEEecCcEEE
Q psy12488          6 NKLSIYLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLA   85 (91)
Q Consensus         6 ~k~~~e~~T~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~DIla   85 (91)
                      ++.+++++|+|||+||+++++|++.|+|+|||+|..     ..|++||+||+|+|++|+|++|+++|++|+|++++||||
T Consensus        13 k~~~~e~~T~gGI~Lp~~a~ek~~~G~VvavG~g~~-----~~~~~Vk~GD~Vl~~~y~g~ev~~~~~~y~iv~e~DILa   87 (91)
T PRK14533         13 KPIKEEKKTEGGIVLPDSAKEKPMKAEVVAVGKLDD-----EEDFDIKVGDKVIFSKYAGTEIKIDDEDYIIIDVNDILA   87 (91)
T ss_pred             EEccccceecccEEecccccCCcceEEEEEECCCCc-----cccccccCCCEEEEccCCCeEEEECCEEEEEEEhHhEEE
Confidence            456788999999999999999999999999999863     568999999999999999999999999999999999999


Q ss_pred             Eeec
Q psy12488         86 VIEK   89 (91)
Q Consensus        86 vi~~   89 (91)
                      +++|
T Consensus        88 ~i~~   91 (91)
T PRK14533         88 KIEE   91 (91)
T ss_pred             EeeC
Confidence            9975


No 6  
>PF00166 Cpn10:  Chaperonin 10 Kd subunit;  InterPro: IPR020818 The chaperonins are `helper' molecules required for correct folding and subsequent assembly of some proteins []. These are required for normal cell growth [], and are stress-induced, acting to stabilise or protect disassembled polypeptides under heat-shock conditions. Type I chaperonins present in eubacteria, mitochondria and chloroplasts require the concerted action of 2 proteins, chaperonin 60 (cpn60) and chaperonin 10 (cpn10) [].  The 10 kDa chaperonin (cpn10 - or groES in bacteria) exists as a ring-shaped oligomer of between six to eight identical subunits, while the 60 kDa chaperonin (cpn60 - or groEL in bacteria) forms a structure comprising 2 stacked rings, each ring containing 7 identical subunits []. These ring structures assemble by self-stimulation in the presence of Mg2+-ATP. The central cavity of the cylindrical cpn60 tetradecamer provides as isolated environment for protein folding whilst cpn-10 binds to cpn-60 and synchronizes the release of the folded protein in an Mg2+-ATP dependent manner []. The binding of cpn10 to cpn60 inhibits the weak ATPase activity of cpn60.  Escherichia coli GroES has also been shown to bind ATP cooperatively, and with an affinity comparable to that of GroEL []. Each GroEL subunit contains three structurally distinct domains: an apical, an intermediate and an equatorial domain. The apical domain contains the binding sites for both GroES and the unfolded protein substrate. The equatorial domain contains the ATP-binding site and most of the oligomeric contacts. The intermediate domain links the apical and equatorial domains and transfers allosteric information between them. The GroEL oligomer is a tetradecamer, cylindrically shaped, that is organised in two heptameric rings stacked back to back. Each GroEL ring contains a central cavity, known as the `Anfinsen cage', that provides an isolated environment for protein folding. The identical 10 kDa subunits of GroES form a dome-like heptameric oligomer in solution. ATP binding to GroES may be important in charging the seven subunits of the interacting GroEL ring with ATP, to facilitate cooperative ATP binding and hydrolysis for substrate protein release.; GO: 0006457 protein folding, 0005737 cytoplasm; PDB: 1PF9_Q 1AON_P 1SX4_T 1SVT_R 2C7D_P 1PCQ_O 2C7C_Q 1GRU_Q 1WNR_F 1P3H_I ....
Probab=99.96  E-value=1.9e-29  Score=163.83  Aligned_cols=81  Identities=42%  Similarity=0.715  Sum_probs=75.0

Q ss_pred             ccccceecceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECCEEEEEEecCcEEEE
Q psy12488          7 KLSIYLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLLAV   86 (91)
Q Consensus         7 k~~~e~~T~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~DIlav   86 (91)
                      +.+++++|+|||+||+++++++++|+|||||+|+.+.+|+.+|+.|++||+|+|++|+|++++++|++|+++|++||||+
T Consensus        13 ~~~~e~~T~~GiiLp~~~~~~~~~G~VvaVG~G~~~~~g~~~~~~vk~GD~Vl~~~~~g~~v~~~~~~~~~~~~~dIlav   92 (93)
T PF00166_consen   13 KIEAEEKTASGIILPESAKEKPNQGKVVAVGPGRYNENGEEVPMDVKVGDKVLFPKYAGTEVKFDGEKYLIVREDDILAV   92 (93)
T ss_dssp             ECSCTCTCTTSCCE-CCSSSSEEEEEEEEE-SEEETTTSSEEETSS-TTSEEEEETTTSEEEEETTEEEEEEEGGGEEEE
T ss_pred             EccccceecceEEeccccccccceeEEEEcCCccccCCCcEeeeeeeeccEEeccccCceEEEECCEEEEEEEHHHeEEE
Confidence            45779999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             e
Q psy12488         87 I   87 (91)
Q Consensus        87 i   87 (91)
                      +
T Consensus        93 i   93 (93)
T PF00166_consen   93 I   93 (93)
T ss_dssp             E
T ss_pred             C
Confidence            6


No 7  
>KOG1641|consensus
Probab=99.93  E-value=1.3e-26  Score=153.43  Aligned_cols=82  Identities=43%  Similarity=0.766  Sum_probs=77.7

Q ss_pred             cccccceecceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECC-EEEEEEecCcEE
Q psy12488          6 NKLSIYLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEG-QELHLFKEADLL   84 (91)
Q Consensus         6 ~k~~~e~~T~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg-~~y~ii~~~DIl   84 (91)
                      +|.+++++|+|||+||++++.|.++|+|+|||||.++..|+.+|.+|++||+|||++|+|++|++++ ++|+++|.+|+|
T Consensus        21 qr~~a~~KT~gGilLPEks~~K~~~g~VvavGpG~~~~~G~~v~~~Vk~Gd~VLlpeygGt~V~l~~~~~~~~fr~e~~l  100 (104)
T KOG1641|consen   21 QRIEAPTKTAGGILLPEKSVGKLLQGTVVAVGPGSRDKGGEIVPVSVKVGDRVLLPEYGGTKVKLGDEDEYHLFRDEDDL  100 (104)
T ss_pred             eeeeccccccceeEeccccccccceEEEEEEcCccccCCCCCcCccccCCCEEEeeccCCcEEeccCCceeEEecchhhh
Confidence            5678899999999999999999999999999999999999999999999999999999999999985 699999999999


Q ss_pred             EEe
Q psy12488         85 AVI   87 (91)
Q Consensus        85 avi   87 (91)
                      +.+
T Consensus       101 ~~~  103 (104)
T KOG1641|consen  101 LAI  103 (104)
T ss_pred             hhh
Confidence            875


No 8  
>KOG1197|consensus
Probab=93.78  E-value=0.06  Score=41.97  Aligned_cols=27  Identities=41%  Similarity=0.478  Sum_probs=23.4

Q ss_pred             cceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         27 EVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        27 k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      +...|.|+|||.|..         +.++||+|.|-.
T Consensus        70 mEaaGvVvAvG~gvt---------drkvGDrVayl~   96 (336)
T KOG1197|consen   70 MEAAGVVVAVGEGVT---------DRKVGDRVAYLN   96 (336)
T ss_pred             cccceEEEEecCCcc---------ccccccEEEEec
Confidence            567899999999986         589999999854


No 9  
>PF08240 ADH_N:  Alcohol dehydrogenase GroES-like domain;  InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1.1.1.1 from EC). Many of them contain an inserted zinc binding domain. This domain has a GroES-like structure; a name derived from the superfamily of proteins with a GroES fold. Proteins with a GroES fold structure have a highly conserved hydrophobic core and a glycyl-aspartate dipeptide which is thought to maintain the fold [, ].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1YKF_D 2NVB_A 3FSR_D 1BXZ_B 3FTN_A 3MEQ_D 3UOG_B 3HZZ_B 4DVJ_A 1P0F_A ....
Probab=93.52  E-value=0.078  Score=33.82  Aligned_cols=26  Identities=46%  Similarity=0.714  Sum_probs=21.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|+|+++|++..         .+++||+|....
T Consensus        38 E~~G~V~~vG~~v~---------~~~~Gd~V~~~~   63 (109)
T PF08240_consen   38 EGVGVVVAVGPGVT---------DFKVGDRVVVSP   63 (109)
T ss_dssp             EEEEEEEEESTTTT---------SSGTT-EEEEES
T ss_pred             ceeeeeeeeccccc---------cccccceeeeec
Confidence            47899999999875         599999999844


No 10 
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]
Probab=91.68  E-value=0.15  Score=40.62  Aligned_cols=23  Identities=43%  Similarity=0.683  Sum_probs=20.7

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      -.|.|.+||+|..         +||+||+|+.
T Consensus        63 gAGiVe~VG~gVt---------~vkpGDhVI~   85 (366)
T COG1062          63 GAGIVEAVGEGVT---------SVKPGDHVIL   85 (366)
T ss_pred             cccEEEEecCCcc---------ccCCCCEEEE
Confidence            4799999999987         7999999985


No 11 
>PF08140 Cuticle_1:  Crustacean cuticle protein repeat;  InterPro: IPR012539 This family consists of the cuticle proteins from the Cancer pagurus (Rock crab) and the Homarus americanus (American lobster). These proteins are isolated from the calcified regions of the crustacean and they contain two copies of an 18 residue sequence motif, which thus far has been found only in crustacean calcified exoskeletons [].; GO: 0042302 structural constituent of cuticle
Probab=91.03  E-value=0.27  Score=27.64  Aligned_cols=34  Identities=29%  Similarity=0.640  Sum_probs=23.3

Q ss_pred             ceeEEecCCccc--cceeEEEEEEcC-CeeCCCCeEe
Q psy12488         15 PGGVLIPEKAQQ--EVNNAVVVAVGP-GARTPNGEYI   48 (91)
Q Consensus        15 ~~GI~LP~~~~~--k~~~G~VVAVG~-G~~~~~G~~~   48 (91)
                      .|||+.|+...-  ..-.+.|+.+|| |....||+.+
T Consensus         2 ~SGii~~dG~~~q~~~~~a~ivl~GpSG~v~sdG~nv   38 (40)
T PF08140_consen    2 PSGIITPDGTNVQFPHGVANIVLIGPSGAVLSDGKNV   38 (40)
T ss_pred             CCceECCCCCEEECCcccceEEEECCceEEeeCCcEe
Confidence            489999998643  223337999999 6666666543


No 12 
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]
Probab=89.60  E-value=0.49  Score=36.29  Aligned_cols=43  Identities=35%  Similarity=0.431  Sum_probs=30.2

Q ss_pred             cceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC-CCceEEEECC--EEEEEEecCcE
Q psy12488         27 EVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK-FGGTKIEVEG--QELHLFKEADL   83 (91)
Q Consensus        27 k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~-y~g~ev~~dg--~~y~ii~~~DI   83 (91)
                      .-..|+|+|||++..         ..++||+|++.. ..     .+|  -+|..+.++.+
T Consensus        63 ~d~aG~V~avG~~V~---------~~~~GdrV~~~~~~~-----~~G~~AEy~~v~a~~~  108 (326)
T COG0604          63 SEAAGVVVAVGSGVT---------GFKVGDRVAALGGVG-----RDGGYAEYVVVPADWL  108 (326)
T ss_pred             ceeEEEEEEeCCCCC---------CcCCCCEEEEccCCC-----CCCcceeEEEecHHHc
Confidence            357899999999886         359999999984 21     122  56666666443


No 13 
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase. This clade of zinc-binding alcohol dehydrogenases (members of pfam00107) are repeatedly associated with genes proposed to be involved with the catabolism of phosphonate compounds.
Probab=88.32  E-value=0.56  Score=34.27  Aligned_cols=30  Identities=23%  Similarity=0.312  Sum_probs=21.6

Q ss_pred             eeEEEEEEcCCeeC-CCCeEecCcccCCCEEEcCC
Q psy12488         29 NNAVVVAVGPGART-PNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        29 ~~G~VVAVG~G~~~-~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ..|+|+++|++... ..|.    .+++||+|....
T Consensus         6 ~~G~V~~vG~~v~~~~~~~----~~~~GdrV~~~~   36 (280)
T TIGR03366         6 IVGEVVALRGGFTPADDGV----PLRLGQRVVWSV   36 (280)
T ss_pred             cceEEEEeCCCccccccCC----CCCCCCEEEEcC
Confidence            57999999998641 1121    489999998754


No 14 
>KOG0025|consensus
Probab=87.06  E-value=1.5  Score=34.80  Aligned_cols=43  Identities=26%  Similarity=0.202  Sum_probs=29.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC-CCce---EEEECCEEEEEEe
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK-FGGT---KIEVEGQELHLFK   79 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~-y~g~---ev~~dg~~y~ii~   79 (91)
                      .-.|+||+||++..         .+|+||+|+-.. --|+   +..+++.+++-+.
T Consensus        84 EGv~eVv~vGs~vk---------gfk~Gd~VIp~~a~lGtW~t~~v~~e~~Li~vd  130 (354)
T KOG0025|consen   84 EGVGEVVAVGSNVK---------GFKPGDWVIPLSANLGTWRTEAVFSESDLIKVD  130 (354)
T ss_pred             cceEEEEEecCCcC---------ccCCCCeEeecCCCCccceeeEeecccceEEcC
Confidence            46899999999765         499999999765 3354   3344555444443


No 15 
>COG4384 Mu-like prophage protein gp45 [Function unknown]
Probab=86.39  E-value=2.7  Score=31.03  Aligned_cols=50  Identities=22%  Similarity=0.369  Sum_probs=35.1

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCC-------ceEEEECCEEEEEEecCcE
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG-------GTKIEVEGQELHLFKEADL   83 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~-------g~ev~~dg~~y~ii~~~DI   83 (91)
                      ...|.||++=      ++.+.|+-++.||+|+|..++       |..|.++-+.|.+....++
T Consensus        78 rShgviv~~~------~~syR~~GL~aGeT~iY~~eG~~i~Lteg~~Ie~~ck~~~v~a~~~v  134 (203)
T COG4384          78 RSHGVIVVSQ------HGSYRITGLKAGETVIYNHEGAKIVLTEGGIIEADCKTLTVNAATGV  134 (203)
T ss_pred             cceeEEEEec------CCccccccccCCceEEEeccCcEEEEccCcEEEEeccEEEEecCCce
Confidence            4455555554      566688899999999999876       4556677777776555443


No 16 
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent. Members of this family represent a distinct clade within the larger family of zinc-dependent dehydrogenases of medium chain alcohols, a family that also includes the so-called glutathione-dependent formaldehyde dehydrogenase. Members of this protein family have a tightly bound NAD that can act as a true cofactor, rather than a cosubstrate in dehydrogenase reactions, in dismutase reactions for some aldehydes. The name given to this family, however, is formaldehyde dehydrogenase, glutathione-independent.
Probab=86.20  E-value=0.86  Score=35.52  Aligned_cols=25  Identities=24%  Similarity=0.434  Sum_probs=21.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|.+.
T Consensus        68 E~~G~V~~vG~~V~---------~~~vGdrV~~~   92 (393)
T TIGR02819        68 EITGEVIEKGRDVE---------FIKIGDIVSVP   92 (393)
T ss_pred             eeEEEEEEEcCccc---------cccCCCEEEEe
Confidence            36999999999875         59999999875


No 17 
>PF06890 Phage_Mu_Gp45:  Bacteriophage Mu Gp45 protein;  InterPro: IPR014462 This entry is represented by the Bacteriophage Mu, Gp45. The characteristics of the protein distribution suggest prophage matches.
Probab=84.41  E-value=6.7  Score=27.88  Aligned_cols=40  Identities=23%  Similarity=0.265  Sum_probs=26.5

Q ss_pred             eEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCC
Q psy12488         17 GVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG   64 (91)
Q Consensus        17 GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~   64 (91)
                      +|+||-.  -+...+.|+|+..++      +.|-.+++|+.++|.+.+
T Consensus        48 ~vvl~lG--G~rs~~Vvia~~d~~------yR~~~L~~GEvalY~~~G   87 (162)
T PF06890_consen   48 AVVLFLG--GDRSHGVVIAVEDRR------YRPKGLKPGEVALYDDEG   87 (162)
T ss_pred             EEEEEec--cCCcceEEEEeCCcc------ccccCCCCCcEEEEcCCC
Confidence            3555533  234567777776544      455679999999999765


No 18 
>cd08230 glucose_DH Glucose dehydrogenase. Glucose dehydrogenase (GlcDH), a member of the medium chain dehydrogenase/zinc-dependent alcohol dehydrogenase-like family, catalyzes the NADP(+)-dependent oxidation of glucose to gluconate, the first step in the Entner-Doudoroff pathway, an alternative to or substitute for glycolysis or the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossman fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology  to GroES.  The MDR group contai
Probab=83.10  E-value=1.2  Score=33.50  Aligned_cols=24  Identities=33%  Similarity=0.358  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++ .         .+++||+|+..
T Consensus        64 e~~G~V~~vG~~-~---------~~~vGdrV~~~   87 (355)
T cd08230          64 EALGVVEEVGDG-S---------GLSPGDLVVPT   87 (355)
T ss_pred             ccceEEEEecCC-C---------CCCCCCEEEec
Confidence            357999999997 4         58999999864


No 19 
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=83.08  E-value=1.2  Score=35.11  Aligned_cols=25  Identities=36%  Similarity=0.432  Sum_probs=21.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|++||++..         .+|+||+|-..
T Consensus        64 EivG~V~~vG~~V~---------~~k~GDrVgV~   88 (339)
T COG1064          64 EIVGTVVEVGEGVT---------GLKVGDRVGVG   88 (339)
T ss_pred             ceEEEEEEecCCCc---------cCCCCCEEEec
Confidence            57899999999886         59999999983


No 20 
>KOG0022|consensus
Probab=81.90  E-value=1.4  Score=35.24  Aligned_cols=23  Identities=35%  Similarity=0.583  Sum_probs=20.5

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEE
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVL   59 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vl   59 (91)
                      ...|.|.+||+|..         .|++||+|+
T Consensus        68 EaaGIVESvGegV~---------~vk~GD~Vi   90 (375)
T KOG0022|consen   68 EAAGIVESVGEGVT---------TVKPGDHVI   90 (375)
T ss_pred             cceeEEEEecCCcc---------ccCCCCEEe
Confidence            35899999999986         699999998


No 21 
>PLN02586 probable cinnamyl alcohol dehydrogenase
Probab=80.59  E-value=1.9  Score=32.88  Aligned_cols=24  Identities=21%  Similarity=0.318  Sum_probs=20.0

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|++
T Consensus        73 E~~G~V~~vG~~v~---------~~~vGdrV~~   96 (360)
T PLN02586         73 EIVGIVTKLGKNVK---------KFKEGDRVGV   96 (360)
T ss_pred             ceeEEEEEECCCCC---------ccCCCCEEEE
Confidence            36899999999764         5899999984


No 22 
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. This group contains members identified as zinc dependent alcohol dehydrogenases (ADH), and class III ADG (aka formaldehyde dehydrogenase, FDH). Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  Class III ADH are also know as glutathione-dependent formaldehyde dehyd
Probab=78.33  E-value=2.2  Score=32.38  Aligned_cols=24  Identities=46%  Similarity=0.674  Sum_probs=20.0

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        68 E~~G~V~~vG~~v~---------~~~~GdrV~~   91 (371)
T cd08281          68 EAAGVVVEVGEGVT---------DLEVGDHVVL   91 (371)
T ss_pred             cceeEEEEeCCCCC---------cCCCCCEEEE
Confidence            36799999998764         4899999986


No 23 
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional
Probab=78.03  E-value=2.5  Score=31.49  Aligned_cols=25  Identities=32%  Similarity=0.323  Sum_probs=20.5

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        60 e~~G~V~~vG~~v~---------~~~vGd~V~~~   84 (347)
T PRK10309         60 EFSGYVEAVGSGVD---------DLHPGDAVACV   84 (347)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEEC
Confidence            46899999998764         58999999864


No 24 
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). The gene neighborhood of members of this family is not conserved and it appears that no members are characterized. The sequence of the family includes 6 invariant cysteine residues and one invariant histidine. It appears that no member is characterized.
Probab=77.72  E-value=2.4  Score=31.84  Aligned_cols=25  Identities=28%  Similarity=0.251  Sum_probs=20.7

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|++.
T Consensus        63 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   87 (329)
T TIGR02822        63 EVVGEVAGRGADAG---------GFAVGDRVGIA   87 (329)
T ss_pred             ceEEEEEEECCCCc---------ccCCCCEEEEc
Confidence            46899999999864         58999999853


No 25 
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase.
Probab=77.56  E-value=2.8  Score=31.10  Aligned_cols=47  Identities=19%  Similarity=0.287  Sum_probs=29.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCc-eEE-EECC--EEEEEEecCcEE
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGG-TKI-EVEG--QELHLFKEADLL   84 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g-~ev-~~dg--~~y~ii~~~DIl   84 (91)
                      ...|+|+++|++.          .+++||+|+...... ... ..+|  .+|+++.++.++
T Consensus        65 E~~G~V~~vG~~v----------~~~vGdrV~~~~~~c~~~~~~~~G~~aey~~v~~~~~~  115 (308)
T TIGR01202        65 ESVGRVVEAGPDT----------GFRPGDRVFVPGSNCYEDVRGLFGGASKRLVTPASRVC  115 (308)
T ss_pred             eeEEEEEEecCCC----------CCCCCCEEEEeCccccccccccCCcccceEEcCHHHce
Confidence            3689999999863          379999999632100 000 0122  588888776543


No 26 
>PLN02178 cinnamyl-alcohol dehydrogenase
Probab=77.42  E-value=2.7  Score=32.43  Aligned_cols=24  Identities=21%  Similarity=0.254  Sum_probs=20.1

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|.+
T Consensus        67 E~aG~Vv~vG~~v~---------~~~vGdrV~~   90 (375)
T PLN02178         67 EIVGIATKVGKNVT---------KFKEGDRVGV   90 (375)
T ss_pred             eeeEEEEEECCCCC---------ccCCCCEEEE
Confidence            46899999999764         5899999985


No 27 
>PF02559 CarD_CdnL_TRCF:  CarD-like/TRCF domain;  InterPro: IPR003711 The bacterium Myxococcus xanthus responds to blue light by producing carotenoids. It also responds to starvation conditions by developing fruiting bodies, where the cells differentiate into myxospores. Each response entails the transcriptional activation of a separate set of genes. A single gene, carD, is required for the activation of both light- and starvation-inducible genes []. The predicted protein contains four repeats of a DNA-binding domain present in mammalian high mobility group I(Y) proteins and other nuclear proteins from animals and plants. Other peptide stretches on CarD also resemble functional domains typical of eukaryotic transcription factors, including a very acidic region and a leucine zipper. High mobility group yI(Y) proteins are known to bind the minor groove of A+T-rich DNA [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 3MLQ_H 2EYQ_A.
Probab=77.35  E-value=4  Score=25.74  Aligned_cols=30  Identities=37%  Similarity=0.562  Sum_probs=20.0

Q ss_pred             ccCCCEEEcCCCCce------EEEECC--EEEEEEecC
Q psy12488         52 VNVGDKVLLPKFGGT------KIEVEG--QELHLFKEA   81 (91)
Q Consensus        52 VkvGD~Vlf~~y~g~------ev~~dg--~~y~ii~~~   81 (91)
                      +++||.|+++.++-.      +.++.|  .+|+++...
T Consensus         2 f~~GD~VVh~~~Gv~~i~~i~~~~~~~~~~~yy~L~~~   39 (98)
T PF02559_consen    2 FKIGDYVVHPNHGVGRIEGIEEIEFGGEKQEYYVLEYA   39 (98)
T ss_dssp             --TTSEEEETTTEEEEEEEEEEEECTTEEEEEEEEEEC
T ss_pred             CCCCCEEEECCCceEEEEEEEEEeeCCeeEEEEEEEEC
Confidence            589999999999842      344555  578777643


No 28 
>COG1329 Transcriptional regulators, similar to M. xanthus CarD [Transcription]
Probab=77.15  E-value=4  Score=29.38  Aligned_cols=38  Identities=26%  Similarity=0.529  Sum_probs=25.8

Q ss_pred             CcccCCCEEEcCCCCceEE------EECC--EEEEEEe--cCcEEEEe
Q psy12488         50 PVVNVGDKVLLPKFGGTKI------EVEG--QELHLFK--EADLLAVI   87 (91)
Q Consensus        50 ~~VkvGD~Vlf~~y~g~ev------~~dg--~~y~ii~--~~DIlavi   87 (91)
                      +..++||+|+||.++.-.|      ++.|  .+|++|.  .+|....+
T Consensus         3 ~~Fk~Gd~VVYP~HGvG~I~~Ieeke~~Ge~~~yyVI~f~~~dm~v~V   50 (166)
T COG1329           3 MAFKIGDHVVYPAHGVGIIQAIEEKEIAGETLEYYVIDFPQSDMTVMV   50 (166)
T ss_pred             ccccCCCEEEecCCCceeeehhhhHhhcCceeEEEEEEEcCCCcEEEe
Confidence            5789999999999985333      2444  5777764  45555544


No 29 
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates.  For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the
Probab=76.94  E-value=2.5  Score=31.96  Aligned_cols=24  Identities=33%  Similarity=0.483  Sum_probs=20.1

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ..|+|+++|++..         .+++||+|+..
T Consensus        64 ~~G~V~~vG~~v~---------~~~~GdrV~~~   87 (369)
T cd08301          64 AAGIVESVGEGVT---------DLKPGDHVLPV   87 (369)
T ss_pred             cceEEEEeCCCCC---------ccccCCEEEEc
Confidence            5799999999764         58999999863


No 30 
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase. NAD-linked ribitol-5-phosphate dehydrogenase, a member of the MDR/zinc-dependent alcohol dehydrogenase-like family, oxidizes the phosphate ester of ribitol-5-phosphate to xylulose-5-phosphate of the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (
Probab=76.53  E-value=7  Score=29.40  Aligned_cols=45  Identities=24%  Similarity=0.280  Sum_probs=29.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCc-----------------eEEEECC--EEEEEEecCcE
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGG-----------------TKIEVEG--QELHLFKEADL   83 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g-----------------~ev~~dg--~~y~ii~~~DI   83 (91)
                      ...|+|+++|.+           .+++||+|.+.....                 .-..++|  -+|++++++.+
T Consensus        65 E~~G~V~~~g~~-----------~~~vGdrV~~~~~~~~~~~~~~~~~~c~~~~~~g~~~~G~~aey~~v~~~~~  128 (341)
T cd08237          65 EGIGVVVSDPTG-----------TYKVGTKVVMVPNTPVEKDEIIPENYLPSSRFRSSGYDGFMQDYVFLPPDRL  128 (341)
T ss_pred             eeEEEEEeeCCC-----------ccCCCCEEEECCCCCchhcccchhccCCCcceeEecCCCceEEEEEEchHHe
Confidence            478999998752           389999998754211                 0012345  68998887654


No 31 
>PLN02827 Alcohol dehydrogenase-like
Probab=75.86  E-value=2.6  Score=32.40  Aligned_cols=24  Identities=29%  Similarity=0.502  Sum_probs=20.4

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ..|+|+++|++..         .+++||+|+..
T Consensus        71 ~~G~V~~vG~~v~---------~~~~GdrV~~~   94 (378)
T PLN02827         71 ASGIVESIGEGVT---------EFEKGDHVLTV   94 (378)
T ss_pred             ceEEEEEcCCCCc---------ccCCCCEEEEe
Confidence            5799999999764         58999999864


No 32 
>cd08293 PTGR2 Prostaglandin reductase. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acid
Probab=75.84  E-value=3.2  Score=30.62  Aligned_cols=25  Identities=24%  Similarity=0.085  Sum_probs=20.6

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|++-
T Consensus        75 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   99 (345)
T cd08293          75 DGGGVGVVEESKHQ---------KFAVGDIVTSF   99 (345)
T ss_pred             EeeEEEEEeccCCC---------CCCCCCEEEec
Confidence            47799999998763         58999999863


No 33 
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent i
Probab=75.56  E-value=7.2  Score=27.98  Aligned_cols=26  Identities=42%  Similarity=0.529  Sum_probs=20.7

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|+|+++|++..         ..++||+|+.-.
T Consensus        58 e~~G~V~~vG~~v~---------~~~~Gd~V~~~~   83 (312)
T cd08269          58 EGWGRVVALGPGVR---------GLAVGDRVAGLS   83 (312)
T ss_pred             eeEEEEEEECCCCc---------CCCCCCEEEEec
Confidence            35799999998754         478999999744


No 34 
>KOG0024|consensus
Probab=75.28  E-value=1.2  Score=35.42  Aligned_cols=26  Identities=27%  Similarity=0.491  Sum_probs=22.7

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|.|..||++..         .+|+||+|...+
T Consensus        68 EssGiV~evG~~Vk---------~LkVGDrVaiEp   93 (354)
T KOG0024|consen   68 ESSGIVEEVGDEVK---------HLKVGDRVAIEP   93 (354)
T ss_pred             ccccchhhhccccc---------ccccCCeEEecC
Confidence            46899999999987         699999999854


No 35 
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like. MDR/AHD-like proteins, including a protein annotated as a threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones.  Zinc-dependent ADHs are medium chain dehydrogenase/reductase type proteins (MDRs) and have a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. In addition to alcohol dehydrogenases, this group includes quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others.  These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc at
Probab=75.22  E-value=3.2  Score=30.72  Aligned_cols=26  Identities=46%  Similarity=0.710  Sum_probs=21.0

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|+|+++|++..         .+++||+|+...
T Consensus        61 e~~G~V~~vG~~v~---------~~~~Gd~V~~~~   86 (339)
T cd08239          61 EPAGVVVAVGPGVT---------HFRVGDRVMVYH   86 (339)
T ss_pred             CceEEEEEECCCCc---------cCCCCCEEEECC
Confidence            35799999999764         589999998643


No 36 
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase. The members of this protein family show dual function. First, they remove formaldehyde, a toxic metabolite, by acting as S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284). S-(hydroxymethyl)glutathione can form spontaneously from formaldehyde and glutathione, and so this enzyme previously was designated glutathione-dependent formaldehyde dehydrogenase. These same proteins are also designated alcohol dehydrogenase (EC 1.1.1.1) of class III, for activities that do not require glutathione; they tend to show poor activity for ethanol among their various substrate alcohols.
Probab=75.09  E-value=3.2  Score=31.62  Aligned_cols=25  Identities=40%  Similarity=0.558  Sum_probs=20.7

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|...
T Consensus        62 E~~G~V~~vG~~v~---------~~~~GdrV~~~   86 (368)
T TIGR02818        62 EGAGIVEAVGEGVT---------SVKVGDHVIPL   86 (368)
T ss_pred             ccEEEEEEECCCCc---------cCCCCCEEEEc
Confidence            36799999999764         58999999864


No 37 
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase. L-sorbose-1-phosphate reductase, a member of the MDR family, catalyzes the NADPH-dependent conversion of l-sorbose 1-phosphate to d-glucitol 6-phosphate in the metabolism of L-sorbose to  (also converts d-fructose 1-phosphate to d-mannitol 6-phosphate).  The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the found
Probab=74.65  E-value=3.5  Score=31.95  Aligned_cols=25  Identities=12%  Similarity=0.236  Sum_probs=20.2

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ..|+|+++|++...        .+++||+|+..
T Consensus        70 ~~G~V~~vG~~v~~--------~~~vGdrV~~~   94 (410)
T cd08238          70 FAGTILKVGKKWQG--------KYKPGQRFVIQ   94 (410)
T ss_pred             cEEEEEEeCCCccC--------CCCCCCEEEEc
Confidence            58999999997631        38999999875


No 38 
>PLN02740 Alcohol dehydrogenase-like
Probab=74.33  E-value=3.2  Score=31.71  Aligned_cols=25  Identities=28%  Similarity=0.445  Sum_probs=20.4

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        72 E~~G~V~~vG~~v~---------~~~vGdrV~~~   96 (381)
T PLN02740         72 EAAGIVESVGEGVE---------DLKAGDHVIPI   96 (381)
T ss_pred             cceEEEEEeCCCCC---------cCCCCCEEEec
Confidence            35799999998764         58999999864


No 39 
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dim
Probab=73.83  E-value=3.8  Score=31.03  Aligned_cols=25  Identities=32%  Similarity=0.472  Sum_probs=20.5

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        63 E~~G~V~~vG~~v~---------~~~vGdrV~~~   87 (368)
T cd08300          63 EGAGIVESVGEGVT---------SVKPGDHVIPL   87 (368)
T ss_pred             ceeEEEEEeCCCCc---------cCCCCCEEEEc
Confidence            36899999999764         58999999864


No 40 
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=73.34  E-value=4  Score=30.74  Aligned_cols=24  Identities=46%  Similarity=0.530  Sum_probs=20.1

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|..
T Consensus        61 e~~G~V~~vG~~v~---------~~~~GdrV~~   84 (358)
T TIGR03451        61 EAAGVVEAVGEGVT---------DVAPGDYVVL   84 (358)
T ss_pred             ceEEEEEEeCCCCc---------ccCCCCEEEE
Confidence            36899999999764         5899999986


No 41 
>PRK10083 putative oxidoreductase; Provisional
Probab=73.19  E-value=4.3  Score=29.90  Aligned_cols=24  Identities=29%  Similarity=0.488  Sum_probs=19.9

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ..|+|+++|++..         .+++||+|+..
T Consensus        61 ~~G~V~~vG~~v~---------~~~~Gd~V~~~   84 (339)
T PRK10083         61 FFGVIDAVGEGVD---------AARIGERVAVD   84 (339)
T ss_pred             eEEEEEEECCCCc---------cCCCCCEEEEc
Confidence            5799999998753         58999999854


No 42 
>PLN02514 cinnamyl-alcohol dehydrogenase
Probab=72.86  E-value=3.8  Score=31.03  Aligned_cols=24  Identities=33%  Similarity=0.304  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|++
T Consensus        70 E~~G~Vv~vG~~v~---------~~~~Gd~V~~   93 (357)
T PLN02514         70 EVVGEVVEVGSDVS---------KFTVGDIVGV   93 (357)
T ss_pred             eeeEEEEEECCCcc---------cccCCCEEEE
Confidence            46799999999764         5899999985


No 43 
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates.  For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ i
Probab=71.83  E-value=4.4  Score=30.69  Aligned_cols=25  Identities=32%  Similarity=0.469  Sum_probs=20.4

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        62 e~~G~V~~vG~~v~---------~~~~GdrV~~~   86 (365)
T cd08277          62 EGAGIVESVGEGVT---------NLKPGDKVIPL   86 (365)
T ss_pred             ceeEEEEeeCCCCc---------cCCCCCEEEEC
Confidence            36899999998764         48899999864


No 44 
>PF01079 Hint:  Hint module;  InterPro: IPR001767 This domain identifies a group of cysteine peptidases correspond to MEROPS peptidase family C46 (clan CH). The type example is the Hedgehog protein from Drosophila melanogaster (Fruit fly). These are involved in intracellular signalling required for a variety of patterning events during development. The hedgehog family of proteins self process by a cysteine-dependent mechanism, which is a one-time autolytic cleavage. It is differentiated from a typical peptidase reaction by the fact that the newly-formed carboxyl group is esterified with cholesterol, rather than being left free. The three-dimensional structure of the autolytic domain of the hedgehog protein of D. melanogaster shows that it is formed from two divergent copies of a module that also occurs in inteins, called a Hint domain [,].; GO: 0008233 peptidase activity, 0006508 proteolysis; PDB: 3K7H_B 3K7I_B 3K7G_B 1AT0_A 3MXW_A 3M1N_B 3HO5_H 2WFR_A 2WFQ_A 2WG3_B ....
Probab=71.45  E-value=8.6  Score=28.35  Aligned_cols=25  Identities=24%  Similarity=0.375  Sum_probs=15.4

Q ss_pred             eCCCCeEecC-cccCCCEEEcCCCCc
Q psy12488         41 RTPNGEYIKP-VVNVGDKVLLPKFGG   65 (91)
Q Consensus        41 ~~~~G~~~p~-~VkvGD~Vlf~~y~g   65 (91)
                      .+.+|..++| ++++||+|+--+-.|
T Consensus        20 ~~~~G~~k~m~~L~iGD~Vla~d~~G   45 (217)
T PF01079_consen   20 TLEDGGRKRMSDLKIGDRVLAVDSDG   45 (217)
T ss_dssp             EBTTS-EEEGGG--TT-EEEEE-TTS
T ss_pred             EeCCCCEeEHHHCCCCCEEEEecCCC
Confidence            3468877788 999999999988444


No 45 
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.
Probab=70.59  E-value=4.6  Score=30.06  Aligned_cols=24  Identities=42%  Similarity=0.632  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        71 e~~G~V~~vG~~v~---------~~~~Gd~V~~   94 (351)
T cd08233          71 EFSGVVVEVGSGVT---------GFKVGDRVVV   94 (351)
T ss_pred             cceEEEEEeCCCCC---------CCCCCCEEEE
Confidence            36799999998654         5899999986


No 46 
>TIGR00692 tdh L-threonine 3-dehydrogenase. E. coli His-90 modulates substrate specificity and is believed part of the active site.
Probab=70.37  E-value=5.3  Score=29.61  Aligned_cols=25  Identities=36%  Similarity=0.557  Sum_probs=20.4

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        62 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   86 (340)
T TIGR00692        62 EVAGEVVGIGPGVE---------GIKVGDYVSVE   86 (340)
T ss_pred             ceEEEEEEECCCCC---------cCCCCCEEEEC
Confidence            36899999998753         58999999874


No 47 
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenases of the medium chain dehydrogenase family. However, this subgroup does not contain the characteristic catalytic zinc site. Also, it contains an atypical structural zinc-binding pattern: DxxCxxCxxxxxxxC. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the clo
Probab=69.54  E-value=5.8  Score=28.92  Aligned_cols=25  Identities=32%  Similarity=0.373  Sum_probs=20.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        61 e~~G~v~~vG~~v~---------~~~~Gd~V~~~   85 (325)
T cd08264          61 EFAGVVEEVGDHVK---------GVKKGDRVVVY   85 (325)
T ss_pred             ceeEEEEEECCCCC---------CCCCCCEEEEC
Confidence            36799999998764         58999999854


No 48 
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordina
Probab=69.35  E-value=6  Score=28.64  Aligned_cols=26  Identities=35%  Similarity=0.486  Sum_probs=20.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|+|+++|++..         .+++||+|+...
T Consensus        65 e~~G~V~~~G~~v~---------~~~~Gd~V~~~~   90 (324)
T cd08292          65 EAVGVVDAVGEGVK---------GLQVGQRVAVAP   90 (324)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEecc
Confidence            46899999998653         489999998753


No 49 
>cd05278 FDH_like Formaldehyde dehydrogenases. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  Formaldehyde dehydrogenase (aka ADH3) may be the ancestral form of alcohol dehydrogenase, which evolved to detoxify formaldehyde.  This CD contains glutathione dependant FDH, glutathione independent FDH, and related alcohol dehydrogenases. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typicall
Probab=68.98  E-value=6.1  Score=29.04  Aligned_cols=24  Identities=29%  Similarity=0.382  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        61 e~~G~V~~vG~~v~---------~~~~Gd~V~~   84 (347)
T cd05278          61 EFVGEVVEVGSDVK---------RLKPGDRVSV   84 (347)
T ss_pred             ceEEEEEEECCCcc---------ccCCCCEEEe
Confidence            36899999998754         4899999996


No 50 
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). While some current members of this family carry designations as putative alginate lyase, it seems no sequence with a direct characterization as such is detected by this model.
Probab=68.57  E-value=6.3  Score=28.83  Aligned_cols=25  Identities=36%  Similarity=0.460  Sum_probs=20.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+.-
T Consensus        65 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   89 (336)
T TIGR02817        65 DAAGVVVAVGDEVT---------LFKPGDEVWYA   89 (336)
T ss_pred             eeEEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            46899999998753         58899999863


No 51 
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordin
Probab=67.96  E-value=6.7  Score=28.85  Aligned_cols=26  Identities=27%  Similarity=0.371  Sum_probs=20.2

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++...        .+++||+|+..
T Consensus        67 e~~G~V~~vG~~v~~--------~~~vGd~V~~~   92 (324)
T cd08291          67 EGSGTVVAAGGGPLA--------QSLIGKRVAFL   92 (324)
T ss_pred             ceEEEEEEECCCccc--------cCCCCCEEEec
Confidence            468999999987631        27899999863


No 52 
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like. This group contains proteins identified as alcohol dehydrogenases and glutathione-dependant formaldehyde dehydrogenases (FDH) of the zinc-dependent/medium chain alcohol dehydrogenase family.  The MDR family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones.  FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=67.74  E-value=6.4  Score=29.05  Aligned_cols=24  Identities=33%  Similarity=0.309  Sum_probs=19.5

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|.|+++|++..         .+++||+|+.
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~   83 (345)
T cd08287          60 EFVGVVEEVGSEVT---------SVKPGDFVIA   83 (345)
T ss_pred             ceEEEEEEeCCCCC---------ccCCCCEEEe
Confidence            35799999998653         5899999985


No 53 
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions  near  the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates.  Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononu
Probab=66.76  E-value=6.3  Score=29.84  Aligned_cols=24  Identities=38%  Similarity=0.493  Sum_probs=19.6

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        62 e~~G~V~~vG~~v~---------~~~~Gd~V~~   85 (365)
T cd08278          62 EGAGVVEAVGSAVT---------GLKPGDHVVL   85 (365)
T ss_pred             ceeEEEEEeCCCcc---------cCCCCCEEEE
Confidence            46899999998653         5899999983


No 54 
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase. Putative L-iditol 2-dehydrogenase based on annotation of some members in this subgroup.  L-iditol 2-dehydrogenase catalyzes the NAD+-dependent conversion of L-iditol to L-sorbose in fructose and mannose metabolism. This enzyme is related to sorbitol dehydrogenase, alcohol dehydrogenase, and other medium chain dehydrogenase/reductases. The zinc-dependent alcohol dehydrogenase (ADH-Zn)-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH.  This group is also called the medium chain dehydrogenases/reductase family (MDR) to highlight its broad range of activities and to distinguish from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain.  The MDR group contains a host of activities, i
Probab=66.62  E-value=7.1  Score=28.71  Aligned_cols=24  Identities=33%  Similarity=0.530  Sum_probs=19.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         ..++||+|+.
T Consensus        60 ~~~G~V~~~G~~v~---------~~~~Gd~V~~   83 (343)
T cd08235          60 EIAGEIVEVGDGVT---------GFKVGDRVFV   83 (343)
T ss_pred             ceEEEEEeeCCCCC---------CCCCCCEEEE
Confidence            46899999998753         5899999995


No 55 
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family. The medium chain reductase/dehydrogenases (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH) , quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydro
Probab=66.19  E-value=7.1  Score=27.04  Aligned_cols=26  Identities=46%  Similarity=0.710  Sum_probs=20.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|+|+++|+...         .+++||+|+...
T Consensus        36 e~~G~v~~~G~~v~---------~~~~Gd~V~~~~   61 (271)
T cd05188          36 EGAGVVVEVGPGVT---------GVKVGDRVVVLP   61 (271)
T ss_pred             ccEEEEEEECCCCC---------cCCCCCEEEEcC
Confidence            46799999998543         589999999754


No 56 
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases. This group contains proteins identified as sorbitol dehydrogenases and other sugar dehydrogenases of the medium-chain dehydrogenase/reductase family (MDR), which includes zinc-dependent alcohol dehydrogenase and related proteins. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Related proteins include threonine dehydrogenase, formaldehyde dehydrogenase, and butanediol dehydrogenase. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast
Probab=65.54  E-value=7.8  Score=28.55  Aligned_cols=25  Identities=32%  Similarity=0.452  Sum_probs=20.4

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        59 ~~~G~V~~~g~~v~---------~~~~Gd~V~~~   83 (343)
T cd08236          59 EFSGTVEEVGSGVD---------DLAVGDRVAVN   83 (343)
T ss_pred             ceEEEEEEECCCCC---------cCCCCCEEEEc
Confidence            46899999998653         58999999864


No 57 
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group has the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (ty
Probab=65.46  E-value=7.7  Score=28.66  Aligned_cols=24  Identities=38%  Similarity=0.444  Sum_probs=19.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|.|+++|++..         .+++||+|+.
T Consensus        61 e~~G~V~~~G~~~~---------~~~~Gd~V~~   84 (345)
T cd08260          61 EFAGVVVEVGEDVS---------RWRVGDRVTV   84 (345)
T ss_pred             ceeEEEEEECCCCc---------cCCCCCEEEE
Confidence            36799999998653         5899999986


No 58 
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase,
Probab=65.24  E-value=7.5  Score=28.62  Aligned_cols=24  Identities=38%  Similarity=0.566  Sum_probs=19.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        60 e~~G~V~~~G~~v~---------~~~~Gd~V~~   83 (337)
T cd08261          60 ELSGEVVEVGEGVA---------GLKVGDRVVV   83 (337)
T ss_pred             ccEEEEEEeCCCCC---------CCCCCCEEEE
Confidence            46799999998653         4899999996


No 59 
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent i
Probab=65.11  E-value=7.8  Score=28.51  Aligned_cols=25  Identities=32%  Similarity=0.401  Sum_probs=20.1

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCc-ccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPV-VNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~-VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         . +++||+|+.-
T Consensus        70 e~~G~V~~vG~~v~---------~~~~~Gd~V~~~   95 (341)
T cd08262          70 EFCGEVVDYGPGTE---------RKLKVGTRVTSL   95 (341)
T ss_pred             ceeEEEEEeCCCCc---------CCCCCCCEEEec
Confidence            35799999998653         3 8899999965


No 60 
>cd05284 arabinose_DH_like D-arabinose dehydrogenase. This group contains arabinose dehydrogenase (AraDH) and related alcohol dehydrogenases. AraDH is a member of the medium chain dehydrogenase/reductase family and catalyzes the NAD(P)-dependent oxidation of D-arabinose and other pentoses, the initial step in the metabolism of d-arabinose into 2-oxoglutarate. Like the alcohol dehydrogenases, AraDH binds a zinc in the catalytic cleft as well as a distal structural zinc. AraDH forms homotetramers as a dimer of dimers. AraDH replaces a conserved catalytic His with replace with Arg, compared to the canonical ADH site. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol d
Probab=65.06  E-value=7.8  Score=28.43  Aligned_cols=24  Identities=33%  Similarity=0.469  Sum_probs=19.4

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ..|+|+++|++..         .+++||+|+.-
T Consensus        65 ~~G~V~~vG~~v~---------~~~~Gd~V~~~   88 (340)
T cd05284          65 NAGWVEEVGSGVD---------GLKEGDPVVVH   88 (340)
T ss_pred             eeEEEEEeCCCCC---------cCcCCCEEEEc
Confidence            5799999998653         58999999853


No 61 
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members. This subgroup of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family has members identified as 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase and alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MD
Probab=64.91  E-value=12  Score=26.69  Aligned_cols=26  Identities=31%  Similarity=0.349  Sum_probs=20.8

Q ss_pred             cceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         27 EVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        27 k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      -...|.|+++|++..         ..++||+|+..
T Consensus        26 ~e~~G~V~~vG~~v~---------~~~~Gd~V~~~   51 (277)
T cd08255          26 YSSVGRVVEVGSGVT---------GFKPGDRVFCF   51 (277)
T ss_pred             cceeEEEEEeCCCCC---------CCCCCCEEEec
Confidence            357899999998653         47899999875


No 62 
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. This group is predominated by atypical alcohol dehydrogenases; they exist as tetramers and exhibit specificity for NADP(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones.  Like other zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric ADHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains; however, they do not have and a structural zinc in a lobe of the catalytic domain.  The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=64.69  E-value=7.2  Score=29.03  Aligned_cols=25  Identities=32%  Similarity=0.523  Sum_probs=20.5

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   84 (351)
T cd08285          60 EAVGVVEEVGSEVK---------DFKPGDRVIVP   84 (351)
T ss_pred             ceEEEEEEecCCcC---------ccCCCCEEEEc
Confidence            46899999998753         58999999964


No 63 
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like. This group is related to formaldehyde dehydrogenase (FDH), which  is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  This family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Another member is identified as a dihydroxyacetone reductase. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (
Probab=64.49  E-value=7.7  Score=28.67  Aligned_cols=24  Identities=38%  Similarity=0.571  Sum_probs=19.7

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ..|+|+++|++..         ..++||+|+..
T Consensus        62 ~~G~V~~~G~~v~---------~~~~Gd~V~~~   85 (345)
T cd08286          62 GVGVVEEVGSAVT---------NFKVGDRVLIS   85 (345)
T ss_pred             ceEEEEEeccCcc---------ccCCCCEEEEC
Confidence            5899999998753         48999999863


No 64 
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2. Glutathione-dependent formaldehyde dehydrogenases (FDHs) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.   These tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typical
Probab=64.02  E-value=8.5  Score=28.30  Aligned_cols=24  Identities=42%  Similarity=0.596  Sum_probs=19.7

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|.|+++|++..         ..++||+|+.
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~   83 (344)
T cd08284          60 EFVGEVVEVGPEVR---------TLKVGDRVVS   83 (344)
T ss_pred             ceEEEEEeeCCCcc---------ccCCCCEEEE
Confidence            35799999998753         5899999986


No 65 
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion of L-lodonate to 5-ketogluconate in the metabolism of L-Idonate to  6-P-gluconate. In E. coli, this GntII pathway is a subsidiary pathway to the canonical GntI system, which also phosphorylates and transports gluconate.  L-ido 5-DH is found in an operon with a regulator indR, transporter idnT, 5-keto-D-gluconate 5-reductase, and Gnt kinase. L-ido 5-DH is a zinc-dependent alcohol dehydrogenase-like protein. The alcohol dehydrogenase ADH-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH.  This group is also called the medium chain dehydrogenases/reductase family (MDR) which displays a broad range of activities and are distinguished from the smaller short chain dehydrogenases(~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domai
Probab=63.30  E-value=8  Score=28.44  Aligned_cols=23  Identities=39%  Similarity=0.598  Sum_probs=19.3

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ..|+|+++|++..         ..++||+|+.
T Consensus        61 ~~G~v~~vG~~v~---------~~~~Gd~V~~   83 (339)
T cd08232          61 VSGVVEAVGPGVT---------GLAPGQRVAV   83 (339)
T ss_pred             ceEEEEeeCCCCC---------cCCCCCEEEE
Confidence            5799999998653         5899999986


No 66 
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. T
Probab=63.18  E-value=8.4  Score=29.48  Aligned_cols=25  Identities=44%  Similarity=0.696  Sum_probs=20.2

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        61 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   85 (386)
T cd08283          61 EFMGVVEEVGPEVR---------NLKVGDRVVVP   85 (386)
T ss_pred             cceEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            46899999998653         58999999864


No 67 
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family. This group shares the zinc coordination sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous
Probab=62.84  E-value=9.5  Score=28.06  Aligned_cols=25  Identities=32%  Similarity=0.481  Sum_probs=20.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        62 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   86 (306)
T cd08258          62 EFSGTIVEVGPDVE---------GWKVGDRVVSE   86 (306)
T ss_pred             ceEEEEEEECCCcC---------cCCCCCEEEEc
Confidence            36799999998654         58999999874


No 68 
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall 
Probab=62.57  E-value=9.2  Score=28.92  Aligned_cols=25  Identities=32%  Similarity=0.602  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~Vv~~   84 (365)
T cd05279          60 EGAGIVESIGPGVT---------TLKPGDKVIPL   84 (365)
T ss_pred             ceeEEEEEeCCCcc---------cCCCCCEEEEc
Confidence            36799999998653         57899999864


No 69 
>PLN02702 L-idonate 5-dehydrogenase
Probab=62.37  E-value=8.5  Score=28.91  Aligned_cols=24  Identities=29%  Similarity=0.479  Sum_probs=19.5

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        80 e~~G~V~~vG~~v~---------~~~~Gd~V~~  103 (364)
T PLN02702         80 ECAGIIEEVGSEVK---------HLVVGDRVAL  103 (364)
T ss_pred             ceeEEEEEECCCCC---------CCCCCCEEEE
Confidence            35799999998653         4789999986


No 70 
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]
Probab=62.05  E-value=9.6  Score=29.29  Aligned_cols=53  Identities=26%  Similarity=0.230  Sum_probs=34.6

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCC----------ce----E--------E---EECC--EEEEEEec
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG----------GT----K--------I---EVEG--QELHLFKE   80 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~----------g~----e--------v---~~dg--~~y~ii~~   80 (91)
                      ...|+|+++| ...         ..++||+|.....-          |.    +        .   -++|  -||+.++.
T Consensus        62 E~~G~V~evG-~~~---------~~~~GdrVvv~~~~~Cg~C~~C~~G~~~~C~~~~~~g~~~~~~~~~G~~aEyv~vp~  131 (350)
T COG1063          62 EFVGEVVEVG-VVR---------GFKVGDRVVVEPNIPCGHCRYCRAGEYNLCENPGFYGYAGLGGGIDGGFAEYVRVPA  131 (350)
T ss_pred             cceEEEEEec-ccc---------CCCCCCEEEECCCcCCCCChhHhCcCcccCCCccccccccccCCCCCceEEEEEecc
Confidence            3689999999 433         58889999887422          11    1        0   0344  68888888


Q ss_pred             CcEEEEeecC
Q psy12488         81 ADLLAVIEKD   90 (91)
Q Consensus        81 ~DIlavi~~~   90 (91)
                      +..+.++.++
T Consensus       132 ~~~~~~~pd~  141 (350)
T COG1063         132 DFNLAKLPDG  141 (350)
T ss_pred             ccCeecCCCC
Confidence            7777766543


No 71 
>PTZ00354 alcohol dehydrogenase; Provisional
Probab=62.02  E-value=9.8  Score=27.49  Aligned_cols=24  Identities=25%  Similarity=0.356  Sum_probs=19.4

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|.|+++|++..         .+++||+|+-
T Consensus        65 e~~G~v~~vG~~v~---------~~~~Gd~V~~   88 (334)
T PTZ00354         65 EVAGYVEDVGSDVK---------RFKEGDRVMA   88 (334)
T ss_pred             eeEEEEEEeCCCCC---------CCCCCCEEEE
Confidence            46899999998653         5789999985


No 72 
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only]
Probab=61.92  E-value=15  Score=24.87  Aligned_cols=31  Identities=26%  Similarity=0.344  Sum_probs=22.8

Q ss_pred             ecCcccCCCEEEcCC-CCceEEEECC-EEEEEE
Q psy12488         48 IKPVVNVGDKVLLPK-FGGTKIEVEG-QELHLF   78 (91)
Q Consensus        48 ~p~~VkvGD~Vlf~~-y~g~ev~~dg-~~y~ii   78 (91)
                      .|..+++||.++|++ +.|+.-..+. .+++++
T Consensus        82 e~v~~~aGD~~~~~~G~~g~W~V~EtvrK~Yv~  114 (116)
T COG3450          82 EPVEVRAGDSFVFPAGFKGTWEVLETVRKHYVI  114 (116)
T ss_pred             eEEEEcCCCEEEECCCCeEEEEEeeeeEEEEEE
Confidence            467999999999998 8887655554 344444


No 73 
>cd08290 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann f
Probab=61.72  E-value=9.9  Score=27.90  Aligned_cols=26  Identities=31%  Similarity=0.424  Sum_probs=20.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|.|+++|++..         ..++||+|+...
T Consensus        70 e~~G~V~~vG~~v~---------~~~~Gd~V~~~~   95 (341)
T cd08290          70 EGVGEVVKVGSGVK---------SLKPGDWVIPLR   95 (341)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEecC
Confidence            46899999998753         589999999654


No 74 
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase. Glutathione-dependent formaldehyde dehydrogenases (FDHs, Class III ADH) are members of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also known as glutathione-dependent formaldehyde dehydrogenase (FDH), which convert aldehydes to corresponding carboxylic acid and alcohol.  ADH is a me
Probab=61.32  E-value=8.9  Score=28.87  Aligned_cols=24  Identities=46%  Similarity=0.666  Sum_probs=19.7

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         ..++||+|+.
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~   83 (363)
T cd08279          60 EGAGVVEEVGPGVT---------GVKPGDHVVL   83 (363)
T ss_pred             cceEEEEEeCCCcc---------ccCCCCEEEE
Confidence            35799999998653         5899999987


No 75 
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic
Probab=61.21  E-value=9.7  Score=28.22  Aligned_cols=24  Identities=38%  Similarity=0.452  Sum_probs=19.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|++
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~   83 (337)
T cd05283          60 EIVGIVVAVGSKVT---------KFKVGDRVGV   83 (337)
T ss_pred             ceeeEEEEECCCCc---------ccCCCCEEEE
Confidence            46899999998754         5899999974


No 76 
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated
Probab=60.48  E-value=11  Score=27.88  Aligned_cols=24  Identities=33%  Similarity=0.293  Sum_probs=19.8

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ..|+|+++|++..         .+++||+|+..
T Consensus        65 ~~G~V~~vG~~v~---------~~~~Gd~V~~~   88 (341)
T PRK05396         65 FVGEVVEVGSEVT---------GFKVGDRVSGE   88 (341)
T ss_pred             eEEEEEEeCCCCC---------cCCCCCEEEEC
Confidence            5899999998754         58999999864


No 77 
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH). This group contains the hypothetical TM0436 alcohol dehydrogenase from Thermotoga maritima,  proteins annotated as 5-exo-alcohol dehydrogenase, and other members of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family.  MDR, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quino
Probab=60.13  E-value=9.7  Score=28.44  Aligned_cols=30  Identities=37%  Similarity=0.488  Sum_probs=20.8

Q ss_pred             ceeEEEEEEcCCeeC-CCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGART-PNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~-~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++... .+|    ..+++||+|+..
T Consensus        61 e~~G~V~~vG~~v~~~~~~----~~~~~Gd~V~~~   91 (361)
T cd08231          61 EGVGRVVALGGGVTTDVAG----EPLKVGDRVTWS   91 (361)
T ss_pred             CCceEEEEeCCCccccccC----CccCCCCEEEEc
Confidence            357999999987531 001    138999999865


No 78 
>smart00829 PKS_ER Enoylreductase. Enoylreductase in Polyketide synthases.
Probab=59.85  E-value=10  Score=26.28  Aligned_cols=25  Identities=40%  Similarity=0.559  Sum_probs=20.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+.-
T Consensus        30 e~~G~v~~~G~~~~---------~~~~Gd~V~~~   54 (288)
T smart00829       30 ECAGVVTRVGPGVT---------GLAVGDRVMGL   54 (288)
T ss_pred             eeEEEEEeeCCCCc---------CCCCCCEEEEE
Confidence            46899999998653         57899999974


No 79 
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH). Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent.  PFDH converts 2 molecules of aldehydes to corresponding carboxylic acid and alcohol.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins).  The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fo
Probab=59.47  E-value=11  Score=28.68  Aligned_cols=24  Identities=29%  Similarity=0.461  Sum_probs=19.6

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        60 e~~G~V~~vG~~v~---------~~~~Gd~V~~   83 (375)
T cd08282          60 EAMGEVEEVGSAVE---------SLKVGDRVVV   83 (375)
T ss_pred             ccEEEEEEeCCCCC---------cCCCCCEEEE
Confidence            46899999998653         5899999986


No 80 
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=59.35  E-value=11  Score=27.63  Aligned_cols=24  Identities=38%  Similarity=0.592  Sum_probs=19.8

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ..|.|+++|++..         .+++||+|+..
T Consensus        85 ~~G~V~~vG~~v~---------~~~~Gd~V~~~  108 (350)
T cd08274          85 IVGRVVAVGEGVD---------TARIGERVLVD  108 (350)
T ss_pred             ceEEEEEeCCCCC---------CCCCCCEEEEe
Confidence            5799999998763         48999999863


No 81 
>cd05285 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Aldose reductase catalyzes the NADP(H)-dependent conversion of glucose to sorbital, and SDH uses NAD(H) in the conversion of sorbitol to fructose.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=59.23  E-value=11  Score=27.90  Aligned_cols=24  Identities=42%  Similarity=0.671  Sum_probs=19.6

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|+...         .+++||+|+.
T Consensus        61 e~~G~V~~vG~~v~---------~~~~Gd~V~~   84 (343)
T cd05285          61 ESAGTVVAVGSGVT---------HLKVGDRVAI   84 (343)
T ss_pred             ceeEEEEeeCCCCC---------CCCCCCEEEE
Confidence            46899999998543         5899999985


No 82 
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group contains proteins that share the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenase family.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. 
Probab=59.11  E-value=12  Score=27.06  Aligned_cols=25  Identities=32%  Similarity=0.400  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+.-
T Consensus        61 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   85 (332)
T cd08259          61 EIVGTVEEVGEGVE---------RFKPGDRVILY   85 (332)
T ss_pred             cceEEEEEECCCCc---------cCCCCCEEEEC
Confidence            36799999998653         58899999853


No 83 
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=59.02  E-value=12  Score=27.25  Aligned_cols=25  Identities=36%  Similarity=0.640  Sum_probs=20.0

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|++.
T Consensus        64 e~~G~v~~vG~~v~---------~~~~Gd~V~~~   88 (327)
T PRK10754         64 EAAGVVSKVGSGVK---------HIKVGDRVVYA   88 (327)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEEC
Confidence            36799999998754         57899999863


No 84 
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only]
Probab=58.99  E-value=13  Score=27.60  Aligned_cols=35  Identities=29%  Similarity=0.384  Sum_probs=25.6

Q ss_pred             CCCeEecCcccCCCEEEcCCCCc-eEEEECCEEEEE
Q psy12488         43 PNGEYIKPVVNVGDKVLLPKFGG-TKIEVEGQELHL   77 (91)
Q Consensus        43 ~~G~~~p~~VkvGD~Vlf~~y~g-~ev~~dg~~y~i   77 (91)
                      .+|+.+-+.++.||.++.+++-| ..+...++.+.|
T Consensus       121 ~~G~~~v~~~~~Gd~iyVPp~~gH~t~N~Gd~pLvf  156 (209)
T COG2140         121 PEGEARVIAVRAGDVIYVPPGYGHYTINTGDEPLVF  156 (209)
T ss_pred             CCCcEEEEEecCCcEEEeCCCcceEeecCCCCCEEE
Confidence            56888888999999999999666 444554444443


No 85 
>cd08246 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl-CoA reductase, a member of the medium chain dehydrogenase/reductase family, catalyzes the NADPH-dependent conversion of crotonyl-CoA to butyryl-CoA, a step in (2S)-methylmalonyl-CoA  production for straight-chain fatty acid biosynthesis.  Like enoyl reductase, another enzyme in fatty acid synthesis, crotonyl-CoA reductase is a member of the zinc-dependent alcohol dehydrogenase-like medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossma
Probab=58.86  E-value=12  Score=28.53  Aligned_cols=24  Identities=38%  Similarity=0.613  Sum_probs=19.9

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ..|+|+++|++..         .+++||+|+..
T Consensus        89 ~~G~V~~vG~~v~---------~~~~Gd~V~~~  112 (393)
T cd08246          89 ASGIVWAVGEGVK---------NWKVGDEVVVH  112 (393)
T ss_pred             eEEEEEEeCCCCC---------cCCCCCEEEEe
Confidence            5799999998753         58899999864


No 86 
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase. 6-hydroxyhexanoate dehydrogenase, an enzyme of the zinc-dependent alcohol dehydrogenase-like family of medium chain dehydrogenases/reductases catalyzes the conversion of 6-hydroxyhexanoate and NAD(+) to 6-oxohexanoate + NADH and H+.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.  A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzy
Probab=58.58  E-value=12  Score=27.79  Aligned_cols=25  Identities=56%  Similarity=0.610  Sum_probs=20.0

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+.-
T Consensus        73 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   97 (350)
T cd08240          73 EIVGEVVAVGPDAA---------DVKVGDKVLVY   97 (350)
T ss_pred             ceeEEEEeeCCCCC---------CCCCCCEEEEC
Confidence            46899999998753         58999999853


No 87 
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family. This group contains proteins related to the zinc-dependent  alcohol dehydrogenases. However, while the group has structural zinc site characteristic of these enzymes, it lacks the consensus site for a catalytic zinc. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone
Probab=57.90  E-value=11  Score=26.96  Aligned_cols=25  Identities=40%  Similarity=0.593  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        64 e~~G~v~~~G~~~~---------~~~~Gd~V~~~   88 (342)
T cd08266          64 DGAGVVEAVGPGVT---------NVKPGQRVVIY   88 (342)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            35799999998653         57899999864


No 88 
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short cha
Probab=57.77  E-value=29  Score=25.47  Aligned_cols=24  Identities=50%  Similarity=0.735  Sum_probs=19.2

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         ..++||+|+.
T Consensus        63 e~~G~V~~vG~~~~---------~~~~Gd~V~~   86 (341)
T cd08297          63 EGAGVVVAVGPGVS---------GLKVGDRVGV   86 (341)
T ss_pred             ccceEEEEeCCCCC---------CCCCCCEEEE
Confidence            35799999998653         5789999985


No 89 
>PRK10838 spr outer membrane lipoprotein; Provisional
Probab=57.67  E-value=3.1  Score=30.24  Aligned_cols=35  Identities=20%  Similarity=0.322  Sum_probs=22.2

Q ss_pred             ceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         15 PGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        15 ~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ..|+-||.++.+-...|+-|.             ..++++||.|+|..
T Consensus       105 ~~Gi~LPr~t~~Q~~~g~~V~-------------~~~lqpGDLVfF~~  139 (190)
T PRK10838        105 QFGLELPRSTYEQQEMGKSVS-------------RSKLRTGDLVLFRA  139 (190)
T ss_pred             hCCCCCCCCHHHHHhcCcCcc-------------cCCCCCCcEEEECC
Confidence            358889988754323332111             12789999999974


No 90 
>PF10844 DUF2577:  Protein of unknown function (DUF2577);  InterPro: IPR022555 This family of proteins has no known function
Probab=57.54  E-value=9.8  Score=24.56  Aligned_cols=22  Identities=41%  Similarity=0.560  Sum_probs=15.0

Q ss_pred             cccCCCEEEcCCCCceEEEECCEEEEEE
Q psy12488         51 VVNVGDKVLLPKFGGTKIEVEGQELHLF   78 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g~ev~~dg~~y~ii   78 (91)
                      .+|+||+|+.-+      .-+|+.|+++
T Consensus        76 ~Lk~GD~V~ll~------~~~gQ~yiVl   97 (100)
T PF10844_consen   76 GLKVGDKVLLLR------VQGGQKYIVL   97 (100)
T ss_pred             CCcCCCEEEEEE------ecCCCEEEEE
Confidence            689999998755      2245666655


No 91 
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=57.43  E-value=13  Score=26.37  Aligned_cols=24  Identities=42%  Similarity=0.544  Sum_probs=19.2

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|.|+++|+...         .+++||+|+.
T Consensus        64 e~~G~v~~~G~~~~---------~~~~Gd~V~~   87 (328)
T cd08268          64 EAAGVVEAVGAGVT---------GFAVGDRVSV   87 (328)
T ss_pred             ceEEEEEeeCCCCC---------cCCCCCEEEe
Confidence            46899999998643         4799999985


No 92 
>TIGR01751 crot-CoA-red crotonyl-CoA reductase. The enzyme modelled by this alignment is responsible for the conversion of crotonyl-CoA reductase to butyryl-CoA. In serine cycle methylotrophic bacteria this enzyme is involved in the process of acetyl-CoA to glyoxylate. In other bacteria the enzyme is used to produce butyrate for incorporation into polyketides such as tylosin from Streptomyces fradiae and coronatine from Pseudomonas syringae.
Probab=57.11  E-value=12  Score=28.76  Aligned_cols=24  Identities=42%  Similarity=0.630  Sum_probs=19.8

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ..|+|+++|++..         .+++||+|+..
T Consensus        85 ~~G~V~~vG~~v~---------~~~~Gd~V~~~  108 (398)
T TIGR01751        85 ASGVVWRVGPGVT---------RWKVGDEVVAS  108 (398)
T ss_pred             eEEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            5799999998764         58999999864


No 93 
>cd07376 PLPDE_III_DSD_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase. This family includes eukaryotic D-serine dehydratases (DSD), cryptic DSDs from bacteria, D-threonine aldolases (D-TA), low specificity D-TAs, and similar uncharacterized proteins. DSD catalyzes the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. D-TA reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. Members of this family are fold type III PLP-dependent enzymes, similar to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on similarity to AR, it is poss
Probab=56.85  E-value=22  Score=26.93  Aligned_cols=37  Identities=19%  Similarity=0.392  Sum_probs=29.4

Q ss_pred             cccCCCEEEc-CCCCceEEEECCEEEEEEecCcEEEEee
Q psy12488         51 VVNVGDKVLL-PKFGGTKIEVEGQELHLFKEADLLAVIE   88 (91)
Q Consensus        51 ~VkvGD~Vlf-~~y~g~ev~~dg~~y~ii~~~DIlavi~   88 (91)
                      .+++||+|.+ +......+..-+. |++++...|.+.+.
T Consensus       305 ~~~vGd~v~~ip~H~c~t~~~~~~-~~vv~~~~v~~~w~  342 (345)
T cd07376         305 DLPIGDRVFLVPNHACETVALHDE-LYVVEGGRVAATWP  342 (345)
T ss_pred             CCCCCCEEEEeCCccccchhcCCE-EEEEECCEEEEEEe
Confidence            5899999999 6677777766655 89999988887654


No 94 
>COG4079 Uncharacterized protein conserved in archaea [Function unknown]
Probab=56.79  E-value=19  Score=27.94  Aligned_cols=28  Identities=21%  Similarity=0.358  Sum_probs=19.4

Q ss_pred             cccCCCEEEcCCC----CceEEEECCEEEEEEe
Q psy12488         51 VVNVGDKVLLPKF----GGTKIEVEGQELHLFK   79 (91)
Q Consensus        51 ~VkvGD~Vlf~~y----~g~ev~~dg~~y~ii~   79 (91)
                      .+++||+|...+-    .|.++++. ..|+++|
T Consensus       261 ~~~pGd~vvv~dg~mki~G~d~kV~-t~yiIcr  292 (293)
T COG4079         261 EVEPGDRVVVKDGVMKIDGKDLKVI-TGYIICR  292 (293)
T ss_pred             ccCCCCEEEEecCceEeccccceee-eeeEEec
Confidence            5899999999773    25555554 5677765


No 95 
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members. This group contains enzymes of the zinc-dependent alcohol dehydrogenase family, including members (aka MDR) identified as 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase and N-benzyl-3-pyrrolidinol dehydrogenase. 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase catalyzes the conversion of 6-Hydroxycyclohex-1-enecarbonyl-CoA and NAD+ to 6-Ketoxycyclohex-1-ene-1-carboxyl-CoA,NADH, and H+. This group displays the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentatio
Probab=56.65  E-value=13  Score=27.00  Aligned_cols=23  Identities=39%  Similarity=0.596  Sum_probs=18.9

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ..|+|+++|+...         .+++||+|+.
T Consensus        64 ~~G~v~~~G~~v~---------~~~~Gd~V~~   86 (338)
T cd08254          64 IAGTVVEVGAGVT---------NFKVGDRVAV   86 (338)
T ss_pred             ccEEEEEECCCCc---------cCCCCCEEEE
Confidence            5799999998654         4789999985


No 96 
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional
Probab=56.32  E-value=13  Score=27.27  Aligned_cols=24  Identities=38%  Similarity=0.670  Sum_probs=19.5

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++..         .+++||+|+.
T Consensus        60 e~~G~V~~~G~~v~---------~~~~Gd~V~~   83 (338)
T PRK09422         60 EGIGIVKEVGPGVT---------SLKVGDRVSI   83 (338)
T ss_pred             ccceEEEEECCCCc---------cCCCCCEEEE
Confidence            46899999998653         4789999985


No 97 
>cd05195 enoyl_red enoyl reductase of polyketide synthase. Putative enoyl reductase of polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase
Probab=55.93  E-value=15  Score=25.41  Aligned_cols=25  Identities=32%  Similarity=0.490  Sum_probs=20.1

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|+.-
T Consensus        34 e~~G~v~~~g~~~~---------~~~~Gd~V~~~   58 (293)
T cd05195          34 ECSGIVTRVGSGVT---------GLKVGDRVMGL   58 (293)
T ss_pred             eeeEEEEeecCCcc---------CCCCCCEEEEE
Confidence            46899999998653         58899999864


No 98 
>cd08234 threonine_DH_like L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation.  THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs  have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria),  and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.
Probab=55.92  E-value=15  Score=26.86  Aligned_cols=24  Identities=42%  Similarity=0.501  Sum_probs=19.7

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|.|+++|++..         .+++||+|+.
T Consensus        59 ~~~G~v~~vG~~v~---------~~~~Gd~V~~   82 (334)
T cd08234          59 EFAGVVVAVGSKVT---------GFKVGDRVAV   82 (334)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEE
Confidence            46899999998653         4799999986


No 99 
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  This group includes alcohol dehydrogenases corresponding to mammalian classes I, II, IV. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.  A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone.  The N-terminal catalytic domain has a distant homology  to GroES.  These proteins typically form dimers (typically
Probab=55.73  E-value=13  Score=28.41  Aligned_cols=25  Identities=36%  Similarity=0.510  Sum_probs=20.2

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        67 e~~G~V~~vG~~v~---------~~~~Gd~V~~~   91 (373)
T cd08299          67 EAAGIVESVGEGVT---------TVKPGDKVIPL   91 (373)
T ss_pred             cceEEEEEeCCCCc---------cCCCCCEEEEC
Confidence            36899999998764         57899999864


No 100
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins. Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an 
Probab=55.12  E-value=15  Score=26.83  Aligned_cols=25  Identities=36%  Similarity=0.375  Sum_probs=19.6

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|++.
T Consensus        60 e~~G~v~~~g~~~~---------~~~~Gd~V~~~   84 (330)
T cd08245          60 EIVGEVVEVGAGVE---------GRKVGDRVGVG   84 (330)
T ss_pred             cceEEEEEECCCCc---------ccccCCEEEEc
Confidence            35799999997653         58999999853


No 101
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=54.97  E-value=16  Score=26.13  Aligned_cols=25  Identities=20%  Similarity=0.110  Sum_probs=19.6

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|+.-
T Consensus        58 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   82 (305)
T cd08270          58 DAAGVVERAAADGS---------GPAVGARVVGL   82 (305)
T ss_pred             eeEEEEEEeCCCCC---------CCCCCCEEEEe
Confidence            46799999998643         47899999853


No 102
>cd08244 MDR_enoyl_red Possible enoyl reductase. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydr
Probab=54.66  E-value=16  Score=26.37  Aligned_cols=25  Identities=36%  Similarity=0.465  Sum_probs=20.0

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|+..
T Consensus        66 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   90 (324)
T cd08244          66 EVAGVVDAVGPGVD---------PAWLGRRVVAH   90 (324)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            36899999998653         47899999874


No 103
>smart00696 DM9 Repeats found in Drosophila proteins.
Probab=54.62  E-value=17  Score=22.16  Aligned_cols=53  Identities=19%  Similarity=0.281  Sum_probs=40.0

Q ss_pred             ecCCccc--cceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECCEE
Q psy12488         20 IPEKAQQ--EVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQE   74 (91)
Q Consensus        20 LP~~~~~--k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg~~   74 (91)
                      +|..|-.  ....|+.+-||-+..  +|.++|-.|-+.....|-.|.|.++.++.=|
T Consensus        12 vP~~AV~~G~~~~G~~lYvgR~~~--~g~~~pGKv~p~~~~~yi~~~g~E~~~~~YE   66 (71)
T smart00696       12 IPPNAVVGGTDSDGEPLYVGRAYY--EGSLLPGKVVPSHGCAYIPYGGQEVRLDSYE   66 (71)
T ss_pred             CCCCcEEcccCCCCCEEEEEEEEE--CCcEEEEEEEccCCEEEEEECCEEEEcCeEE
Confidence            4666632  345677788887665  6788888999999999999999999985433


No 104
>cd05282 ETR_like 2-enoyl thioester reductase-like. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossman
Probab=54.42  E-value=16  Score=26.28  Aligned_cols=26  Identities=38%  Similarity=0.446  Sum_probs=20.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|.|+++|++..         ..++||+|+...
T Consensus        63 e~~G~v~~~G~~v~---------~~~~Gd~V~~~~   88 (323)
T cd05282          63 EGVGVVVEVGSGVS---------GLLVGQRVLPLG   88 (323)
T ss_pred             ceEEEEEEeCCCCC---------CCCCCCEEEEeC
Confidence            46899999998764         478999999754


No 105
>cd08251 polyketide_synthase polyketide synthase. Polyketide synthases produce polyketides in step by step mechanism that is similar to fatty acid synthesis. Enoyl reductase reduces a double to single bond. Erythromycin is one example of a polyketide generated by 3 complex enzymes (megasynthases). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde a
Probab=54.25  E-value=15  Score=25.83  Aligned_cols=25  Identities=40%  Similarity=0.551  Sum_probs=19.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         ..++||+|+..
T Consensus        44 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   68 (303)
T cd08251          44 EASGVVRAVGPHVT---------RLAVGDEVIAG   68 (303)
T ss_pred             eeeEEEEEECCCCC---------CCCCCCEEEEe
Confidence            46799999998653         47899999863


No 106
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase. Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Probab=53.61  E-value=16  Score=27.42  Aligned_cols=24  Identities=29%  Similarity=0.531  Sum_probs=18.7

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+ +||+|+..
T Consensus        60 E~~G~V~~vG~~v~---------~~-~GdrV~~~   83 (349)
T TIGR03201        60 EISGRVIQAGAGAA---------SW-IGKAVIVP   83 (349)
T ss_pred             cceEEEEEeCCCcC---------CC-CCCEEEEC
Confidence            36899999999753         24 89999864


No 107
>PF10794 DUF2606:  Protein of unknown function (DUF2606);  InterPro: IPR019730 This entry represents bacterial proteins with unknown function. 
Probab=53.35  E-value=58  Score=22.56  Aligned_cols=42  Identities=14%  Similarity=0.223  Sum_probs=33.1

Q ss_pred             ccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEE
Q psy12488         26 QEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIE   69 (91)
Q Consensus        26 ~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~   69 (91)
                      ..|+.-....+|  +.+.+|+.++-.++.|+.++|-+-+++.+.
T Consensus        71 ~qPs~eig~~IG--KTD~~Gki~Wk~~~kG~Y~v~l~n~e~~~~  112 (131)
T PF10794_consen   71 PQPSKEIGISIG--KTDEEGKIIWKNGRKGKYIVFLPNGETQET  112 (131)
T ss_pred             CCCchhhceeec--ccCCCCcEEEecCCcceEEEEEcCCCceeE
Confidence            346666666776  467899999999999999999888876554


No 108
>PLN03154 putative allyl alcohol dehydrogenase; Provisional
Probab=53.28  E-value=14  Score=27.97  Aligned_cols=24  Identities=17%  Similarity=0.033  Sum_probs=18.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|.|.+||++..         .+++||+|+.
T Consensus        81 ~~~G~v~~vg~~v~---------~~~~Gd~V~~  104 (348)
T PLN03154         81 EGFGVSKVVDSDDP---------NFKPGDLISG  104 (348)
T ss_pred             EeeEEEEEEecCCC---------CCCCCCEEEe
Confidence            34689999998753         5899999973


No 109
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenase and has the catalytic and structural zinc-binding sites characteristic of this group. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology  to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanedi
Probab=53.16  E-value=17  Score=27.79  Aligned_cols=25  Identities=24%  Similarity=0.246  Sum_probs=19.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        94 e~~G~V~~vG~~v~---------~~~~Gd~V~~~  118 (384)
T cd08265          94 EFSGVVEKTGKNVK---------NFEKGDPVTAE  118 (384)
T ss_pred             ceEEEEEEECCCCC---------CCCCCCEEEEC
Confidence            35799999998653         47899999863


No 110
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1. Human Reticulon 4 Interacting Protein 1 is a member of the medium chain dehydrogenase/ reductase (MDR) family. Riticulons are endoplasmic reticulum associated proteins involved in membrane trafficking  and neuroendocrine secretion. The MDR/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.
Probab=52.97  E-value=16  Score=26.83  Aligned_cols=25  Identities=32%  Similarity=0.538  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|+..
T Consensus        80 e~~G~v~~vG~~v~---------~~~~Gd~V~~~  104 (350)
T cd08248          80 DCSGVVVDIGSGVK---------SFEIGDEVWGA  104 (350)
T ss_pred             eeEEEEEecCCCcc---------cCCCCCEEEEe
Confidence            35799999998653         47899999863


No 111
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=52.18  E-value=17  Score=26.39  Aligned_cols=42  Identities=26%  Similarity=0.188  Sum_probs=26.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECCEEEEEEecCcE
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHLFKEADL   83 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~DI   83 (91)
                      ...|.|+++|++..         .+++||+|.--...|.     -.+|+++..+.+
T Consensus        64 e~~G~v~~vG~~v~---------~~~~Gd~V~~~~~~g~-----~~~~~~~~~~~~  105 (331)
T cd08273          64 DLVGRVDALGSGVT---------GFEVGDRVAALTRVGG-----NAEYINLDAKYL  105 (331)
T ss_pred             ceEEEEEEeCCCCc---------cCCCCCEEEEeCCCcc-----eeeEEEechHHe
Confidence            35799999998653         5899999986432111     135666655443


No 112
>KOG0023|consensus
Probab=51.87  E-value=14  Score=29.65  Aligned_cols=25  Identities=32%  Similarity=0.400  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+.||+...         -.|+||+|=..
T Consensus        72 EiaG~VvkvGs~V~---------~~kiGD~vGVg   96 (360)
T KOG0023|consen   72 EIAGVVVKVGSNVT---------GFKIGDRVGVG   96 (360)
T ss_pred             eeeEEEEEECCCcc---------cccccCeeeee
Confidence            46899999999754         58899988654


No 113
>PRK11479 hypothetical protein; Provisional
Probab=51.72  E-value=6.7  Score=30.17  Aligned_cols=39  Identities=8%  Similarity=-0.032  Sum_probs=26.7

Q ss_pred             ceecceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         11 YLLFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        11 e~~T~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      .++++-|+-||.++...-..|+-|+..             ++++||.|+|..
T Consensus        37 ~~~~~~~~~~pr~s~~q~~~g~~Vs~~-------------~LqpGDLVFfst   75 (274)
T PRK11479         37 AEAKTWAVKFQHQSSFTEQGIKEITAP-------------DLKPGDLLFSSS   75 (274)
T ss_pred             ccchhcceecCcccHHHHhCCcccChh-------------hCCCCCEEEEec
Confidence            356677899998886654444433322             699999999863


No 114
>TIGR00074 hypC_hupF hydrogenase assembly chaperone HypC/HupF. An additional proposed function is to shuttle the iron atom that has been liganded at the HypC/HypD complex to the precursor of the large hydrogenase (HycE) subunit. PubMed:12441107.
Probab=51.63  E-value=24  Score=22.08  Aligned_cols=12  Identities=50%  Similarity=0.592  Sum_probs=10.2

Q ss_pred             cccCCCEEEcCC
Q psy12488         51 VVNVGDKVLLPK   62 (91)
Q Consensus        51 ~VkvGD~Vlf~~   62 (91)
                      ++++||.|+..-
T Consensus        35 ~~~vGD~VLVH~   46 (76)
T TIGR00074        35 EVKVGDYVLVHV   46 (76)
T ss_pred             CCCCCCEEEEec
Confidence            799999999754


No 115
>cd06555 ASCH_PF0470_like ASC-1 homology domain, subfamily similar to Pyrococcus furiosus Pf0470. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation.
Probab=51.44  E-value=12  Score=24.93  Aligned_cols=15  Identities=33%  Similarity=0.667  Sum_probs=13.3

Q ss_pred             cccCCCEEEcCCCCc
Q psy12488         51 VVNVGDKVLLPKFGG   65 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g   65 (91)
                      .+++||+++|..+.+
T Consensus        31 ~ikvGD~I~f~~~~~   45 (109)
T cd06555          31 QIKVGDKILFNDLDT   45 (109)
T ss_pred             cCCCCCEEEEEEcCC
Confidence            699999999999864


No 116
>cd08249 enoyl_reductase_like enoyl_reductase_like. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol de
Probab=51.32  E-value=19  Score=26.76  Aligned_cols=25  Identities=36%  Similarity=0.377  Sum_probs=19.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|+--
T Consensus        61 e~~G~v~~vG~~v~---------~~~~Gd~V~~~   85 (339)
T cd08249          61 DFAGTVVEVGSGVT---------RFKVGDRVAGF   85 (339)
T ss_pred             eeeEEEEEeCCCcC---------cCCCCCEEEEE
Confidence            46799999998753         47899999853


No 117
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.   A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone.  The N-terminal catalytic domain has a distant homology to GroES.  These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subu
Probab=51.14  E-value=17  Score=27.36  Aligned_cols=27  Identities=33%  Similarity=0.410  Sum_probs=19.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++.. .     +...++||+|+.
T Consensus        60 e~~G~v~~vG~~~~-~-----~~~~~~Gd~V~~   86 (367)
T cd08263          60 EISGEVVEVGPNVE-N-----PYGLSVGDRVVG   86 (367)
T ss_pred             ccceEEEEeCCCCC-C-----CCcCCCCCEEEE
Confidence            46799999998643 1     113899999986


No 118
>cd00148 PROF Profilin binds actin monomers, membrane polyphosphoinositides such as PI(4,5)P2, and poly-L-proline. Profilin can inhibit actin polymerization into F-actin by binding to monomeric actin (G-actin) and terminal F-actin subunits, but - as a regulator of the cytoskeleton - it may also promote actin polymerization. It plays a role in the assembly of branched actin filament networks, by activating WASP via binding to WASP's proline rich domain. Profilin may link the cytoskeleton with major signalling pathways by interacting with components of the phosphatidylinositol cycle and Ras pathway.
Probab=50.82  E-value=32  Score=22.88  Aligned_cols=20  Identities=20%  Similarity=0.320  Sum_probs=16.4

Q ss_pred             eEEEECCEEEEEEecCcEEE
Q psy12488         66 TKIEVEGQELHLFKEADLLA   85 (91)
Q Consensus        66 ~ev~~dg~~y~ii~~~DIla   85 (91)
                      .=+.++|++|+++|.++-..
T Consensus        60 ~Gi~l~G~KY~~l~~d~~~i   79 (127)
T cd00148          60 TGLTLGGQKYMVIRADDRSI   79 (127)
T ss_pred             CCEEECCeEEEEEecCccEE
Confidence            34899999999999988543


No 119
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catal
Probab=50.78  E-value=19  Score=26.59  Aligned_cols=24  Identities=33%  Similarity=0.351  Sum_probs=19.4

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|.|+++|++..         .+++||+|+.
T Consensus        61 e~~G~v~~vG~~v~---------~~~~Gd~V~~   84 (333)
T cd08296          61 EVVGRIDAVGEGVS---------RWKVGDRVGV   84 (333)
T ss_pred             ceeEEEEEECCCCc---------cCCCCCEEEe
Confidence            35799999998653         4889999985


No 120
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=50.72  E-value=20  Score=25.59  Aligned_cols=25  Identities=40%  Similarity=0.445  Sum_probs=20.0

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|+..
T Consensus        65 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   89 (319)
T cd08267          65 DFAGEVVAVGSGVT---------RFKVGDEVFGR   89 (319)
T ss_pred             eeeEEEEEeCCCCC---------CCCCCCEEEEe
Confidence            46799999998654         57899999864


No 121
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short cha
Probab=50.06  E-value=19  Score=26.29  Aligned_cols=23  Identities=43%  Similarity=0.562  Sum_probs=18.7

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ..|.|+++|++..         .+++||+|+.
T Consensus        66 ~~G~V~~vG~~v~---------~~~~Gd~V~~   88 (329)
T cd08298          66 IVGRVEAVGPGVT---------RFSVGDRVGV   88 (329)
T ss_pred             ccEEEEEECCCCC---------CCcCCCEEEE
Confidence            5799999998653         4899999975


No 122
>PF01455 HupF_HypC:  HupF/HypC family;  InterPro: IPR001109 The large subunit of [NiFe]-hydrogenase, as well as other nickel metalloenzymes, is synthesised as a precursor devoid of the metalloenzyme active site. This precursor then undergoes a complex post-translational maturation process that requires a number of accessory proteins. The hydrogenase expression/formation proteins (HupF/HypC) form a family of small proteins that are hydrogenase precursor-specific chaperones required for this maturation process []. They are believed to keep the hydrogenase precursor in a conformation accessible for metal incorporation [, ].; PDB: 3D3R_A 2Z1C_C 2OT2_A.
Probab=50.06  E-value=22  Score=21.58  Aligned_cols=12  Identities=50%  Similarity=0.601  Sum_probs=7.9

Q ss_pred             cccCCCEEEcCC
Q psy12488         51 VVNVGDKVLLPK   62 (91)
Q Consensus        51 ~VkvGD~Vlf~~   62 (91)
                      ++++||+|+..-
T Consensus        37 ~v~~Gd~VLVHa   48 (68)
T PF01455_consen   37 DVKVGDYVLVHA   48 (68)
T ss_dssp             SB-TT-EEEEET
T ss_pred             CCCCCCEEEEec
Confidence            599999999754


No 123
>PRK13771 putative alcohol dehydrogenase; Provisional
Probab=49.71  E-value=20  Score=26.16  Aligned_cols=25  Identities=24%  Similarity=0.215  Sum_probs=19.7

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         ..++||+|+..
T Consensus        61 e~~G~v~~~g~~~~---------~~~~G~~V~~~   85 (334)
T PRK13771         61 EVVGTVEEVGENVK---------GFKPGDRVASL   85 (334)
T ss_pred             cceEEEEEeCCCCc---------cCCCCCEEEEC
Confidence            35799999998653         47899999864


No 124
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=49.52  E-value=22  Score=25.32  Aligned_cols=25  Identities=40%  Similarity=0.383  Sum_probs=19.6

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|+...         .+++||+|+.-
T Consensus        64 e~~G~v~~~G~~~~---------~~~~Gd~V~~~   88 (326)
T cd08272          64 DVAGVVEAVGEGVT---------RFRVGDEVYGC   88 (326)
T ss_pred             ceeEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            35799999997653         47899999953


No 125
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=49.52  E-value=19  Score=25.68  Aligned_cols=25  Identities=40%  Similarity=0.438  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++..         .+++||+|+..
T Consensus        63 e~~G~v~~~G~~~~---------~~~~Gd~V~~~   87 (325)
T cd08271          63 DGAGVVVAVGAKVT---------GWKVGDRVAYH   87 (325)
T ss_pred             ceEEEEEEeCCCCC---------cCCCCCEEEec
Confidence            46799999998654         47899999964


No 126
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR). Zeta-crystallin is a eye lens protein with NADP-dependent quinone reductase activity (QOR). It has been cited as a structural component in mammalian eyes, but also has homology to quinone reductases in unrelated species. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  Alcohol dehydrogenase in the liver converts
Probab=49.30  E-value=19  Score=25.47  Aligned_cols=26  Identities=42%  Similarity=0.580  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|.|+++|+...         .+++||+|+.-.
T Consensus        64 e~~G~v~~~g~~~~---------~~~~Gd~v~~~~   89 (325)
T cd08253          64 DGAGVVEAVGEGVD---------GLKVGDRVWLTN   89 (325)
T ss_pred             ceEEEEEeeCCCCC---------CCCCCCEEEEec
Confidence            35799999997553         579999998643


No 127
>TIGR03214 ura-cupin putative allantoin catabolism protein. This model represents a protein containing a tandem arrangement of cupin domains (N-terminal part of pfam07883 and C-terminal more distantly related to pfam00190). This protein is found in the vicinity of genes involved in the catabolism of allantoin, a breakdown product of urate and sometimes of urate iteslf. The distribution of pathway components in the genomes in which this family is observed suggests that the function is linked to the allantoate catabolism to glyoxylate pathway (GenProp0686) since it is sometimes found in genomes lacking any elements of the xanthine-to-allantoin pathways (e.g. in Enterococcus faecalis).
Probab=48.58  E-value=32  Score=25.69  Aligned_cols=49  Identities=18%  Similarity=0.319  Sum_probs=35.0

Q ss_pred             eEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECC---EEEEEEec
Q psy12488         30 NAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEG---QELHLFKE   80 (91)
Q Consensus        30 ~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg---~~y~ii~~   80 (91)
                      .+.-|==|.|..+.||+.  ..|++||.+.++.|.=+.+.--|   -+|++.++
T Consensus       202 h~~yiL~G~G~~~~~g~~--~~V~~GD~i~i~~~~~h~~~~~G~~~~~~l~ykd  253 (260)
T TIGR03214       202 HGLYVLEGKGVYNLDNNW--VPVEAGDYIWMGAYCPQACYAGGRGEFRYLLYKD  253 (260)
T ss_pred             eEEEEEeceEEEEECCEE--EEecCCCEEEECCCCCEEEEecCCCcEEEEEEcc
Confidence            355555677776666654  57999999999999988887644   36666543


No 128
>PRK09880 L-idonate 5-dehydrogenase; Provisional
Probab=48.38  E-value=23  Score=26.50  Aligned_cols=24  Identities=13%  Similarity=0.087  Sum_probs=18.4

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|+|+++  +..         .+++||+|.+..
T Consensus        66 E~~G~V~~v--~v~---------~~~vGdrV~~~~   89 (343)
T PRK09880         66 EVIGKIVHS--DSS---------GLKEGQTVAINP   89 (343)
T ss_pred             ccEEEEEEe--cCc---------cCCCCCEEEECC
Confidence            467999999  332         589999998753


No 129
>cd05286 QOR2 Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds.  Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone 
Probab=48.18  E-value=24  Score=24.84  Aligned_cols=25  Identities=44%  Similarity=0.635  Sum_probs=19.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|+.-
T Consensus        61 e~~G~v~~~g~~~~---------~~~~G~~V~~~   85 (320)
T cd05286          61 EGAGVVEAVGPGVT---------GFKVGDRVAYA   85 (320)
T ss_pred             ceeEEEEEECCCCC---------CCCCCCEEEEe
Confidence            46799999997653         47999999874


No 130
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members. Includes Human Mgc45594 gene product of undetermined function. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.
Probab=47.19  E-value=25  Score=25.52  Aligned_cols=25  Identities=40%  Similarity=0.413  Sum_probs=19.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|+..
T Consensus        67 e~~G~v~~vG~~v~---------~~~~Gd~V~~~   91 (329)
T cd08250          67 EGVGEVVAVGEGVT---------DFKVGDAVATM   91 (329)
T ss_pred             eeEEEEEEECCCCC---------CCCCCCEEEEe
Confidence            36799999998653         47899999974


No 131
>COG4043 Preprotein translocase subunit Sec61beta [Intracellular    trafficking, secretion, and vesicular transport]
Probab=47.00  E-value=12  Score=25.20  Aligned_cols=12  Identities=25%  Similarity=0.584  Sum_probs=11.0

Q ss_pred             cccCCCEEEcCC
Q psy12488         51 VVNVGDKVLLPK   62 (91)
Q Consensus        51 ~VkvGD~Vlf~~   62 (91)
                      .+|+||+++|+.
T Consensus        33 ~ik~GD~IiF~~   44 (111)
T COG4043          33 QIKPGDKIIFNG   44 (111)
T ss_pred             CCCCCCEEEEcC
Confidence            799999999985


No 132
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family. This group has the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, 
Probab=46.28  E-value=23  Score=26.27  Aligned_cols=25  Identities=40%  Similarity=0.529  Sum_probs=19.0

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ..|+|+++|++..  +|     .+++||+|+.
T Consensus        70 ~~G~v~~vG~~v~--~~-----~~~~Gd~V~~   94 (350)
T cd08256          70 FVGRVVELGEGAE--ER-----GVKVGDRVIS   94 (350)
T ss_pred             eeEEEEEeCCCcc--cC-----CCCCCCEEEE
Confidence            5799999998652  00     3789999985


No 133
>cd08252 AL_MDR Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, whil
Probab=45.27  E-value=25  Score=25.57  Aligned_cols=25  Identities=36%  Similarity=0.498  Sum_probs=19.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         ..++||+|++-
T Consensus        66 e~~G~v~~~G~~v~---------~~~~Gd~V~~~   90 (336)
T cd08252          66 DASGVVEAVGSEVT---------LFKVGDEVYYA   90 (336)
T ss_pred             ceEEEEEEcCCCCC---------CCCCCCEEEEc
Confidence            35799999998653         47999999974


No 134
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional
Probab=44.46  E-value=44  Score=19.68  Aligned_cols=29  Identities=31%  Similarity=0.408  Sum_probs=14.1

Q ss_pred             EcCCCCceEEEECCEEEEEEecCcEEEEe
Q psy12488         59 LLPKFGGTKIEVEGQELHLFKEADLLAVI   87 (91)
Q Consensus        59 lf~~y~g~ev~~dg~~y~ii~~~DIlavi   87 (91)
                      +..+.+|+=.++.-.+--.++..++|+.|
T Consensus        42 I~a~~~G~V~~i~v~~G~~V~~G~~l~~i   70 (71)
T PRK05889         42 VLAEVAGTVSKVSVSVGDVIQAGDLIAVI   70 (71)
T ss_pred             EeCCCCEEEEEEEeCCCCEECCCCEEEEE
Confidence            44556664333221111235677777765


No 135
>PRK10413 hydrogenase 2 accessory protein HypG; Provisional
Probab=44.33  E-value=42  Score=21.28  Aligned_cols=12  Identities=25%  Similarity=0.180  Sum_probs=9.9

Q ss_pred             cccCCCEEEcCC
Q psy12488         51 VVNVGDKVLLPK   62 (91)
Q Consensus        51 ~VkvGD~Vlf~~   62 (91)
                      ++++||+|+..-
T Consensus        42 ~~~vGDyVLVHa   53 (82)
T PRK10413         42 ADLLGQWVLVHV   53 (82)
T ss_pred             ccccCCEEEEec
Confidence            578999999754


No 136
>cd05281 TDH Threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)- dependent oxidation.  THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs  have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria) and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.
Probab=44.29  E-value=28  Score=25.71  Aligned_cols=24  Identities=42%  Similarity=0.432  Sum_probs=19.0

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|+...         ..++||+|+.
T Consensus        64 e~~G~V~~~G~~v~---------~~~~Gd~V~~   87 (341)
T cd05281          64 EFAGEVVEVGEGVT---------RVKVGDYVSA   87 (341)
T ss_pred             ceEEEEEEECCCCC---------CCCCCCEEEE
Confidence            36899999998642         4789999976


No 137
>TIGR00739 yajC preprotein translocase, YajC subunit. While this protein is part of the preprotein translocase in Escherichia coli, it is not essential for viability or protein secretion. The N-terminus region contains a predicted membrane-spanning region followed by a region consisting almost entirely of residues with charged (acidic, basic, or zwitterionic) side chains. This small protein is about 100 residues in length, and is restricted to bacteria; however, this protein is absent from some lineages, including spirochetes and Mycoplasmas.
Probab=44.05  E-value=66  Score=20.20  Aligned_cols=25  Identities=28%  Similarity=0.361  Sum_probs=17.0

Q ss_pred             cccCCCEEEcCC-CCceEEEECCEEE
Q psy12488         51 VVNVGDKVLLPK-FGGTKIEVEGQEL   75 (91)
Q Consensus        51 ~VkvGD~Vlf~~-y~g~ev~~dg~~y   75 (91)
                      .+++||.|+... .-|+=+.++++..
T Consensus        37 ~L~~Gd~VvT~gGi~G~V~~i~d~~v   62 (84)
T TIGR00739        37 SLKKGDKVLTIGGIIGTVTKIAENTI   62 (84)
T ss_pred             hCCCCCEEEECCCeEEEEEEEeCCEE
Confidence            678888888765 5566666665433


No 138
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding
Probab=43.96  E-value=26  Score=24.70  Aligned_cols=25  Identities=48%  Similarity=0.581  Sum_probs=19.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|+.-
T Consensus        64 e~~G~v~~vg~~~~---------~~~~Gd~V~~~   88 (323)
T cd05276          64 EVAGVVVAVGPGVT---------GWKVGDRVCAL   88 (323)
T ss_pred             eeEEEEEeeCCCCC---------CCCCCCEEEEe
Confidence            35799999998653         47899999864


No 139
>PF11302 DUF3104:  Protein of unknown function (DUF3104);  InterPro: IPR021453  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=42.55  E-value=16  Score=23.07  Aligned_cols=15  Identities=27%  Similarity=0.310  Sum_probs=12.5

Q ss_pred             CcccCCCEEEcCCCC
Q psy12488         50 PVVNVGDKVLLPKFG   64 (91)
Q Consensus        50 ~~VkvGD~Vlf~~y~   64 (91)
                      +.||.||+|++.+-.
T Consensus         4 L~Vk~Gd~ViV~~~~   18 (75)
T PF11302_consen    4 LSVKPGDTVIVQDEQ   18 (75)
T ss_pred             cccCCCCEEEEecCc
Confidence            479999999997754


No 140
>TIGR03784 marine_sortase sortase, marine proteobacterial type. Members of this protein family are sortase enzymes, cysteine transpeptidases involved in protein sorting activities. Members of this family tend to be found in proteobacteria, rather than in Gram-positive bacteria where sortases attach proteins to the Gram-positive cell wall or participate in pilin cross-linking. Many species with this sortase appear to contain a signal target sequence, a protein with a Vault protein inter-alpha-trypsin domain (pfam08487) and a von Willebrand factor type A domain (pfam00092), encoded by an adjacent gene. These sortases are designated subfamily 6 according to Comfort and Clubb (2004).
Probab=42.50  E-value=35  Score=24.25  Aligned_cols=32  Identities=16%  Similarity=0.178  Sum_probs=20.9

Q ss_pred             cccCCCEEEcCCCCceEEEECCEEEEEEecCc
Q psy12488         51 VVNVGDKVLLPKFGGTKIEVEGQELHLFKEAD   82 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~D   82 (91)
                      .+++||.|.+..-.|+...|.=.+-.+++.+|
T Consensus       108 ~L~~GD~I~v~~~~g~~~~Y~V~~~~iV~~~d  139 (174)
T TIGR03784       108 ELRPGDVIRLQTPDGQWQSYQVTATRVVDESE  139 (174)
T ss_pred             hCCCCCEEEEEECCCeEEEEEEeEEEEECCcc
Confidence            79999999998777765444333334455544


No 141
>PF00235 Profilin:  Profilin;  InterPro: IPR002097 Profilin is a small eukaryotic protein that binds to monomeric actin (G-actin) in a 1:1 ratio thus preventing the polymerisation of actin into filaments (F-actin). It can also in certain circumstance promote actin polymerisation. Profilin also binds to polyphosphoinositides such as PIP2. Overall sequence similarity among profilin from organisms which belong to different phyla (ranging from fungi to mammals) is low, but the N-terminal region is relatively well conserved. That region is thought to be involved in the binding to actin.   A protein structurally similar to profilin is present in the genome of Variola virus and Vaccinia virus (gene A42R). Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Ara t 8, Bet v 2, Cyn d 12, Hel a 2, Mer a 1 and Phl p 11.; GO: 0003779 actin binding, 0007010 cytoskeleton organization, 0015629 actin cytoskeleton; PDB: 1ACF_A 3NEC_C 2V8F_B 2V8C_A 2VK3_A 2JKF_A 2JKG_A 1F2K_B 2ACG_A 1YPR_B ....
Probab=42.10  E-value=25  Score=22.63  Aligned_cols=18  Identities=17%  Similarity=0.422  Sum_probs=14.9

Q ss_pred             ceEEEECCEEEEEEecCc
Q psy12488         65 GTKIEVEGQELHLFKEAD   82 (91)
Q Consensus        65 g~ev~~dg~~y~ii~~~D   82 (91)
                      ..-|.++|++|+++|.+|
T Consensus        58 ~~gi~l~G~kY~~~~~d~   75 (121)
T PF00235_consen   58 SNGITLGGKKYIVLRADD   75 (121)
T ss_dssp             HH-EEETTEEEEEEEEET
T ss_pred             cCCeEEcCcEeEEEecCC
Confidence            356999999999999876


No 142
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=41.99  E-value=30  Score=24.83  Aligned_cols=25  Identities=36%  Similarity=0.457  Sum_probs=19.7

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|++..         .+++||+|+.-
T Consensus        63 e~~G~v~~~g~~~~---------~~~~G~~V~~~   87 (337)
T cd08275          63 ECAGTVEAVGEGVK---------DFKVGDRVMGL   87 (337)
T ss_pred             eeEEEEEEECCCCc---------CCCCCCEEEEe
Confidence            35799999998654         57899999864


No 143
>PF05203 Hom_end_hint:  Hom_end-associated Hint;  InterPro: IPR007868 Homing endonucleases are encoded by mobile DNA elements that are found inserted within host genes in all domains of life. The crystal structure of the homing nuclease PI-Sce [] revealed two domains: an endonucleolytic centre resembling the C-terminal domain of Drosophila melanogaster Hedgehog protein, and a second domain containing the protein-splicing active site. This domain corresponds to the protein-splicing domain.; GO: 0030908 protein splicing; PDB: 1LWT_A 1UM2_B 1JVA_B 1GPP_A 1VDE_A 1EF0_B 1DFA_A 1LWS_A.
Probab=41.24  E-value=38  Score=24.90  Aligned_cols=30  Identities=23%  Similarity=0.308  Sum_probs=18.6

Q ss_pred             EEcCCeeCCCCeEecC-cccCCCEEEcCCCC
Q psy12488         35 AVGPGARTPNGEYIKP-VVNVGDKVLLPKFG   64 (91)
Q Consensus        35 AVG~G~~~~~G~~~p~-~VkvGD~Vlf~~y~   64 (91)
                      |-|+-.+..||...+. +|++||.|+=++-.
T Consensus         3 ~~gT~vlmaDG~~k~ie~i~~Gd~vmg~dg~   33 (215)
T PF05203_consen    3 AKGTRVLMADGSIKPIEDIKIGDQVMGPDGR   33 (215)
T ss_dssp             ETT-EEEBTTS-EEEGGG--TT-EEEBTTSS
T ss_pred             CCCCEEEecCCCeeEEeecccCCEEECCCCC
Confidence            4466667788888888 99999999966544


No 144
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast. This group contains members identified in targeting of yeast membrane proteins ATPase. AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast, identified as a multicopy suppressor of pma1 mutants which cause temperature sensitive growth arrest due to the inability of ATPase to target to the cell surface. This family is homologous to the medium chain family of dehydrogenases and reductases. Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-termi
Probab=41.19  E-value=34  Score=25.33  Aligned_cols=25  Identities=32%  Similarity=0.376  Sum_probs=19.2

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|.|+++|++...        ..++||+|+-
T Consensus        65 e~~G~V~~vG~~v~~--------~~~~Gd~V~~   89 (352)
T cd08247          65 DYSGVIVKVGSNVAS--------EWKVGDEVCG   89 (352)
T ss_pred             eeEEEEEEeCccccc--------CCCCCCEEEE
Confidence            468999999986521        4789999984


No 145
>smart00392 PROF Profilin. Binds actin monomers, membrane polyphosphoinositides and poly-L-proline.
Probab=41.13  E-value=49  Score=21.96  Aligned_cols=19  Identities=16%  Similarity=0.315  Sum_probs=15.5

Q ss_pred             eEEEECCEEEEEEecCcEE
Q psy12488         66 TKIEVEGQELHLFKEADLL   84 (91)
Q Consensus        66 ~ev~~dg~~y~ii~~~DIl   84 (91)
                      .=+.++|++|+++|.+|..
T Consensus        62 ~Gi~l~G~Ky~~~~~d~~~   80 (129)
T smart00392       62 NGLTLGGQKYMVIRADDRS   80 (129)
T ss_pred             CCeEECCeEEEEEEecCcE
Confidence            4589999999999987643


No 146
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family. Members of this family are putative quinone oxidoreductases that belong to the broader superfamily (modeled by Pfam pfam00107) of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxiooreductases. The alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, and members are likely to be quinone oxidoreductases instead. A member of this family in Homo sapiens, PIG3, is induced by p53 but is otherwise uncharacterized.
Probab=40.44  E-value=37  Score=24.04  Aligned_cols=25  Identities=40%  Similarity=0.420  Sum_probs=19.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|+...         .+++||+|+--
T Consensus        64 e~~G~v~~vg~~~~---------~~~~Gd~V~~~   88 (325)
T TIGR02824        64 EVAGEVVAVGEGVS---------RWKVGDRVCAL   88 (325)
T ss_pred             eeEEEEEEeCCCCC---------CCCCCCEEEEc
Confidence            46799999997543         47899999863


No 147
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds.  Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts et
Probab=40.25  E-value=32  Score=24.15  Aligned_cols=26  Identities=46%  Similarity=0.565  Sum_probs=20.1

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|.|+++|++..         .+++||+|+...
T Consensus        66 e~~G~v~~~G~~~~---------~~~~G~~V~~~~   91 (309)
T cd05289          66 DVAGVVVAVGPGVT---------GFKVGDEVFGMT   91 (309)
T ss_pred             ceeEEEEeeCCCCC---------CCCCCCEEEEcc
Confidence            35799999998653         578999998654


No 148
>PF01052 SpoA:  Surface presentation of antigens (SPOA);  InterPro: IPR001543 Proteins in this group are involved in a secretory pathway responsible for the surface presentation of invasion plasmid antigen needed for the entry of Salmonella and other species into mammalian cells [, ].They could play a role in preserving the translocation competence of the IPA antigens and are required for secretion of the three IPA proteins [].  The C-terminal region of flagellar motor switch proteins FliN and FliM is also included in this entry. ; PDB: 3UEP_A 1O9Y_B 1YAB_A.
Probab=40.02  E-value=59  Score=19.29  Aligned_cols=26  Identities=31%  Similarity=0.446  Sum_probs=16.5

Q ss_pred             cccCCCEEEcCCC--CceEEEECCEEEE
Q psy12488         51 VVNVGDKVLLPKF--GGTKIEVEGQELH   76 (91)
Q Consensus        51 ~VkvGD~Vlf~~y--~g~ev~~dg~~y~   76 (91)
                      .+++||.+-++..  .-..+.++|...+
T Consensus        28 ~L~~Gdvi~l~~~~~~~v~l~v~g~~~~   55 (77)
T PF01052_consen   28 NLKVGDVIPLDKPADEPVELRVNGQPIF   55 (77)
T ss_dssp             C--TT-EEEECCESSTEEEEEETTEEEE
T ss_pred             cCCCCCEEEeCCCCCCCEEEEECCEEEE
Confidence            6889999999887  4456677886544


No 149
>PRK02268 hypothetical protein; Provisional
Probab=39.50  E-value=17  Score=25.41  Aligned_cols=14  Identities=14%  Similarity=0.155  Sum_probs=10.9

Q ss_pred             EecC-cccCCCEEEc
Q psy12488         47 YIKP-VVNVGDKVLL   60 (91)
Q Consensus        47 ~~p~-~VkvGD~Vlf   60 (91)
                      ..|+ -+|+||.++|
T Consensus        30 ~apl~RmkpGD~ivy   44 (141)
T PRK02268         30 AAPLRRMKPGDWIIY   44 (141)
T ss_pred             cchhhcCCCCCEEEE
Confidence            3444 7899999997


No 150
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=38.52  E-value=37  Score=24.44  Aligned_cols=25  Identities=40%  Similarity=0.538  Sum_probs=19.0

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|.|+++|+...         .+++||+|+..
T Consensus        64 e~~G~v~~~G~~~~---------~~~~Gd~V~~~   88 (336)
T cd08276          64 DGAGEVVAVGEGVT---------RFKVGDRVVPT   88 (336)
T ss_pred             ceeEEEEEeCCCCc---------CCCCCCEEEEe
Confidence            35799999997543         47889999864


No 151
>PF12791 RsgI_N:  Anti-sigma factor N-terminus;  InterPro: IPR024449 The heat shock genes in Bacillus subtilis can be classified into several groups according to their regulation [], and the sigma gene, sigI, of Bacillus subtilis belongs to the group IV heat-shock response genes and has many orthologues in the bacterial phylum Firmicutes []. Regulation of sigma factor I is carried out by RsgI from the same operon. This entry represents the N-terminal cytoplasmic portion of RsgI ('upstream' of the single transmembrane helix) which has been shown to interact directly with Sigma-I [].
Probab=37.36  E-value=34  Score=19.34  Aligned_cols=12  Identities=17%  Similarity=0.393  Sum_probs=9.4

Q ss_pred             cccCCCEEEcCC
Q psy12488         51 VVNVGDKVLLPK   62 (91)
Q Consensus        51 ~VkvGD~Vlf~~   62 (91)
                      .+++||.|.|..
T Consensus        25 ~~~vG~eI~~~~   36 (56)
T PF12791_consen   25 GMEVGQEIEFDE   36 (56)
T ss_pred             CCcccCEEEEec
Confidence            588888888866


No 152
>PF07591 PT-HINT:  Pretoxin HINT domain;  InterPro: IPR011451 This entry represents a cluster of homologous proteins identified in Leptospira interrogans. One member (Q8EZX6 from SWISSPROT) has been predicted to be a phenazine biosynthesis family protein.; PDB: 2JNQ_A 2JMZ_A.
Probab=37.25  E-value=11  Score=25.31  Aligned_cols=19  Identities=32%  Similarity=0.389  Sum_probs=0.0

Q ss_pred             CCCeEecC-cccCCCEEEcCC
Q psy12488         43 PNGEYIKP-VVNVGDKVLLPK   62 (91)
Q Consensus        43 ~~G~~~p~-~VkvGD~Vlf~~   62 (91)
                      .+|. .|. ++++||+|+=.+
T Consensus         5 ~~G~-k~Ie~I~~GD~Vls~d   24 (130)
T PF07591_consen    5 ADGL-KPIEDIKVGDRVLSYD   24 (130)
T ss_dssp             ---------------------
T ss_pred             cccc-cccccccccccccccc
Confidence            4553 455 899999999654


No 153
>cd06819 PLPDE_III_LS_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Low Specificity D-Threonine Aldolase. Low specificity D-threonine aldolase (Low specificity D-TA, EC 4.3.1.18), encoded by dtaAS gene from Arthrobacter sp. strain DK-38, is the prototype of this subfamily. Low specificity D-TAs are fold type III PLP-dependent enzymes that catalyze the interconversion between D-threonine/D-allo-threonine and glycine plus acetaldehyde. Both PLP and divalent cations (eg. Mn2+) are required for catalytic activity. Members of this subfamily show similarity to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on its similarity to AR, it is possible that low specificity D-TAs also form dimers in solution. Experimental data show that t
Probab=37.21  E-value=64  Score=24.46  Aligned_cols=36  Identities=11%  Similarity=0.123  Sum_probs=25.4

Q ss_pred             cccCCCEEEcCC-CCceEEEECCEEEEEEecCcEEEEe
Q psy12488         51 VVNVGDKVLLPK-FGGTKIEVEGQELHLFKEADLLAVI   87 (91)
Q Consensus        51 ~VkvGD~Vlf~~-y~g~ev~~dg~~y~ii~~~DIlavi   87 (91)
                      .+++||+|.|-+ |+...+..= ..|++++.+.|...+
T Consensus       316 ~~~vGd~v~~~p~h~c~t~~~~-~~~~vv~~~~v~~~w  352 (358)
T cd06819         316 PLKIGDRLELVPGHCDPTVNLH-DWYVGVRGGVVEDVW  352 (358)
T ss_pred             CCCCCCEEEEECCCcCcccccc-CEEEEEECCEEEEEE
Confidence            689999999976 666555433 347778877676655


No 154
>cd00165 S4 S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized functional similarity between these three protein classes.
Probab=36.86  E-value=71  Score=17.16  Aligned_cols=28  Identities=21%  Similarity=0.224  Sum_probs=16.7

Q ss_pred             cccCCCEEEcCCCC-ceEEEECCEEEEEE
Q psy12488         51 VVNVGDKVLLPKFG-GTKIEVEGQELHLF   78 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~-g~ev~~dg~~y~ii   78 (91)
                      .++.||+|.+..-. ..+|-++++.++++
T Consensus        41 ~v~~~d~i~i~~~~~~~~i~~ed~~~lvv   69 (70)
T cd00165          41 KVKPGDVIEVDGKSIEEDIVYEDKKLLVV   69 (70)
T ss_pred             CcCCCCEEEEcCCCcccceeeccCCEEEe
Confidence            67788888776421 12555666666554


No 155
>cd04451 S1_IF1 S1_IF1: Translation Initiation Factor IF1, S1-like RNA-binding domain. IF1 contains an S1-like RNA-binding domain, which is found in a wide variety of RNA-associated proteins. Translation initiation includes a number of interrelated steps preceding the formation of the first peptide bond. In Escherichia coli, the initiation mechanism requires, in addition to mRNA, fMet-tRNA, and ribosomal subunits,  the presence of three additional proteins (initiation factors IF1, IF2, and IF3) and at least one GTP molecule. The three initiation factors influence both the kinetics and the stability of ternary complex formation. IF1 is the smallest of the three factors. IF1 enhances the rate of 70S ribosome subunit association and dissociation and the interaction of 30S ribosomal subunit with IF2 and IF3. It stimulates 30S complex formation. In addition, by binding to the A-site of the 30S ribosomal subunit, IF1 may contribute to the fidelity of the selection of the initiation site of th
Probab=36.78  E-value=25  Score=20.48  Aligned_cols=11  Identities=27%  Similarity=0.392  Sum_probs=9.8

Q ss_pred             cccCCCEEEcC
Q psy12488         51 VVNVGDKVLLP   61 (91)
Q Consensus        51 ~VkvGD~Vlf~   61 (91)
                      .+.+||+|.|.
T Consensus        40 ~~~vGD~V~~~   50 (64)
T cd04451          40 RILPGDRVKVE   50 (64)
T ss_pred             ccCCCCEEEEE
Confidence            48999999988


No 156
>PF13375 RnfC_N:  RnfC Barrel sandwich hybrid domain
Probab=36.20  E-value=32  Score=22.38  Aligned_cols=13  Identities=62%  Similarity=0.818  Sum_probs=9.0

Q ss_pred             cCcccCCCEEEcC
Q psy12488         49 KPVVNVGDKVLLP   61 (91)
Q Consensus        49 p~~VkvGD~Vlf~   61 (91)
                      .+.|++||+|.-.
T Consensus        43 ~p~V~~Gd~V~~G   55 (101)
T PF13375_consen   43 EPVVKVGDKVKKG   55 (101)
T ss_pred             eEEEcCCCEEcCC
Confidence            3478888888653


No 157
>COG3264 Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]
Probab=36.15  E-value=47  Score=29.47  Aligned_cols=16  Identities=44%  Similarity=0.630  Sum_probs=14.7

Q ss_pred             cccCCCEEEcCCCCce
Q psy12488         51 VVNVGDKVLLPKFGGT   66 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g~   66 (91)
                      ++|+||+|-+..+.|+
T Consensus       660 pvkvGD~It~g~~~G~  675 (835)
T COG3264         660 PVKVGDTVTIGTVSGT  675 (835)
T ss_pred             CcccCCEEEECCceEE
Confidence            7999999999999973


No 158
>PF12852 Cupin_6:  Cupin
Probab=35.94  E-value=23  Score=24.36  Aligned_cols=32  Identities=31%  Similarity=0.223  Sum_probs=20.9

Q ss_pred             EEEEcCCeeCCCCeEecCcccCCCEEEcCCCC
Q psy12488         33 VVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG   64 (91)
Q Consensus        33 VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~   64 (91)
                      +|.-|.....-+|...|..+..||.|+++.-.
T Consensus        40 ~V~~G~~~l~~~~~~~~~~L~~GDivllp~g~   71 (186)
T PF12852_consen   40 VVLRGSCWLRVPGGGEPIRLEAGDIVLLPRGT   71 (186)
T ss_pred             EEECCeEEEEEcCCCCeEEecCCCEEEEcCCC
Confidence            33444444433443478899999999998754


No 159
>PRK10409 hydrogenase assembly chaperone; Provisional
Probab=34.69  E-value=26  Score=22.70  Aligned_cols=12  Identities=33%  Similarity=0.302  Sum_probs=10.1

Q ss_pred             cccCCCEEEcCC
Q psy12488         51 VVNVGDKVLLPK   62 (91)
Q Consensus        51 ~VkvGD~Vlf~~   62 (91)
                      .+++||+|+..-
T Consensus        41 ~~~vGDyVLVHa   52 (90)
T PRK10409         41 QPRVGQWVLVHV   52 (90)
T ss_pred             ccCCCCEEEEec
Confidence            589999999754


No 160
>PRK10689 transcription-repair coupling factor; Provisional
Probab=34.49  E-value=64  Score=29.41  Aligned_cols=32  Identities=28%  Similarity=0.439  Sum_probs=25.0

Q ss_pred             CcccCCCEEEcCCCC-----c-eEEEECC--EEEEEEecC
Q psy12488         50 PVVNVGDKVLLPKFG-----G-TKIEVEG--QELHLFKEA   81 (91)
Q Consensus        50 ~~VkvGD~Vlf~~y~-----g-~ev~~dg--~~y~ii~~~   81 (91)
                      .++++||.|++.+|+     | ..++++|  .+|+.++..
T Consensus       475 ~~l~~Gd~VVh~~~Gig~~~gi~~~~~~g~~~~~~~l~y~  514 (1147)
T PRK10689        475 AELHPGQPVVHLEHGVGRYAGMTTLEAGGIKGEYLMLTYA  514 (1147)
T ss_pred             hhCCCCCEEEecCCCeEEEeeEEEEecCCcceeEEEEEEC
Confidence            389999999999988     3 3456676  788888754


No 161
>PRK00276 infA translation initiation factor IF-1; Validated
Probab=34.10  E-value=30  Score=20.94  Aligned_cols=14  Identities=29%  Similarity=0.449  Sum_probs=11.2

Q ss_pred             cccCCCEEEcC--CCC
Q psy12488         51 VVNVGDKVLLP--KFG   64 (91)
Q Consensus        51 ~VkvGD~Vlf~--~y~   64 (91)
                      .+.+||.|.|.  .|.
T Consensus        46 ~i~vGD~V~ve~~~~~   61 (72)
T PRK00276         46 RILPGDKVTVELSPYD   61 (72)
T ss_pred             ccCCCCEEEEEEcccC
Confidence            47899999998  553


No 162
>PF09871 DUF2098:  Uncharacterized protein conserved in archaea (DUF2098);  InterPro: IPR019209  This family of proteins have no known function. 
Probab=33.96  E-value=1e+02  Score=19.89  Aligned_cols=34  Identities=29%  Similarity=0.480  Sum_probs=24.4

Q ss_pred             cccCCCEEEcCCCC--c--eEEEE-CCEEEEEEecCcEE
Q psy12488         51 VVNVGDKVLLPKFG--G--TKIEV-EGQELHLFKEADLL   84 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~--g--~ev~~-dg~~y~ii~~~DIl   84 (91)
                      ++++|+.|.|..=+  |  .+++. ||..|.++...+++
T Consensus         2 ~I~vGs~VRY~~TGT~G~V~diK~ed~~~wv~LD~t~L~   40 (91)
T PF09871_consen    2 PIKVGSYVRYINTGTVGKVVDIKEEDGETWVLLDSTDLY   40 (91)
T ss_pred             cceeCCEEEECCCCeEEEEEEEEEeCCCeEEEEccCCce
Confidence            57899999998754  3  35554 57888888666654


No 163
>PF11549 Sec31:  Protein transport protein SEC31;  InterPro: IPR021614  Sec31 is involved in COPII coat formation as it forms through the sequential binding of three cytoplasmic proteins: Sar1, Sec23/24 and Sec13/31. Sec13/31 is recruited by the pre-budding complex and polymerisation of Sec13/31 occurs to form an octahedral cage that is the outer shell of the COPII coat []. Sec13/31 is a hetero-tetramer which is organised as a linear array of alpha-solenoid and beta-propeller domains to form a rod in which twenty-four copies assemble to form the COPII cub-octahedron []. ; PDB: 2QTV_D.
Probab=33.87  E-value=15  Score=21.62  Aligned_cols=19  Identities=32%  Similarity=0.553  Sum_probs=0.8

Q ss_pred             ecCCccccceeEEEEEEcC
Q psy12488         20 IPEKAQQEVNNAVVVAVGP   38 (91)
Q Consensus        20 LP~~~~~k~~~G~VVAVG~   38 (91)
                      ||...++|+..++-|+|.|
T Consensus        29 Lpl~vkEKpsRAKavsvap   47 (51)
T PF11549_consen   29 LPLKVKEKPSRAKAVSVAP   47 (51)
T ss_dssp             --S----------------
T ss_pred             cchhhhccccccccccccc
Confidence            6777889999999999987


No 164
>cd05288 PGDH Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino 
Probab=33.58  E-value=47  Score=24.05  Aligned_cols=23  Identities=26%  Similarity=0.014  Sum_probs=17.9

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|++           .+++||+|+..
T Consensus        71 e~~G~V~~~G~~-----------~~~~Gd~V~~~   93 (329)
T cd05288          71 GGVGEVVESRSP-----------DFKVGDLVSGF   93 (329)
T ss_pred             ceEEEEEecCCC-----------CCCCCCEEecc
Confidence            357999999852           48999999864


No 165
>PF01878 EVE:  EVE domain;  InterPro: IPR002740 The EVE domain is part of the wider PUA domain superfamily. The function of this domain is not known but, given the structural similarities to PUA, is likely to involve RNA binding []. ; PDB: 2G2X_B 2AR1_A 3EOP_A 2EVE_A 2HD9_A 2ZBN_A 1WMM_A 2P5D_A 2GBS_A 1ZCE_A.
Probab=33.58  E-value=22  Score=23.65  Aligned_cols=12  Identities=33%  Similarity=0.523  Sum_probs=7.4

Q ss_pred             cccCCCEEEcCC
Q psy12488         51 VVNVGDKVLLPK   62 (91)
Q Consensus        51 ~VkvGD~Vlf~~   62 (91)
                      .+|+||.|+|=.
T Consensus        39 ~mk~GD~vifY~   50 (143)
T PF01878_consen   39 RMKPGDKVIFYH   50 (143)
T ss_dssp             C--TT-EEEEEE
T ss_pred             cCCCCCEEEEEE
Confidence            799999999933


No 166
>KOG3309|consensus
Probab=33.25  E-value=11  Score=26.98  Aligned_cols=22  Identities=41%  Similarity=0.489  Sum_probs=18.9

Q ss_pred             eCCCCeEecCcccCCCEEEcCC
Q psy12488         41 RTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        41 ~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      .+.+|..++...++||.||+--
T Consensus        49 v~~dG~~~~i~g~vGdtlLd~a   70 (159)
T KOG3309|consen   49 VDPDGEEIKIKGKVGDTLLDAA   70 (159)
T ss_pred             ECCCCCEEEeeeecchHHHHHH
Confidence            4579999999999999999743


No 167
>PF13403 Hint_2:  Hint domain
Probab=33.22  E-value=1e+02  Score=21.08  Aligned_cols=38  Identities=24%  Similarity=0.223  Sum_probs=25.5

Q ss_pred             CCeeCCCCeEecCcccCCCEEEcCCCCceEEEECCEEE
Q psy12488         38 PGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQEL   75 (91)
Q Consensus        38 ~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg~~y   75 (91)
                      +-..+.+|.+.--.+++||+|+=.+-.-++|+.=+...
T Consensus         7 T~I~T~~G~~~Ve~L~~GD~V~T~dgg~~~V~wig~~~   44 (147)
T PF13403_consen    7 TLIETPDGPRPVEDLRPGDRVLTRDGGFQPVRWIGRRT   44 (147)
T ss_pred             CEEecCCcCeEeeccCCCCEEEecCCCEEEEEEEEEEE
Confidence            33445566444448999999998877767776655443


No 168
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family, including threonine dehydrogenase. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reducta
Probab=33.08  E-value=55  Score=23.75  Aligned_cols=21  Identities=19%  Similarity=0.036  Sum_probs=16.1

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      ...|+|+++|++            .++||+|+.
T Consensus        57 e~~G~Vv~~G~~------------~~~G~~V~~   77 (319)
T cd08242          57 EFVGIVEEGPEA------------ELVGKRVVG   77 (319)
T ss_pred             eEEEEEEEeCCC------------CCCCCeEEE
Confidence            357999999974            358888863


No 169
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=33.07  E-value=55  Score=23.26  Aligned_cols=23  Identities=13%  Similarity=0.029  Sum_probs=17.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+++|.  .         .+++||+|+..
T Consensus        63 e~~G~v~~vG~--~---------~~~~Gd~V~~~   85 (320)
T cd08243          63 EAVGEVEEAPG--G---------TFTPGQRVATA   85 (320)
T ss_pred             eeEEEEEEecC--C---------CCCCCCEEEEe
Confidence            35799999994  1         48999999854


No 170
>PRK05585 yajC preprotein translocase subunit YajC; Validated
Probab=33.02  E-value=1.1e+02  Score=20.05  Aligned_cols=22  Identities=23%  Similarity=0.276  Sum_probs=14.2

Q ss_pred             cccCCCEEEcCC-CCceEEEECC
Q psy12488         51 VVNVGDKVLLPK-FGGTKIEVEG   72 (91)
Q Consensus        51 ~VkvGD~Vlf~~-y~g~ev~~dg   72 (91)
                      .+++||+|+... .-|+=+.+++
T Consensus        52 ~Lk~Gd~VvT~gGi~G~Vv~i~~   74 (106)
T PRK05585         52 SLAKGDEVVTNGGIIGKVTKVSE   74 (106)
T ss_pred             hcCCCCEEEECCCeEEEEEEEeC
Confidence            677888886644 5566566655


No 171
>PF06560 GPI:  Glucose-6-phosphate isomerase (GPI);  InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5.3.1.9 from EC), which are involved in glycolysis and in gluconeogenesis and catalyse the conversion of D-glucose 6-phosphate to D-fructose 6-phosphate. The deduced amino acid sequence of the first archaeal PGI isolated from Pyrococcus furiosus revealed that it is not related to its eukaryotic and many of its bacterial counterparts. In contrast, this archaeal PGI shares similarity with the cupin superfamily that consists of a variety of proteins that are generally involved in sugar metabolism in both prokaryotes and eukaryotes [].; GO: 0004347 glucose-6-phosphate isomerase activity, 0006094 gluconeogenesis, 0006096 glycolysis, 0005737 cytoplasm; PDB: 1J3Q_B 1J3R_B 1J3P_A 2GC0_A 1X8E_A 1X82_A 1QY4_B 2GC2_B 1QXJ_A 1QXR_B ....
Probab=32.97  E-value=44  Score=24.17  Aligned_cols=32  Identities=22%  Similarity=0.386  Sum_probs=18.7

Q ss_pred             eEecCcccCCCEEEcCC-CCceEEEECCEEEEE
Q psy12488         46 EYIKPVVNVGDKVLLPK-FGGTKIEVEGQELHL   77 (91)
Q Consensus        46 ~~~p~~VkvGD~Vlf~~-y~g~ev~~dg~~y~i   77 (91)
                      +..-..+++||.|++++ |+=..|..+++.+.+
T Consensus       108 ~~~~v~~~~G~~v~IPp~yaH~tIN~g~~~L~~  140 (182)
T PF06560_consen  108 DVIAVEAKPGDVVYIPPGYAHRTINTGDEPLVF  140 (182)
T ss_dssp             -EEEEEE-TTEEEEE-TT-EEEEEE-SSS-EEE
T ss_pred             eEEEEEeCCCCEEEECCCceEEEEECCCCcEEE
Confidence            45556888999999988 444677777666554


No 172
>TIGR03635 S17_bact 30S ribosomal protein S17. This model describes the bacterial ribosomal small subunit protein S17, while excluding cytosolic eukaryotic homologs and archaeal homologs. The model finds many, but not, chloroplast and mitochondrial counterparts to bacterial S17.
Probab=32.79  E-value=26  Score=21.54  Aligned_cols=13  Identities=31%  Similarity=0.350  Sum_probs=10.9

Q ss_pred             CcccCCCEEEcCC
Q psy12488         50 PVVNVGDKVLLPK   62 (91)
Q Consensus        50 ~~VkvGD~Vlf~~   62 (91)
                      ..+++||+|.+.+
T Consensus        47 ~~~k~GD~V~I~e   59 (71)
T TIGR03635        47 NECKVGDVVRIIE   59 (71)
T ss_pred             CCCCCCCEEEEEE
Confidence            3799999999865


No 173
>TIGR00523 eIF-1A eukaryotic/archaeal initiation factor 1A. Recommended nomenclature: eIF-1A for eukaryotes, aIF-1A for Archaea. Also called eIF-4C
Probab=32.61  E-value=22  Score=23.26  Aligned_cols=17  Identities=18%  Similarity=0.204  Sum_probs=13.8

Q ss_pred             CcccCCCEEEcCCCCce
Q psy12488         50 PVVNVGDKVLLPKFGGT   66 (91)
Q Consensus        50 ~~VkvGD~Vlf~~y~g~   66 (91)
                      +-++.||.|+.++|..+
T Consensus        56 iwI~~GD~VlVsp~d~~   72 (99)
T TIGR00523        56 IWIREGDVVIVKPWEFQ   72 (99)
T ss_pred             EEecCCCEEEEEEccCC
Confidence            35899999999877654


No 174
>cd08241 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic
Probab=32.54  E-value=60  Score=22.84  Aligned_cols=25  Identities=40%  Similarity=0.482  Sum_probs=19.1

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      ...|+|+.+|++..         ..++||+|+--
T Consensus        64 e~~G~v~~~g~~~~---------~~~~G~~V~~~   88 (323)
T cd08241          64 EVAGVVEAVGEGVT---------GFKVGDRVVAL   88 (323)
T ss_pred             eeEEEEEEeCCCCC---------CCCCCCEEEEe
Confidence            35799999997543         47889999864


No 175
>PF02699 YajC:  Preprotein translocase subunit;  InterPro: IPR003849 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins []. The translocase protein subunits are encoded on the bacterial chromosome.  The translocase itself comprises 7 proteins, including a chaperone (SecB), ATPase (SecA), an integral membrane complex (SecY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. Other cytoplasmic/periplasmic proteins play a part in preprotein translocase activity, namely YidC and YajC []. The latter is bound in a complex to SecD and SecF, and plays a part in stabilising and regulating secretion through the SecYEG integral membrane component via SecA [].  Homologues of the YajC gene have been found in a range of pathogenic and commensal microbes. Brucella abortis YajC- and SecD-like proteins were shown to stimulate a Th1 cell-mediated immune response in mice, and conferred protection when challenged with B.abortis []. Therefore, these proteins may have an antigenic role as well as a secretory one in virulent bacteria []. A number of previously uncharacterised "hypothetical" proteins also show similarity to E.coli YajC, suggesting that this family is wider than first thought [].  More recently, the precise interactions between the E.coli SecYEG complex, SecD, SecF, YajC and YidC have been studied []. Rather than acting individually, the four proteins form a heterotetrameric complex and associate with the SecYEG heterotrimeric complex []. The SecF and YajC subunits link the complex to the integral membrane translocase. ; PDB: 2RDD_B.
Probab=32.51  E-value=15  Score=22.98  Aligned_cols=23  Identities=26%  Similarity=0.442  Sum_probs=0.0

Q ss_pred             cccCCCEEEcCC-CCceEEEECCE
Q psy12488         51 VVNVGDKVLLPK-FGGTKIEVEGQ   73 (91)
Q Consensus        51 ~VkvGD~Vlf~~-y~g~ev~~dg~   73 (91)
                      .+++||+|+... .-|+=++++++
T Consensus        36 ~Lk~Gd~VvT~gGi~G~V~~i~~~   59 (82)
T PF02699_consen   36 SLKPGDEVVTIGGIYGTVVEIDDD   59 (82)
T ss_dssp             ------------------------
T ss_pred             cCCCCCEEEECCcEEEEEEEEeCC
Confidence            688888888765 66665666433


No 176
>PF03829 PTSIIA_gutA:  PTS system glucitol/sorbitol-specific IIA component;  InterPro: IPR004716 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC []. These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).  The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site.  An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose [, , , ].  The Man family is unique in several respects among PTS permease families:   It is the only PTS family in which members possess a IID protein.  It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue.  Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars.   This family consists only of glucitol-specific transporters, and occur both in Gram-negative and Gram-positive bacteria. The system in Escherichia coli consists of a IIA protein, and a IIBC protein. This family is specific for the IIA component.; GO: 0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system, 0005737 cytoplasm; PDB: 2F9H_A.
Probab=32.49  E-value=1.6e+02  Score=19.74  Aligned_cols=13  Identities=23%  Similarity=0.432  Sum_probs=7.3

Q ss_pred             eeEEEEEEcCCee
Q psy12488         29 NNAVVVAVGPGAR   41 (91)
Q Consensus        29 ~~G~VVAVG~G~~   41 (91)
                      .+.+|.++|+-..
T Consensus         5 y~~~I~~IG~~a~   17 (117)
T PF03829_consen    5 YETTITAIGEEAE   17 (117)
T ss_dssp             EEEEEEEE-TTT-
T ss_pred             EEEEEEEhhhhHH
Confidence            4567777777554


No 177
>PRK11165 diaminopimelate decarboxylase; Provisional
Probab=32.44  E-value=79  Score=25.02  Aligned_cols=12  Identities=33%  Similarity=0.562  Sum_probs=11.1

Q ss_pred             cccCCCEEEcCC
Q psy12488         51 VVNVGDKVLLPK   62 (91)
Q Consensus        51 ~VkvGD~Vlf~~   62 (91)
                      .+++||.|+|..
T Consensus       363 ~l~~GD~l~i~~  374 (420)
T PRK11165        363 QVQVGDYLVFHD  374 (420)
T ss_pred             CCCCCCEEEEec
Confidence            899999999976


No 178
>PF09285 Elong-fact-P_C:  Elongation factor P, C-terminal;  InterPro: IPR015365 These nucleic acid binding domains are predominantly found in elongation factor P, where they adopt an OB-fold, with five beta-strands forming a beta-barrel in a Greek-key topology []. ; GO: 0043043 peptide biosynthetic process, 0005737 cytoplasm; PDB: 1YBY_A 3OYY_B 1UEB_B 3HUW_V 3HUY_V 3A5Z_H.
Probab=32.37  E-value=41  Score=19.90  Aligned_cols=19  Identities=21%  Similarity=0.368  Sum_probs=11.7

Q ss_pred             EecCcccCCCEEEcCCCCc
Q psy12488         47 YIKPVVNVGDKVLLPKFGG   65 (91)
Q Consensus        47 ~~p~~VkvGD~Vlf~~y~g   65 (91)
                      .+|+-++.||+|.++--.|
T Consensus        33 ~VP~FI~~Gd~I~VdT~~g   51 (56)
T PF09285_consen   33 QVPLFIEEGDKIKVDTRDG   51 (56)
T ss_dssp             EEETT--TT-EEEEETTTT
T ss_pred             EccceecCCCEEEEECCCC
Confidence            4778899999988766544


No 179
>CHL00010 infA translation initiation factor 1
Probab=31.90  E-value=79  Score=19.46  Aligned_cols=15  Identities=20%  Similarity=0.333  Sum_probs=11.5

Q ss_pred             CcccCCCEEEcC--CCC
Q psy12488         50 PVVNVGDKVLLP--KFG   64 (91)
Q Consensus        50 ~~VkvGD~Vlf~--~y~   64 (91)
                      ..+.+||.|.|.  .+.
T Consensus        45 i~~~vGD~V~ve~~~~~   61 (78)
T CHL00010         45 IRILPGDRVKVELSPYD   61 (78)
T ss_pred             cccCCCCEEEEEEcccC
Confidence            357889999998  554


No 180
>TIGR00580 mfd transcription-repair coupling factor (mfd). All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transacribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). This family is closely related to the RecG and UvrB families.
Probab=31.76  E-value=75  Score=28.30  Aligned_cols=32  Identities=31%  Similarity=0.495  Sum_probs=24.6

Q ss_pred             CcccCCCEEEcCCCC-----c-eEEEECC--EEEEEEecC
Q psy12488         50 PVVNVGDKVLLPKFG-----G-TKIEVEG--QELHLFKEA   81 (91)
Q Consensus        50 ~~VkvGD~Vlf~~y~-----g-~ev~~dg--~~y~ii~~~   81 (91)
                      .++++||.|++.+|+     | ..++++|  .+|+.++..
T Consensus       326 ~~l~~Gd~VVh~~~Gig~~~gi~~~~~~g~~~dy~~l~y~  365 (926)
T TIGR00580       326 NELNPGDYVVHLDHGIGRFLGLETLEVGGIERDYLVLEYA  365 (926)
T ss_pred             hhCCCCCEEEecCCCeEEEeeEEEEecCCcceeEEEEEEC
Confidence            489999999999988     3 3456666  688887754


No 181
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase. Leukotriene B4 12-hydroxydehydrogenase is an NADP-dependent enzyme of arachidonic acid metabolism, responsible for converting leukotriene B4 to the much less active metabolite 12-oxo-leukotriene B4. The BRENDA database lists leukotriene B4 12-hydroxydehydrogenase as one of the synonyms of 2-alkenal reductase (EC 1.3.1.74), while 1.3.1.48 is 15-oxoprostaglandin 13-reductase.
Probab=31.62  E-value=45  Score=24.46  Aligned_cols=21  Identities=24%  Similarity=0.134  Sum_probs=16.5

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEc
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLL   60 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf   60 (91)
                      -..|+|+++|+            .+++||+|+.
T Consensus        64 ~~~g~v~~~~~------------~~~~GdrV~~   84 (325)
T TIGR02825        64 QVARVVESKNV------------ALPKGTIVLA   84 (325)
T ss_pred             eEEEEEEeCCC------------CCCCCCEEEE
Confidence            46788888763            4789999986


No 182
>COG0309 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=31.32  E-value=42  Score=26.73  Aligned_cols=31  Identities=19%  Similarity=0.108  Sum_probs=20.9

Q ss_pred             EcCCeeCCCCeEecCcccCCCEEEcCCCCce
Q psy12488         36 VGPGARTPNGEYIKPVVNVGDKVLLPKFGGT   66 (91)
Q Consensus        36 VG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~   66 (91)
                      .|-|.........|..+|+||.|+..+-.|.
T Consensus       145 t~iG~~~~~~~v~~~~~~~GD~vI~tg~~g~  175 (339)
T COG0309         145 TGIGIIDKEILVSPSGARPGDAVIVTGTIGI  175 (339)
T ss_pred             eeEEeecCCcccccCCCCCCCEEEEcCChhH
Confidence            3334443344466678999999999887653


No 183
>PRK06763 F0F1 ATP synthase subunit alpha; Validated
Probab=30.94  E-value=64  Score=24.14  Aligned_cols=35  Identities=26%  Similarity=0.160  Sum_probs=23.2

Q ss_pred             cceeEEEEEEcCCeeC-----CCC-----eEecCcccCCCEEEcC
Q psy12488         27 EVNNAVVVAVGPGART-----PNG-----EYIKPVVNVGDKVLLP   61 (91)
Q Consensus        27 k~~~G~VVAVG~G~~~-----~~G-----~~~p~~VkvGD~Vlf~   61 (91)
                      -...|+||.|..+...     -+.     .--+..||+||.|...
T Consensus        40 ~tiEGrVvEV~~~~i~iesk~yn~~v~i~~d~~~nvKVGD~VKaT   84 (213)
T PRK06763         40 STIEGRVVEVDNGVIVIKSKQYEEPVSVYIDSLSNVKVGDEVKAT   84 (213)
T ss_pred             ceeeeEEEEEeCCEEEEEeccCCCceEEEecCCCCcccCcEEEEc
Confidence            3789999999988422     000     0123478999999754


No 184
>cd06820 PLPDE_III_LS_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Low Specificity D-Threonine Aldolase-like. This subfamily is composed of uncharacterized bacterial proteins with similarity to low specificity D-threonine aldolase (D-TA), which is a fold type III PLP-dependent enzyme that catalyzes the interconversion between D-threonine/D-allo-threonine and glycine plus acetaldehyde. Both PLP and divalent cations (eg. Mn2+) are required for catalytic activity. Low specificity D-TAs show similarity to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on its similarity to AR, it is possible that low specificity D-TAs also form dimers in solution. Experimental data show that the monomeric form of low specificity D-TAs exh
Probab=30.93  E-value=90  Score=23.66  Aligned_cols=37  Identities=16%  Similarity=0.284  Sum_probs=25.9

Q ss_pred             cccCCCEEEcCC-CCceEEEECCEEEEEEecCcEEEEee
Q psy12488         51 VVNVGDKVLLPK-FGGTKIEVEGQELHLFKEADLLAVIE   88 (91)
Q Consensus        51 ~VkvGD~Vlf~~-y~g~ev~~dg~~y~ii~~~DIlavi~   88 (91)
                      .+++||+|.|-+ |+...+..= ..|++++.+.|..++.
T Consensus       311 ~~~vGd~i~~~p~h~c~t~~~~-~~~~~~~~~~v~~~w~  348 (353)
T cd06820         311 LPRVGDRVRVVPNHACVVVNLV-DEVYLVDGGEVVETWP  348 (353)
T ss_pred             CCCCCCEEEEECCCcCcchhcC-CEEEEEECCEEEEEEE
Confidence            589999999977 655555443 3577888877766553


No 185
>COG4506 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.87  E-value=47  Score=23.41  Aligned_cols=22  Identities=23%  Similarity=0.468  Sum_probs=19.0

Q ss_pred             eEEEECCEEEEEEecCcEEEEe
Q psy12488         66 TKIEVEGQELHLFKEADLLAVI   87 (91)
Q Consensus        66 ~ev~~dg~~y~ii~~~DIlavi   87 (91)
                      +.+++++.++++||.-|+....
T Consensus        56 TtlKi~d~e~~liR~G~v~M~~   77 (143)
T COG4506          56 TTLKIDDDELLLIRSGDVNMRM   77 (143)
T ss_pred             EEEEEcCCEEEEEEcccchhhh
Confidence            6789999999999999997644


No 186
>COG1465 Predicted alternative 3-dehydroquinate synthase [Amino acid transport and metabolism]
Probab=30.70  E-value=1.5e+02  Score=23.83  Aligned_cols=34  Identities=26%  Similarity=0.527  Sum_probs=24.1

Q ss_pred             EecCcccCCCEEEcCCCCce-------EEEECCEEEEEEec
Q psy12488         47 YIKPVVNVGDKVLLPKFGGT-------KIEVEGQELHLFKE   80 (91)
Q Consensus        47 ~~p~~VkvGD~Vlf~~y~g~-------ev~~dg~~y~ii~~   80 (91)
                      +--..++.||.|+.-+|.|.       -++++-.-.++++.
T Consensus       276 kYLaEL~aGDeV~iVD~dGr~R~aiVGRvKIErRPl~lIeA  316 (376)
T COG1465         276 KYLAELKAGDEVLIVDFDGRTRSAIVGRVKIERRPLMLIEA  316 (376)
T ss_pred             EEhhhhcCCCeEEEEecCCceeEEEEEEEEeecCceEEEEE
Confidence            33448999999999998873       25666666666653


No 187
>PF07378 FlbT:  Flagellar protein FlbT;  InterPro: IPR009967 This family consists of several FlbT proteins. FlbT is a post-transcriptional repressor function in flagellum biogenesis. FlbT is associated with the 5' untranslated region (UTR) of fljK (25 kDa flagellin) mRNA and that this association requires a predicted loop structure in the transcript. Mutations within this loop abolish FlbT association and result in increased mRNA stability. It is therefore thought that FlbT promotes the degradation of flagellin mRNA by associating with the 5' UTR [].; GO: 0048027 mRNA 5'-UTR binding, 0006402 mRNA catabolic process, 0045718 negative regulation of flagellum assembly
Probab=30.30  E-value=43  Score=22.80  Aligned_cols=34  Identities=18%  Similarity=0.462  Sum_probs=23.0

Q ss_pred             CcccCCCEEEcCCC------CceEEEECCEEEEEEecCcEE
Q psy12488         50 PVVNVGDKVLLPKF------GGTKIEVEGQELHLFKEADLL   84 (91)
Q Consensus        50 ~~VkvGD~Vlf~~y------~g~ev~~dg~~y~ii~~~DIl   84 (91)
                      ..+|+|.+++.+.-      ..+.+.+.+. -.|+|++|||
T Consensus         3 l~LkpgERi~INGAVi~N~drr~~l~i~n~-a~~Lre~dil   42 (126)
T PF07378_consen    3 LSLKPGERIIINGAVIRNGDRRSTLEIEND-APFLREKDIL   42 (126)
T ss_pred             eeecCCCEEEEcCeEEEeCCCceEEEEecC-CceechhccC
Confidence            36788888888651      1245556555 6778888886


No 188
>PF15057 DUF4537:  Domain of unknown function (DUF4537)
Probab=30.09  E-value=49  Score=22.14  Aligned_cols=14  Identities=50%  Similarity=0.745  Sum_probs=11.7

Q ss_pred             cCcccCCCEEEcCC
Q psy12488         49 KPVVNVGDKVLLPK   62 (91)
Q Consensus        49 p~~VkvGD~Vlf~~   62 (91)
                      ...+++||.||-+.
T Consensus        53 ~~~L~~GD~VLA~~   66 (124)
T PF15057_consen   53 RHSLQVGDKVLAPW   66 (124)
T ss_pred             cCcCCCCCEEEEec
Confidence            45899999999863


No 189
>PF02643 DUF192:  Uncharacterized ACR, COG1430;  InterPro: IPR003795 This entry describes proteins of unknown function.; PDB: 3M7A_B 3PJY_B.
Probab=30.06  E-value=17  Score=23.58  Aligned_cols=25  Identities=28%  Similarity=0.349  Sum_probs=13.4

Q ss_pred             EEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         32 VVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        32 ~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      -|+++.+|...      ...+++||+|.|.+
T Consensus        84 ~vLE~~aG~~~------~~~i~~Gd~v~~~~  108 (108)
T PF02643_consen   84 YVLELPAGWFE------KLGIKVGDRVRIEP  108 (108)
T ss_dssp             EEEEEETTHHH------HHT--TT-EEE---
T ss_pred             EEEEcCCCchh------hcCCCCCCEEEecC
Confidence            37888877642      33699999998763


No 190
>cd06812 PLPDE_III_DSD_D-TA_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 1. This subfamily is composed of uncharacterized bacterial proteins with similarity to eukaryotic D-serine dehydratases (DSD) and D-threonine aldolases (D-TA). DSD catalyzes the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. D-TA reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. DSD and D-TA are fold type III PLP-dependent enzymes, similar to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on their similarity to AR, it is possible mem
Probab=29.91  E-value=92  Score=23.81  Aligned_cols=36  Identities=8%  Similarity=0.207  Sum_probs=25.1

Q ss_pred             cccCCCEEEcCC-CCceEEEECCEEEEEEecCcEE-EEe
Q psy12488         51 VVNVGDKVLLPK-FGGTKIEVEGQELHLFKEADLL-AVI   87 (91)
Q Consensus        51 ~VkvGD~Vlf~~-y~g~ev~~dg~~y~ii~~~DIl-avi   87 (91)
                      .+++||+|.|-+ |+..-+..- ..|++++.+.+. .++
T Consensus       331 ~~~vGd~v~~~p~H~c~t~~~~-~~~~~v~~~~~~~~~w  368 (374)
T cd06812         331 DLPIGTRLRILPNHACATAAQH-DHYHVLDGEGVVQATW  368 (374)
T ss_pred             CCCCCCEEEEeCCccCcchhcC-CEEEEEeCCCEEEEEe
Confidence            689999998866 665555443 457778877666 554


No 191
>PF03293 Pox_RNA_pol:  Poxvirus DNA-directed RNA polymerase, 18 kD subunit;  InterPro: IPR004973 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. The Poxvirus DNA-directed RNA polymerase (2.7.7.6 from EC) catalyses DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. The enzyme consists of at least eight subunits, this is the 18 kDa subunit.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0019083 viral transcription
Probab=29.90  E-value=1.2e+02  Score=21.67  Aligned_cols=34  Identities=9%  Similarity=0.173  Sum_probs=20.1

Q ss_pred             cccCCCEEEcCCCCceEEEECCEEEEEEecCcEE
Q psy12488         51 VVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLL   84 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~DIl   84 (91)
                      .|.=||.|---.-..-.|.|++-+|.|+|..-+.
T Consensus        98 ~V~CgDLiCkl~rdsGtVSf~dsKYCfirNg~vY  131 (160)
T PF03293_consen   98 TVQCGDLICKLSRDSGTVSFNDSKYCFIRNGVVY  131 (160)
T ss_pred             EEEcCcEEEEeeccCCeEEecCceEEEEECCEEe
Confidence            3444555433222234578888999999875443


No 192
>PRK06531 yajC preprotein translocase subunit YajC; Validated
Probab=29.81  E-value=1.2e+02  Score=20.27  Aligned_cols=33  Identities=21%  Similarity=0.290  Sum_probs=18.0

Q ss_pred             cccCCCEEEcCC-CCceEEEECCE-EEEEEecCcE
Q psy12488         51 VVNVGDKVLLPK-FGGTKIEVEGQ-ELHLFKEADL   83 (91)
Q Consensus        51 ~VkvGD~Vlf~~-y~g~ev~~dg~-~y~ii~~~DI   83 (91)
                      .+++||.|+-.. .-|+=+.++++ .++.+..+.+
T Consensus        36 sLk~GD~VvT~GGi~G~V~~I~~~~~~v~le~~gv   70 (113)
T PRK06531         36 AIQKGDEVVTIGGLYGTVDEVDTEAKTIVLDVDGV   70 (113)
T ss_pred             hcCCCCEEEECCCcEEEEEEEecCCCEEEEEECCE
Confidence            578888887543 55554555442 3444443333


No 193
>PF13856 Gifsy-2:  ATP-binding sugar transporter from pro-phage; PDB: 2PP6_A.
Probab=29.63  E-value=82  Score=19.75  Aligned_cols=30  Identities=13%  Similarity=0.145  Sum_probs=16.4

Q ss_pred             CcccCCCEEEcCCCCceEEEECCEEEEEEecC
Q psy12488         50 PVVNVGDKVLLPKFGGTKIEVEGQELHLFKEA   81 (91)
Q Consensus        50 ~~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~   81 (91)
                      +.|+..|.--  +--|..|.+||+.|++-+..
T Consensus        56 L~v~~~d~~~--P~~gd~v~~dG~~y~V~~~~   85 (95)
T PF13856_consen   56 LYVFSSDYPK--PRRGDRVVIDGESYTVTRFQ   85 (95)
T ss_dssp             EEE--SS-------TT-EEEETTEEEEEEEEE
T ss_pred             EEEEcCCCCC--CCCCCEEEECCeEEEEeEEe
Confidence            4566666322  45578889999999987644


No 194
>PF13464 DUF4115:  Domain of unknown function (DUF4115)
Probab=29.63  E-value=1.2e+02  Score=18.05  Aligned_cols=24  Identities=17%  Similarity=0.344  Sum_probs=16.0

Q ss_pred             CCCEEEcCCCCceEEEECCEEEEE
Q psy12488         54 VGDKVLLPKFGGTKIEVEGQELHL   77 (91)
Q Consensus        54 vGD~Vlf~~y~g~ev~~dg~~y~i   77 (91)
                      ..=+|.+..-++.++++||+.+=+
T Consensus        38 ~~~~i~iGna~~v~v~~nG~~~~~   61 (77)
T PF13464_consen   38 EPFRIRIGNAGAVEVTVNGKPVDL   61 (77)
T ss_pred             CCEEEEEeCCCcEEEEECCEECCC
Confidence            333444455567889999988765


No 195
>TIGR03102 halo_cynanin halocyanin domain. Halocyanins are blue (type I) copper redox proteins found in halophilic archaea such as Natronobacterium pharaonis. This model represents a domain duplicated in some halocyanins, while appearing once in others. This domain includes the characteristic copper ligand residues. This family does not include plastocyanins, and does not include certain divergent paralogs of halocyanin.
Probab=29.61  E-value=88  Score=20.80  Aligned_cols=32  Identities=28%  Similarity=0.358  Sum_probs=20.6

Q ss_pred             eEEEEEEcCCeeCCCCeEecC--cccCCCEEEcC
Q psy12488         30 NAVVVAVGPGARTPNGEYIKP--VVNVGDKVLLP   61 (91)
Q Consensus        30 ~G~VVAVG~G~~~~~G~~~p~--~VkvGD~Vlf~   61 (91)
                      ...-|.+|+.-...+=.+.|.  .|++||+|.|.
T Consensus        22 ~~~~v~~G~~~~~g~~~F~P~~ltV~~GdTVtw~   55 (115)
T TIGR03102        22 DEVTVDVGAEANGGGFAFDPPAIRVDPGTTVVWE   55 (115)
T ss_pred             ceEEEEecccCCCCceeEeCCEEEECCCCEEEEE
Confidence            345688886332111145665  79999999996


No 196
>PF11901 DUF3421:  Protein of unknown function (DUF3421);  InterPro: IPR024518 This domain of unknown function is found in the fish toxin Natterin [] and in uncharacterised proteins.
Probab=29.48  E-value=42  Score=22.21  Aligned_cols=49  Identities=24%  Similarity=0.373  Sum_probs=35.1

Q ss_pred             ecCCccc--cceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEE
Q psy12488         20 IPEKAQQ--EVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEV   70 (91)
Q Consensus        20 LP~~~~~--k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~   70 (91)
                      +|..|-.  ....|+.+-||-...  +|..+|-.|.++..+.|=+|.|.|+.+
T Consensus        68 iP~~av~~G~~~~Ge~lyIgR~~~--~g~~~~GKv~~s~~~~~ip~gG~E~~~  118 (119)
T PF11901_consen   68 IPPNAVVGGRTEDGEPLYIGRAHY--NGSLIPGKVHPSHKCCYIPYGGKEISF  118 (119)
T ss_pred             cCCCcEEcccccCCCEEEEEEEEE--CCeeEEEEEEcCCCEEEEEECCEEEEc
Confidence            4544432  345577777776654  577788888888999999999888765


No 197
>PF06236 MelC1:  Tyrosinase co-factor MelC1;  InterPro: IPR010928 This family consists of several tyrosinase co-factor MELC1 proteins from a number of Streptomyces species. The melanin operon (melC) of Streptomyces antibioticus contains two genes, melC1 and melC2 (apotyrosinase). It is thought that MelC1 forms a transient binary complex with the downstream apotyrosinase MelC2 to facilitate the incorporation of copper ion and the secretion of tyrosinase indicating that MelC1 is a chaperone for the apotyrosinase MelC2 [].; GO: 0005507 copper ion binding, 0042438 melanin biosynthetic process; PDB: 1WX4_B 2ZWD_B 2ZMZ_B 1WX2_B 1WX5_D 3AWX_B 3AWS_B 2ZMY_B 3AX0_B 2ZWG_B ....
Probab=29.33  E-value=75  Score=21.91  Aligned_cols=18  Identities=33%  Similarity=0.850  Sum_probs=14.0

Q ss_pred             ceEEEECCEEEEEEecCc
Q psy12488         65 GTKIEVEGQELHLFKEAD   82 (91)
Q Consensus        65 g~ev~~dg~~y~ii~~~D   82 (91)
                      +.+|.+||.++.+||..|
T Consensus        70 ~~~V~IDGr~LhvMr~AD   87 (125)
T PF06236_consen   70 GYEVTIDGRPLHVMRRAD   87 (125)
T ss_dssp             SEEEEETTEEE-EEE-TT
T ss_pred             ceEEEECCeEeeeEEcCC
Confidence            468999999999999876


No 198
>cd05829 Sortase_E Sortase E (SrtE) is a membrane transpeptidase found in gram-positive bacteria that cleaves surface proteins at a cell sorting motif and catalyzes a transpeptidation reaction in which the surface protein substrate is covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. The function of Sortase E is unknown. In two different sortase families, the N-terminus either functions as both a signal peptide for secretion and a stop-transfer signal for membrane anchoring, or it contains a signal peptide only and the C-terminus serves as a membrane anchor. Most gram-positive bacteria contain more than one sortase and it is thought that the different sortases anchor different surface protein classes. The sortase domain is a modified beta-barrel flanked by two (SrtA) or three (SrtB) short alpha-helices.
Probab=29.31  E-value=67  Score=21.73  Aligned_cols=41  Identities=17%  Similarity=0.235  Sum_probs=23.7

Q ss_pred             eEEEEEEcCCeeC-CCCeEecC-cccCCCEEEcCCCCceEEEE
Q psy12488         30 NAVVVAVGPGART-PNGEYIKP-VVNVGDKVLLPKFGGTKIEV   70 (91)
Q Consensus        30 ~G~VVAVG~G~~~-~~G~~~p~-~VkvGD~Vlf~~y~g~ev~~   70 (91)
                      .|.++=.|.-... ..+-+..+ .+++||.|.+..-.|....|
T Consensus        49 ~Gn~viaGH~~~~g~~~~F~~L~~l~~GD~I~v~~~~g~~~~Y   91 (144)
T cd05829          49 KGTAVLAGHVDSRGGPAVFFRLGDLRKGDKVEVTRADGQTATF   91 (144)
T ss_pred             CCCEEEEEecCCCCCChhhcchhcCCCCCEEEEEECCCCEEEE
Confidence            4666666652211 11223333 89999999998855544433


No 199
>smart00306 HintN Hint (Hedgehog/Intein) domain N-terminal region. Hedgehog/Intein domain, N-terminal region. Domain has been split to accommodate large insertions of endonucleases.
Probab=29.05  E-value=49  Score=19.75  Aligned_cols=22  Identities=36%  Similarity=0.330  Sum_probs=14.5

Q ss_pred             CCCCeEecC-cccCCCEEEcCCC
Q psy12488         42 TPNGEYIKP-VVNVGDKVLLPKF   63 (91)
Q Consensus        42 ~~~G~~~p~-~VkvGD~Vlf~~y   63 (91)
                      +.+|..+|+ ++++||.|+-.+.
T Consensus        11 ~~~gg~~~i~~l~~g~~V~~~~~   33 (100)
T smart00306       11 TEDGGIKKIEELEEGDKVLALDE   33 (100)
T ss_pred             cCCCCEEEHHHcCCCCEEEEecC
Confidence            345455566 7888888886553


No 200
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto- 13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of ac
Probab=29.00  E-value=1.1e+02  Score=22.09  Aligned_cols=11  Identities=27%  Similarity=0.298  Sum_probs=9.0

Q ss_pred             cccCCCEEEcC
Q psy12488         51 VVNVGDKVLLP   61 (91)
Q Consensus        51 ~VkvGD~Vlf~   61 (91)
                      .+++||+|+..
T Consensus        77 ~~~~Gd~V~~~   87 (329)
T cd08294          77 KFPVGTIVVAS   87 (329)
T ss_pred             CCCCCCEEEee
Confidence            57899999863


No 201
>PRK04190 glucose-6-phosphate isomerase; Provisional
Probab=28.91  E-value=1.2e+02  Score=21.87  Aligned_cols=34  Identities=21%  Similarity=0.242  Sum_probs=22.7

Q ss_pred             CCCeEecCcccCCCEEEcCCCCceEEEE-CCEEEE
Q psy12488         43 PNGEYIKPVVNVGDKVLLPKFGGTKIEV-EGQELH   76 (91)
Q Consensus        43 ~~G~~~p~~VkvGD~Vlf~~y~g~ev~~-dg~~y~   76 (91)
                      .+|+.....+++||.|+++++..-.+.- .++.+.
T Consensus       115 ~~G~~~~~~v~pGd~v~IPpg~~H~~iN~G~epl~  149 (191)
T PRK04190        115 PEGEARWIEMEPGTVVYVPPYWAHRSVNTGDEPLV  149 (191)
T ss_pred             CCCcEEEEEECCCCEEEECCCCcEEeEECCCCCEE
Confidence            3455566789999999999977644433 334433


No 202
>COG0298 HypC Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=28.70  E-value=55  Score=21.01  Aligned_cols=17  Identities=35%  Similarity=0.501  Sum_probs=12.6

Q ss_pred             eEecCcccCCCEEEcCC
Q psy12488         46 EYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        46 ~~~p~~VkvGD~Vlf~~   62 (91)
                      .+++-++++||+|+..-
T Consensus        33 ~Lv~~~v~~GdyVLVHv   49 (82)
T COG0298          33 DLVGEEVKVGDYVLVHV   49 (82)
T ss_pred             eeecCccccCCEEEEEe
Confidence            34555899999999753


No 203
>PF00278 Orn_DAP_Arg_deC:  Pyridoxal-dependent decarboxylase, C-terminal sheet domain;  InterPro: IPR022643 These enzymes are collectively known as group IV decarboxylases []. Pyridoxal-dependent decarboxylases acting on ornithine, lysine, arginine and related substrates can be classified into two different families on the basis of sequence similarities [, ]. Members of this family while most probably evolutionary related, do not share extensive regions of sequence similarities. The proteins contain a conserved lysine residue which is known, in mouse ODC [], to be the site of attachment of the pyridoxal-phosphate group. The proteins also contain a stretch of three consecutive glycine residues and has been proposed to be part of a substrate- binding region []. This entry represents the C-terminal region of the Orn/DAP/Arg decarboxylases.; GO: 0003824 catalytic activity; PDB: 1TWI_B 1TUF_A 3MT1_A 3N2B_C 2O0T_A 1HKW_A 1HKV_A 3VAB_A 3N2O_A 7ODC_A ....
Probab=28.58  E-value=51  Score=20.66  Aligned_cols=34  Identities=18%  Similarity=0.330  Sum_probs=20.3

Q ss_pred             EEEEEcCCeeCC----CCeEecCcccCCCEEEcCCCCc
Q psy12488         32 VVVAVGPGARTP----NGEYIKPVVNVGDKVLLPKFGG   65 (91)
Q Consensus        32 ~VVAVG~G~~~~----~G~~~p~~VkvGD~Vlf~~y~g   65 (91)
                      .+.=.|+-+...    .....|..+++||.++|..-++
T Consensus        59 ~~~i~GptC~~~D~i~~~~~lP~~l~~GD~l~f~~~GA   96 (116)
T PF00278_consen   59 PSTIWGPTCDSGDVIARDVMLPKELEVGDWLVFENMGA   96 (116)
T ss_dssp             EEEEEESSSSTTSEEEEEEEEESTTTTT-EEEESS-SS
T ss_pred             EEEEEECCcCCCceEeeeccCCCCCCCCCEEEEecCcc
Confidence            444478766432    1233455899999999988443


No 204
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B. aeIF5B is a homologue of prokaryotic Initiation Factor 2 (IF2).  Disruption of the eIF5B gene (FUN12) in yeast causes a severe slow-growth phenotype, associated with a defect in translation. eIF5B has a function analogous to prokaryotic IF2 in mediating the joining of joining of 60S subunits.  The eIF5B consists of three N-terminal domains  (I, II, II) connected by a long helix to domain IV. Domain I is a G domain, domain II and IV are beta-barrels and domain III has a novel alpha-beta-alpha sandwich fold. The G domain and the beta-barrel domain II display a similar structure and arrangement to the homologous domains of EF1A, eEF1A and aeIF2gamma.
Probab=27.84  E-value=67  Score=21.46  Aligned_cols=19  Identities=26%  Similarity=0.567  Sum_probs=15.3

Q ss_pred             cccCCCEEEcCCCCc---eEEE
Q psy12488         51 VVNVGDKVLLPKFGG---TKIE   69 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g---~ev~   69 (91)
                      .+++||+|++....|   +.|+
T Consensus        26 tL~~GD~Iv~g~~~Gpi~tkVR   47 (110)
T cd03703          26 TLREGDTIVVCGLNGPIVTKVR   47 (110)
T ss_pred             eEecCCEEEEccCCCCceEEEe
Confidence            689999999988776   5554


No 205
>PRK05886 yajC preprotein translocase subunit YajC; Validated
Probab=27.83  E-value=78  Score=21.14  Aligned_cols=21  Identities=19%  Similarity=0.340  Sum_probs=10.4

Q ss_pred             cccCCCEEEcCC-CCceEEEEC
Q psy12488         51 VVNVGDKVLLPK-FGGTKIEVE   71 (91)
Q Consensus        51 ~VkvGD~Vlf~~-y~g~ev~~d   71 (91)
                      .+++||+|+... .-|+=+.++
T Consensus        38 ~Lk~GD~VvT~gGi~G~V~~I~   59 (109)
T PRK05886         38 SLQPGDRVHTTSGLQATIVGIT   59 (109)
T ss_pred             hcCCCCEEEECCCeEEEEEEEe
Confidence            456666665543 444434443


No 206
>PRK13914 invasion associated secreted endopeptidase; Provisional
Probab=27.43  E-value=27  Score=28.99  Aligned_cols=35  Identities=14%  Similarity=0.255  Sum_probs=21.6

Q ss_pred             eeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCC
Q psy12488         16 GGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKF   63 (91)
Q Consensus        16 ~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y   63 (91)
                      .||.||..+..-...|      ....       .-++++||.|+|...
T Consensus       404 ~GI~LPR~s~~Q~~~G------~~Vs-------~selqpGDLVFF~~~  438 (481)
T PRK13914        404 AGISLPRTSGAQYAST------TRIS-------ESQAKPGDLVFFDYG  438 (481)
T ss_pred             cCCCCCCChHHHHhcC------cccc-------cccCCCCCEEEeCCC
Confidence            5899998764322222      1111       127999999999743


No 207
>PRK06033 hypothetical protein; Validated
Probab=27.36  E-value=1.5e+02  Score=18.48  Aligned_cols=27  Identities=11%  Similarity=0.044  Sum_probs=19.4

Q ss_pred             cccCCCEEEcCCCCc--eEEEECCEEEEE
Q psy12488         51 VVNVGDKVLLPKFGG--TKIEVEGQELHL   77 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g--~ev~~dg~~y~i   77 (91)
                      .+++||.+-+.....  .++.++|...+.
T Consensus        27 ~L~~GDVI~L~~~~~~~v~v~V~~~~~f~   55 (83)
T PRK06033         27 RMGRGAVIPLDATEADEVWILANNHPIAR   55 (83)
T ss_pred             CCCCCCEEEeCCCCCCcEEEEECCEEEEE
Confidence            788999999987543  566778865543


No 208
>PF00877 NLPC_P60:  NlpC/P60 family;  InterPro: IPR000064 The Escherichia coli NLPC/Listeria P60 domain occurs at the C terminus of a number of different bacterial and viral proteins. The viral proteins are either described as tail assembly proteins or Gp19. In bacteria, the proteins are variously described as being putative tail component of prophage, invasin, invasion associated protein, putative lipoprotein, cell wall hydrolase, or putative endopeptidase.  The E. coli NLPC/Listeria P60 domain is contained within the boundaries of the cysteine peptidase domain that defines the MEROPS peptidase family C40 (clan C-). A type example being dipeptidyl-peptidase VI from Bacillus sphaericus and gamma-glutamyl-diamino acid-endopeptidase precursor from Lactococcus lactis 3.4.19.11 from EC. This group also contains proteins classified as non-peptidase homologues in that they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of peptidases in the C40 family. ; PDB: 3PVQ_B 3GT2_A 3NPF_B 2K1G_A 3I86_A 3S0Q_A 2XIV_A 3PBC_A 3NE0_A 3M1U_B ....
Probab=27.14  E-value=27  Score=21.81  Aligned_cols=30  Identities=17%  Similarity=0.248  Sum_probs=17.5

Q ss_pred             CcccCCCEEEcCCCCc-eE--EEECCEEEEEEe
Q psy12488         50 PVVNVGDKVLLPKFGG-TK--IEVEGQELHLFK   79 (91)
Q Consensus        50 ~~VkvGD~Vlf~~y~g-~e--v~~dg~~y~ii~   79 (91)
                      .+.++||.++|..... ..  |-+++..++--.
T Consensus        50 ~~~~pGDlif~~~~~~~~Hvgiy~g~~~~iha~   82 (105)
T PF00877_consen   50 SELQPGDLIFFKGGGGISHVGIYLGDGKFIHAS   82 (105)
T ss_dssp             GG-TTTEEEEEEGTGGEEEEEEEEETTEEEEEE
T ss_pred             hcCCcccEEEEeCCccCCEeEEEEeCCeEEEeC
Confidence            3899999999988221 22  334555555444


No 209
>PRK06788 flagellar motor switch protein; Validated
Probab=26.75  E-value=1.4e+02  Score=20.17  Aligned_cols=47  Identities=17%  Similarity=0.197  Sum_probs=30.5

Q ss_pred             cceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCc--eEEEECCEEEE
Q psy12488         27 EVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGG--TKIEVEGQELH   76 (91)
Q Consensus        27 k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g--~ev~~dg~~y~   76 (91)
                      ....-..+.+|.-...-.   -=+.+++||.|.++...+  .++.++|..++
T Consensus        33 ~v~V~v~aeLG~t~ltl~---DlL~L~vGDVI~Ldk~~~dpv~v~Vng~~~f   81 (119)
T PRK06788         33 DISIELGVKLGKASITLG---DVKQLKVGDVLEVEKNLGHKVDVYLSNMKVG   81 (119)
T ss_pred             cCceEEEEEEecceecHH---HHhCCCCCCEEEeCCcCCCCEEEEECCEEEE
Confidence            345566777787654310   013789999999988665  45667886554


No 210
>cd04486 YhcR_OBF_like YhcR_OBF_like: A subfamily of OB-fold domains similar to the OB folds of Bacillus subtilis YhcR. YhcR is a sugar-nonspecific nuclease, which is active in the presence of Ca2+ and Mn2+. It cleaves RNA endonucleolytically, producing 3'-monophosphate nucleosides. YhcR appears to be the major Ca2+ activated nuclease of B. subtilis. YhcR may be localized in the cell wall.
Probab=26.69  E-value=1.6e+02  Score=17.98  Aligned_cols=36  Identities=28%  Similarity=0.448  Sum_probs=22.2

Q ss_pred             eeEEecCCcc---ccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcC
Q psy12488         16 GGVLIPEKAQ---QEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLP   61 (91)
Q Consensus        16 ~GI~LP~~~~---~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~   61 (91)
                      +|.+|-+...   .....|.-|..+.          +..+++||+|.+.
T Consensus        16 ~GffiQd~~~d~~~~ts~gifV~~~~----------~~~~~~Gd~V~vt   54 (78)
T cd04486          16 GGFYIQDEDGDGDPATSEGIFVYTGS----------GADVAVGDLVRVT   54 (78)
T ss_pred             CEEEEEcCCCCCCCcccceEEEecCC----------CCCCCCCCEEEEE
Confidence            5777766521   1344565555543          2379999999884


No 211
>smart00841 Elong-fact-P_C Elongation factor P, C-terminal. These nucleic acid binding domains are predominantly found in elongation factor P, where they adopt an OB-fold, with five beta-strands forming a beta-barrel in a Greek-key topology PUBMED:15210970.
Probab=26.68  E-value=58  Score=19.24  Aligned_cols=17  Identities=24%  Similarity=0.337  Sum_probs=11.3

Q ss_pred             EecCcccCCCEEEcCCC
Q psy12488         47 YIKPVVNVGDKVLLPKF   63 (91)
Q Consensus        47 ~~p~~VkvGD~Vlf~~y   63 (91)
                      .+|+-++.||+|.++--
T Consensus        33 ~VP~FI~~Gd~I~V~T~   49 (56)
T smart00841       33 QVPLFINEGDKIKVDTR   49 (56)
T ss_pred             EcCCcccCCCEEEEECC
Confidence            36677777877766543


No 212
>TIGR01048 lysA diaminopimelate decarboxylase. This family consists of diaminopimelate decarboxylase, an enzyme which catalyzes the conversion of diaminopimelic acid into lysine during the last step of lysine biosynthesis.
Probab=26.55  E-value=1e+02  Score=23.90  Aligned_cols=32  Identities=25%  Similarity=0.295  Sum_probs=21.1

Q ss_pred             EEEEEcCCeeCC----CCeEecCcccCCCEEEcCCCC
Q psy12488         32 VVVAVGPGARTP----NGEYIKPVVNVGDKVLLPKFG   64 (91)
Q Consensus        32 ~VVAVG~G~~~~----~G~~~p~~VkvGD~Vlf~~y~   64 (91)
                      .+.=+||-+...    .....| .+++||.++|..-+
T Consensus       339 ~~~v~G~~C~~~D~l~~~~~lp-~l~~GD~l~~~~~G  374 (417)
T TIGR01048       339 VADVVGPLCESGDVLARDRELP-EVEPGDLLAVFDAG  374 (417)
T ss_pred             EEEEEeCCcCCCCEEeeccCCC-CCCCCCEEEEeCCC
Confidence            456678866432    223344 79999999997733


No 213
>PRK05610 rpsQ 30S ribosomal protein S17; Reviewed
Probab=26.42  E-value=38  Score=21.51  Aligned_cols=12  Identities=25%  Similarity=0.404  Sum_probs=10.7

Q ss_pred             cccCCCEEEcCC
Q psy12488         51 VVNVGDKVLLPK   62 (91)
Q Consensus        51 ~VkvGD~Vlf~~   62 (91)
                      .+++||.|.+.+
T Consensus        53 ~~k~GD~V~I~e   64 (84)
T PRK05610         53 EAKIGDVVRIME   64 (84)
T ss_pred             CCCCCCEEEEEE
Confidence            799999999975


No 214
>PF05899 Cupin_3:  Protein of unknown function (DUF861);  InterPro: IPR008579 The function of the proteins in this entry are unknown. They contain the conserved barrel domain of the 'cupin' superfamily and members are specific to plants and bacteria.; PDB: 1RC6_A 3MYX_A 1O5U_A 2K9Z_A 1LKN_A 3ES4_A 1SFN_B 3BCW_A.
Probab=26.33  E-value=79  Score=18.91  Aligned_cols=28  Identities=32%  Similarity=0.496  Sum_probs=17.8

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCC
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      ...|.|.-.-     .+|+  +..+++||.++|++
T Consensus        31 vleG~v~it~-----~~G~--~~~~~aGD~~~~p~   58 (74)
T PF05899_consen   31 VLEGEVTITD-----EDGE--TVTFKAGDAFFLPK   58 (74)
T ss_dssp             EEEEEEEEEE-----TTTE--EEEEETTEEEEE-T
T ss_pred             EEEeEEEEEE-----CCCC--EEEEcCCcEEEECC
Confidence            3445555443     2443  36899999999998


No 215
>PRK08433 flagellar motor switch protein; Validated
Probab=26.24  E-value=1.5e+02  Score=19.75  Aligned_cols=46  Identities=11%  Similarity=0.078  Sum_probs=28.1

Q ss_pred             eeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCC--ceEEEECCEEEEE
Q psy12488         29 NNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG--GTKIEVEGQELHL   77 (91)
Q Consensus        29 ~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~--g~ev~~dg~~y~i   77 (91)
                      ..-..+.+|.-...-   .-=+.+++||.+.+....  -.++.++|...+.
T Consensus        33 ~VeV~v~LG~t~itl---~dlL~Lq~GDVI~Ld~~~~e~v~v~V~g~~~f~   80 (111)
T PRK08433         33 EVDFSAELGTTQISL---LEILKFEKGSVIDLEKPAGESVELYINGRIIGK   80 (111)
T ss_pred             eeEEEEEEecccccH---HHHhCCCCCCEEEeCCCCCCCEEEEECCEEEEE
Confidence            344455566544320   011378999999998754  4677788876554


No 216
>PF13759 2OG-FeII_Oxy_5:  Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A.
Probab=26.16  E-value=36  Score=21.31  Aligned_cols=20  Identities=30%  Similarity=0.399  Sum_probs=12.7

Q ss_pred             CeEecCcccCCCEEEcCCCC
Q psy12488         45 GEYIKPVVNVGDKVLLPKFG   64 (91)
Q Consensus        45 G~~~p~~VkvGD~Vlf~~y~   64 (91)
                      ........+.||.|||+.+-
T Consensus        63 ~~~~~~~p~~G~lvlFPs~l   82 (101)
T PF13759_consen   63 SPYYIVEPEEGDLVLFPSWL   82 (101)
T ss_dssp             -SEEEE---TTEEEEEETTS
T ss_pred             CceEEeCCCCCEEEEeCCCC
Confidence            44556788999999999864


No 217
>cd05794 S1_EF-P_repeat_2 S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with N-formylmethionyl-tRNA and puromycine in vitro. EF-P binds to both the 30S and 50S ribosomal subunits. EF-P binds near the streptomycine binding site of the 16S rRNA in the 30S subunit. EF-P interacts with domains 2 and 5 of the 23S rRNA. The L16 ribosomal protein of the 50S or its N-terminal fragment are required for EF-P mediated peptide bond synthesis, whereas L11, L15, and L7/L12 are not required in this reaction, suggesting that EF-P may function at a different ribosomal site than most other translation factors. EF-P is essential for cell viability and is required for protein synthesis. EF-P is mainly present in bacteria. The EF-P homologs in archaea and eukaryotes are the initiation factors aIF5A and eIF5A, respectively. EF-P 
Probab=26.14  E-value=58  Score=19.24  Aligned_cols=18  Identities=11%  Similarity=0.205  Sum_probs=12.8

Q ss_pred             EecCcccCCCEEEcCCCC
Q psy12488         47 YIKPVVNVGDKVLLPKFG   64 (91)
Q Consensus        47 ~~p~~VkvGD~Vlf~~y~   64 (91)
                      .+|+-++.||+|..+--.
T Consensus        33 ~VP~FI~~Gd~I~V~T~~   50 (56)
T cd05794          33 QVPLFIKEGEKIKVDTRT   50 (56)
T ss_pred             EcCCeecCCCEEEEECCC
Confidence            367788888888775433


No 218
>PRK08666 5'-methylthioadenosine phosphorylase; Validated
Probab=26.09  E-value=63  Score=23.93  Aligned_cols=26  Identities=31%  Similarity=0.565  Sum_probs=17.4

Q ss_pred             EEEEEEcC-CeeCCCCeEecCcccCCCEEEcCCC
Q psy12488         31 AVVVAVGP-GARTPNGEYIKPVVNVGDKVLLPKF   63 (91)
Q Consensus        31 G~VVAVG~-G~~~~~G~~~p~~VkvGD~Vlf~~y   63 (91)
                      -.|+.+|. |..+       ..+++||.|+..++
T Consensus        77 ~~II~tgsaGsl~-------~~l~~GDiVi~~d~  103 (261)
T PRK08666         77 ERILATSAVGSLN-------PNMKPGDFVILDQF  103 (261)
T ss_pred             CEEEEeccccccC-------CCCCCCCEEeehhh
Confidence            35566665 3332       36999999998875


No 219
>PTZ00316 profilin; Provisional
Probab=25.72  E-value=99  Score=21.86  Aligned_cols=15  Identities=7%  Similarity=0.253  Sum_probs=13.0

Q ss_pred             eEEEECCEEEEEEec
Q psy12488         66 TKIEVEGQELHLFKE   80 (91)
Q Consensus        66 ~ev~~dg~~y~ii~~   80 (91)
                      .=|.++|++|+++|.
T Consensus        60 ~Gi~l~G~KY~~lr~   74 (150)
T PTZ00316         60 SGVTIYGVKFFGLQS   74 (150)
T ss_pred             CCEEEcceEEEEEEe
Confidence            458999999999985


No 220
>PRK10377 PTS system glucitol/sorbitol-specific transporter subunit IIA; Provisional
Probab=25.63  E-value=2.1e+02  Score=19.20  Aligned_cols=14  Identities=14%  Similarity=0.275  Sum_probs=7.4

Q ss_pred             ceEEEECCEEEEEE
Q psy12488         65 GTKIEVEGQELHLF   78 (91)
Q Consensus        65 g~ev~~dg~~y~ii   78 (91)
                      |..+++|+++|.+-
T Consensus        55 Gd~l~i~~~~Y~It   68 (120)
T PRK10377         55 GLQFELGQHRYPVT   68 (120)
T ss_pred             CCEEEECCEEEEEE
Confidence            34455566666543


No 221
>cd06166 Sortase_D_5 Sortase D (SrtD) is a membrane transpeptidase found in gram-positive bacteria that anchors surface proteins to peptidoglycans of the bacterial cell wall envelope. This involves a transpeptidation reaction in which the surface protein substrate is cleaved at the cell wall sorting signal and covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. Class D sortases are further classified into subfamilies 4 and 5. This group contains a subset of Class D sortases belonging to subfamily-5, represented by Clostridium perfringens CPE2315. Subfamily-5 sortases recognize a nonstandard sorting signal (LAXTG) and have replaced Sortase A in some gram-postive bacteria. They may play a housekeeping role in the cell.
Probab=25.46  E-value=93  Score=20.37  Aligned_cols=51  Identities=12%  Similarity=0.130  Sum_probs=27.7

Q ss_pred             EEEEEEcCCeeCCCCeEecC-cccCCCEEEcCCCCceEEEECCEEEEEEecCc
Q psy12488         31 AVVVAVGPGARTPNGEYIKP-VVNVGDKVLLPKFGGTKIEVEGQELHLFKEAD   82 (91)
Q Consensus        31 G~VVAVG~G~~~~~G~~~p~-~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~D   82 (91)
                      |-++=.|.-......-+..+ .+++||.|.+... +...+|.=..-.+++.+|
T Consensus        43 gn~viaGH~~~~~~~~F~~L~~l~~Gd~v~v~~~-~~~~~Y~V~~~~~v~~~~   94 (126)
T cd06166          43 GNFAIAGHRSYTYGRIFNRLDEVEKGDEIKVTTK-NGTYKYKITSIFVVEPTD   94 (126)
T ss_pred             ceEEEEeCcCCCCCcccCChHHCCCCCEEEEEEC-CEEEEEEEEEEEEECCCc
Confidence            66666665321111122333 7999999999876 444444433334455554


No 222
>PF01426 BAH:  BAH domain;  InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation. The BAH domain appears to act as a protein-protein interaction module specialised in gene silencing, as suggested for example by its interaction within yeast Orc1p with the silent information regulator Sir1p. The BAH module might therefore play an important role by linking DNA methylation, replication and transcriptional regulation [].; GO: 0003677 DNA binding; PDB: 4DA4_A 3PT6_B 3AV6_A 3AV5_A 3AV4_A 3PT9_A 3SWR_A 3PTA_A 1M4Z_A 1ZBX_A ....
Probab=25.41  E-value=66  Score=20.06  Aligned_cols=14  Identities=29%  Similarity=0.256  Sum_probs=11.4

Q ss_pred             cccCCCEEEcCCCC
Q psy12488         51 VVNVGDKVLLPKFG   64 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~   64 (91)
                      .+++||.|++..-.
T Consensus         2 ~~~vGD~V~v~~~~   15 (119)
T PF01426_consen    2 TYKVGDFVYVKPDD   15 (119)
T ss_dssp             EEETTSEEEEECTS
T ss_pred             EEeCCCEEEEeCCC
Confidence            47899999997755


No 223
>PF12508 DUF3714:  Protein of unknown function (DUF3714) ;  InterPro: IPR022187  Proteins in this entry are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage. 
Probab=25.04  E-value=72  Score=23.38  Aligned_cols=27  Identities=22%  Similarity=0.226  Sum_probs=19.9

Q ss_pred             eecceeEEecCCccccceeEEEEEEcCCeeC
Q psy12488         12 LLFPGGVLIPEKAQQEVNNAVVVAVGPGART   42 (91)
Q Consensus        12 ~~T~~GI~LP~~~~~k~~~G~VVAVG~G~~~   42 (91)
                      ..+.+|+.||...   ...| +..++..+..
T Consensus        78 ~i~i~g~~IPkgt---~l~G-~~~~~~~Rl~  104 (200)
T PF12508_consen   78 DIQIGGILIPKGT---YLYG-VASFQGQRLL  104 (200)
T ss_pred             ceEECCEEeCCCC---EEEE-EEeeeccEEE
Confidence            3455899999554   6888 8888887764


No 224
>TIGR03595 Obg_CgtA_exten Obg family GTPase CgtA, C-terminal extension. CgtA (see model TIGR02729) is a broadly conserved member of the obg family of GTPases associated with ribosome maturation. This model represents a unique C-terminal domain found in some but not all sequences of CgtA. This region is preceded, and may be followed, by a region of low-complexity sequence.
Probab=24.93  E-value=44  Score=20.20  Aligned_cols=16  Identities=31%  Similarity=0.358  Sum_probs=12.5

Q ss_pred             ecCcccCCCEEEcCCC
Q psy12488         48 IKPVVNVGDKVLLPKF   63 (91)
Q Consensus        48 ~p~~VkvGD~Vlf~~y   63 (91)
                      ..+-++.||+|.+.+|
T Consensus        50 ~~~G~~~GD~V~Ig~~   65 (69)
T TIGR03595        50 RKAGAKDGDTVRIGDF   65 (69)
T ss_pred             HHcCCCCCCEEEEccE
Confidence            3457999999998765


No 225
>cd04466 S1_YloQ_GTPase S1_YloQ_GTPase: YloQ GTase family (also known as YjeQ and CpgA), S1-like RNA-binding domain. Proteins in the YloQ GTase family bind the ribosome and have GTPase activity. The precise role of this family is unknown. The protein structure is composed of three domains: an N-terminal S1 domain, a central GTPase domain, and a C-terminal zinc finger domain. This N-terminal S1 domain binds ssRNA. The central GTPase domain contains nucleotide-binding signature motifs: G1 (walker A), G3 (walker B) and G4 motifs. Experiments show that the bacterial YloQ and YjeQ proteins have low intrinsic GTPase activity. The C-terminal zinc-finger domain has structural similarity to a portion of the DNA-repair protein Rad51. This suggests a possible role for this GTPase as a regulator of translation, perhaps as a translation initiation factor. This family is classified based on the N-terminal S1 domain.
Probab=24.81  E-value=44  Score=19.05  Aligned_cols=13  Identities=31%  Similarity=0.363  Sum_probs=10.4

Q ss_pred             CcccCCCEEEcCC
Q psy12488         50 PVVNVGDKVLLPK   62 (91)
Q Consensus        50 ~~VkvGD~Vlf~~   62 (91)
                      ..+.+||.|++..
T Consensus        36 ~~~~VGD~V~~~~   48 (68)
T cd04466          36 NPPAVGDRVEFEP   48 (68)
T ss_pred             CCCCCCcEEEEEE
Confidence            3578999999854


No 226
>TIGR02480 fliN flagellar motor switch protein FliN. Proteins that consist largely of the domain described by this model can be designated flagellar motor switch protein FliN. Longer proteins in which this region is a C-terminal domain typically are designated FliY. More distantly related sequences, outside the scope of this family, are associated with type III secretion and include the surface presentation of antigens protein SpaO required or invasion of host cells by Salmonella enterica.
Probab=24.75  E-value=1.7e+02  Score=17.65  Aligned_cols=26  Identities=23%  Similarity=0.305  Sum_probs=19.0

Q ss_pred             cccCCCEEEcCCCC--ceEEEECCEEEE
Q psy12488         51 VVNVGDKVLLPKFG--GTKIEVEGQELH   76 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~--g~ev~~dg~~y~   76 (91)
                      .+++||.+-+....  -.++.++|...+
T Consensus        28 ~L~~Gdvi~L~~~~~~~v~l~v~g~~~~   55 (77)
T TIGR02480        28 KLGEGSVIELDKLAGEPLDILVNGRLIA   55 (77)
T ss_pred             cCCCCCEEEcCCCCCCcEEEEECCEEEE
Confidence            78999999998643  356777886544


No 227
>TIGR01700 PNPH purine nucleoside phosphorylase I, inosine and guanosine-specific. Several metazoan enzymes (PNPH) are well characterized including the human and bovine enzymes which have been crystallized.
Probab=24.67  E-value=68  Score=23.73  Aligned_cols=25  Identities=28%  Similarity=0.511  Sum_probs=16.9

Q ss_pred             EEEEEcC-CeeCCCCeEecCcccCCCEEEcCCC
Q psy12488         32 VVVAVGP-GARTPNGEYIKPVVNVGDKVLLPKF   63 (91)
Q Consensus        32 ~VVAVG~-G~~~~~G~~~p~~VkvGD~Vlf~~y   63 (91)
                      .|+.+|. |..+       ..+++||.|+..++
T Consensus        85 ~II~~gsaGsl~-------~~l~~GDiVi~~d~  110 (249)
T TIGR01700        85 TLVVTNAAGGIN-------PEFKVGDLMLIRDH  110 (249)
T ss_pred             EEEEecccccCC-------CCCCCCCEEEEhhH
Confidence            4566665 3332       36999999998774


No 228
>KOG0276|consensus
Probab=24.66  E-value=2.6e+02  Score=24.62  Aligned_cols=48  Identities=19%  Similarity=0.336  Sum_probs=31.8

Q ss_pred             eeccee-EEecCCccccceeEEEEEEcCCeeCCCCeEecCcccC-CCEEEcC
Q psy12488         12 LLFPGG-VLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNV-GDKVLLP   61 (91)
Q Consensus        12 ~~T~~G-I~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~Vkv-GD~Vlf~   61 (91)
                      ....+| |+....  ...+....-++|......+|++.|+.||. |-.=+||
T Consensus       305 sMd~~gKIiwa~~--~ei~~~~~ks~~~~~ev~DgErL~LsvKeLgs~eiyP  354 (794)
T KOG0276|consen  305 SMDSNGKIIWAVH--SEIQAVNLKSVGAQKEVTDGERLPLSVKELGSVEIYP  354 (794)
T ss_pred             eecCCccEEEEcC--ceeeeeeceeccCcccccCCccccchhhhccccccch
Confidence            445566 666533  34567777788888777899999998885 4433444


No 229
>PF05382 Amidase_5:  Bacteriophage peptidoglycan hydrolase ;  InterPro: IPR008044 This entry is represented by Bacteriophage SFi21, lysin (Cell wall hydrolase; 3.5.1.28 from EC). At least one of proteins in this entry, the Pal protein from the pneumococcal bacteriophage Dp-1 (O03979 from SWISSPROT) has been shown to be an N-acetylmuramoyl-L-alanine amidase []. According to the known modular structure of this and other peptidoglycan hydrolases from the pneumococcal system, the active site should reside within this domain while a C-terminal domain binds to the choline residues of the cell wall teichoic acids [, ].
Probab=23.97  E-value=1e+02  Score=21.44  Aligned_cols=33  Identities=12%  Similarity=0.243  Sum_probs=21.6

Q ss_pred             cccCCCEEEcCCCCceEEEECCEEEEEEecCcEE
Q psy12488         51 VVNVGDKVLLPKFGGTKIEVEGQELHLFKEADLL   84 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~DIl   84 (91)
                      .++.||.+++..- |..--..|..++|+....|+
T Consensus        75 ~~q~GDI~I~g~~-g~S~G~~GHtgif~~~~~iI  107 (145)
T PF05382_consen   75 NLQRGDIFIWGRR-GNSAGAGGHTGIFMDNDTII  107 (145)
T ss_pred             cccCCCEEEEcCC-CCCCCCCCeEEEEeCCCcEE
Confidence            6899999998553 21112356777777766665


No 230
>cd02558 PSRA_1 PSRA_1: Pseudouridine synthase, a subgroup of the RluA family. This group is comprised of bacterial proteins assigned to the RluA family of pseudouridine synthases. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi).  No cofactors are required. The RluA family is comprised of proteins related to Escherichia coli RluA.
Probab=23.96  E-value=98  Score=22.70  Aligned_cols=11  Identities=18%  Similarity=-0.043  Sum_probs=8.3

Q ss_pred             cccCCCEEEcC
Q psy12488         51 VVNVGDKVLLP   61 (91)
Q Consensus        51 ~VkvGD~Vlf~   61 (91)
                      .++.||+|.+.
T Consensus        16 ~l~~gd~i~~~   26 (246)
T cd02558          16 PYRPGTFVWYY   26 (246)
T ss_pred             eecCCCEEEEe
Confidence            68888888653


No 231
>PF05721 PhyH:  Phytanoyl-CoA dioxygenase (PhyH);  InterPro: IPR008775 This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins as well as a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalysing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterised by the accumulation of phytanic acid in plasma and tissues [].; PDB: 3GJA_A 3EMR_A 3OBZ_A 2OPW_A 3NNL_B 3NNF_A 3NNM_B 3NNJ_A 2FCV_B 2FCU_A ....
Probab=23.94  E-value=38  Score=22.41  Aligned_cols=18  Identities=17%  Similarity=0.377  Sum_probs=14.1

Q ss_pred             eEecCcccCCCEEEcCCC
Q psy12488         46 EYIKPVVNVGDKVLLPKF   63 (91)
Q Consensus        46 ~~~p~~VkvGD~Vlf~~y   63 (91)
                      ..++..+++||.|+|..+
T Consensus       178 ~~~~~~~~~Gdvl~~~~~  195 (211)
T PF05721_consen  178 EWVPVPMKAGDVLFFHSR  195 (211)
T ss_dssp             GCEEE-BSTTEEEEEETT
T ss_pred             ceEEeecCCCeEEEEcCC
Confidence            446778999999999874


No 232
>PF11213 DUF3006:  Protein of unknown function (DUF3006);  InterPro: IPR021377  This family of proteins has no known function. 
Probab=23.74  E-value=98  Score=18.58  Aligned_cols=14  Identities=14%  Similarity=0.169  Sum_probs=11.4

Q ss_pred             EecCcccCCCEEEc
Q psy12488         47 YIKPVVNVGDKVLL   60 (91)
Q Consensus        47 ~~p~~VkvGD~Vlf   60 (91)
                      ..|..++.||.+.+
T Consensus        29 ~LP~~~keGDvl~i   42 (71)
T PF11213_consen   29 RLPEGAKEGDVLEI   42 (71)
T ss_pred             HCCCCCCcccEEEE
Confidence            46778999998877


No 233
>TIGR01697 PNPH-PUNA-XAPA inosine guanosine and xanthosine phosphorylase family. Sequences from Clostridium and Thermotoga fall between these last two clades and are uncharacterized with respect to substrate range and operon.
Probab=23.65  E-value=80  Score=23.21  Aligned_cols=27  Identities=19%  Similarity=0.400  Sum_probs=18.1

Q ss_pred             eEEEEEEcC-CeeCCCCeEecCcccCCCEEEcCCC
Q psy12488         30 NAVVVAVGP-GARTPNGEYIKPVVNVGDKVLLPKF   63 (91)
Q Consensus        30 ~G~VVAVG~-G~~~~~G~~~p~~VkvGD~Vlf~~y   63 (91)
                      .-.|+.+|. |..+       ..+++||.|+-.++
T Consensus        83 v~~II~~GsaGsl~-------~~l~~GDiVI~~~~  110 (248)
T TIGR01697        83 VEILVVTNAAGGLN-------PDFKPGDLMIIKDH  110 (248)
T ss_pred             CCEEEEecccccCC-------CCCCCCCEEEEhhh
Confidence            345666666 3332       36999999998774


No 234
>TIGR02219 phage_NlpC_fam putative phage cell wall peptidase, NlpC/P60 family. Members of this family show sequence similarity to members of the NlpC/P60 family described by Pfam model pfam00877 and by Anantharaman and Aravind (PubMed:12620121). The NlpC/P60 family includes a number of characterized bacterial cell wall hydrolases. Members of this related family are all found in prophage regions of bacterial genomes.
Probab=23.26  E-value=46  Score=22.21  Aligned_cols=12  Identities=17%  Similarity=0.277  Sum_probs=10.5

Q ss_pred             cccCCCEEEcCC
Q psy12488         51 VVNVGDKVLLPK   62 (91)
Q Consensus        51 ~VkvGD~Vlf~~   62 (91)
                      ++++||.|+|.-
T Consensus        76 ~~qpGDlvff~~   87 (134)
T TIGR02219        76 AAQPGDVLVFRW   87 (134)
T ss_pred             cCCCCCEEEEee
Confidence            789999999963


No 235
>COG3061 OapA Cell envelope opacity-associated protein A [Cell envelope biogenesis, outer membrane]
Probab=23.24  E-value=1.1e+02  Score=23.23  Aligned_cols=32  Identities=22%  Similarity=0.445  Sum_probs=24.3

Q ss_pred             cccCCCEEEcCCCC-c--eEEEEC--CEEEEEEecCc
Q psy12488         51 VVNVGDKVLLPKFG-G--TKIEVE--GQELHLFKEAD   82 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~-g--~ev~~d--g~~y~ii~~~D   82 (91)
                      .+|-||.|.|+--+ |  +++.++  +..-+|+|..|
T Consensus       199 nlkaGq~Vki~~naqG~Vt~L~le~~n~~vlF~RQ~D  235 (242)
T COG3061         199 NLKAGQKVKISLNAQGRVTELRLETGNNQVLFTRQSD  235 (242)
T ss_pred             hccCCCEEEEEEcCccceEEEEeccCCceEEEEEcCC
Confidence            79999999997743 4  456663  45888999877


No 236
>PRK10334 mechanosensitive channel MscS; Provisional
Probab=23.19  E-value=1.2e+02  Score=22.96  Aligned_cols=34  Identities=15%  Similarity=0.326  Sum_probs=21.8

Q ss_pred             cccCCCEEEcCCCCceE--EEE-------CCEEEEEEecCcEE
Q psy12488         51 VVNVGDKVLLPKFGGTK--IEV-------EGQELHLFKEADLL   84 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g~e--v~~-------dg~~y~ii~~~DIl   84 (91)
                      ++++||.|.++++.|+-  +.+       .+.+.++++.+.++
T Consensus       129 pf~vGD~I~i~~~~G~V~~I~~r~T~i~t~d~~~v~IPNs~~~  171 (286)
T PRK10334        129 PFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKII  171 (286)
T ss_pred             CCCCCCEEEECCEEEEEEEEEeEEEEEEcCCCCEEEEcchHhc
Confidence            78999999999888742  222       33445555555544


No 237
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase. One member from Halobacterium is annotated as "molybdenum-binding protein" although no evidence can be found for this classification.
Probab=22.86  E-value=1.3e+02  Score=24.82  Aligned_cols=32  Identities=25%  Similarity=0.335  Sum_probs=24.7

Q ss_pred             cceeEEEEEEcCCeeC---CCCeEecCcccCCCEEE
Q psy12488         27 EVNNAVVVAVGPGART---PNGEYIKPVVNVGDKVL   59 (91)
Q Consensus        27 k~~~G~VVAVG~G~~~---~~G~~~p~~VkvGD~Vl   59 (91)
                      =|.-|.|+. |....+   -+|+-.|...++||.|+
T Consensus       124 iP~Dg~v~~-g~~~vdes~lTGEs~pv~k~~gd~V~  158 (562)
T TIGR01511       124 IPVDGTVIE-GESEVDESLVTGESLPVPKKVGDPVI  158 (562)
T ss_pred             ecCceEEEE-CceEEehHhhcCCCCcEEcCCCCEEE
Confidence            367777777 665555   38999999999999984


No 238
>PF00924 MS_channel:  Mechanosensitive ion channel;  InterPro: IPR006685 Mechanosensitive (MS) channels provide protection against hypo-osmotic shock, responding both to stretching of the cell membrane and to membrane depolarisation. They are present in the membranes of organisms from the three domains of life: bacteria, archaea, and eukarya []. There are two families of MS channels: large-conductance MS channels (MscL) and small-conductance MS channels (MscS or YGGB). The pressure threshold for MscS opening is 50% that of MscL []. The MscS family is much larger and more variable in size and sequence than the MscL family. Much of the diversity in MscS proteins occurs in the size of the transmembrane regions, which ranges from three to eleven transmembrane helices, although the three C-terminal helices are conserved. This family contains sequences form the MscS family of proteins. MscS folds as a homo-heptamer with a cylindrical shape, and can be divided into transmembrane and extramembrane regions: an N-terminal periplasmic region, a transmembrane region, and a C-terminal cytoplasmic region (middle and C-terminal domains). The transmembrane region forms a channel through the membrane that opens into a chamber enclosed by the extramembrane portion, the latter connecting to the cytoplasm through distinct portals [].; GO: 0055085 transmembrane transport, 0016020 membrane; PDB: 2OAU_E 2VV5_F.
Probab=22.82  E-value=2e+02  Score=19.74  Aligned_cols=21  Identities=24%  Similarity=0.384  Sum_probs=13.3

Q ss_pred             cccCCCEEEcCCCCceEEEEC
Q psy12488         51 VVNVGDKVLLPKFGGTKIEVE   71 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g~ev~~d   71 (91)
                      ++++||+|.+..+.|.=.++.
T Consensus        60 pf~vGD~I~i~~~~G~V~~I~   80 (206)
T PF00924_consen   60 PFKVGDRIEIGGVEGRVEEIG   80 (206)
T ss_dssp             SS-TT-EEESSS-EEEEEEE-
T ss_pred             CccCCCEEEEEEeehHHHhcC
Confidence            789999999998888544443


No 239
>COG3794 PetE Plastocyanin [Energy production and conversion]
Probab=22.74  E-value=86  Score=21.46  Aligned_cols=13  Identities=31%  Similarity=0.309  Sum_probs=11.1

Q ss_pred             cccCCCEEEcCCC
Q psy12488         51 VVNVGDKVLLPKF   63 (91)
Q Consensus        51 ~VkvGD~Vlf~~y   63 (91)
                      .|++||+|-|-..
T Consensus        57 ~v~pGDTVtw~~~   69 (128)
T COG3794          57 TVKPGDTVTWVNT   69 (128)
T ss_pred             EECCCCEEEEEEC
Confidence            8999999999553


No 240
>PF02989 DUF228:  Lyme disease proteins of unknown function;  InterPro: IPR004239 This group comprises proteins of unknown function from Borrelia burgdorferi, the causitive organism of Lyme disease.
Probab=22.73  E-value=2e+02  Score=21.13  Aligned_cols=37  Identities=22%  Similarity=0.348  Sum_probs=23.9

Q ss_pred             ecceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCC
Q psy12488         13 LFPGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFG   64 (91)
Q Consensus        13 ~T~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~   64 (91)
                      -|..+-++|-+.   ..+|.-+|-.+            .+|.||+..|++.+
T Consensus       105 fs~tAtVvPITn---nFegyLvak~~------------~ik~gdkL~fN~~G  141 (184)
T PF02989_consen  105 FSKTATVVPITN---NFEGYLVAKDS------------TIKAGDKLIFNKDG  141 (184)
T ss_pred             ccceEEEEeccC---CeEEEEEECCC------------CCCcCcEEEecCCC
Confidence            344445555443   35565555432            79999999999875


No 241
>COG1829 Predicted archaeal kinase (sugar kinase superfamily) [General function prediction only]
Probab=22.70  E-value=1.3e+02  Score=23.43  Aligned_cols=50  Identities=20%  Similarity=0.419  Sum_probs=33.2

Q ss_pred             ceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCceEEEECCEEEEE
Q psy12488         15 PGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGGTKIEVEGQELHL   77 (91)
Q Consensus        15 ~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g~ev~~dg~~y~i   77 (91)
                      -+|++.|-..+++...|   ++|-|..          +..|=+|-.....++.|.+||+++=+
T Consensus        11 ITgfF~pv~~~~p~~SG---SiGaGv~----------l~~gv~v~v~~~~~~~v~~Ng~~~d~   60 (283)
T COG1829          11 ITGFFVPVIGKDPLKSG---SIGAGVA----------LERGVTVEVRFGEGTGVRLNGKKIDL   60 (283)
T ss_pred             eEEEEEeccCCCCccCC---CcceeEE----------ecCceeEEEEecCCceEEECCeeccc
Confidence            36888887766666666   3455543          55566666667777888888866543


No 242
>PF09269 DUF1967:  Domain of unknown function (DUF1967);  InterPro: IPR015349 The Obg family comprises a group of ancient P-loop small G proteins (GTPases) belonging to the TRAFAC (for translation factors) class and can be subdivided into several distinct protein subfamilies []. OBG GTPases have been found in both prokaryotes and eukaryotes []. The structure of the OBG GTPase from Thermus thermophilus has been determined []. This entry represents a C-terminal domain found in certain OBG GTPases. This domain contains a four-stranded beta sheet and three alpha helices flanked by an additional beta strand. It is predominantly found in the bacterial GTP-binding protein Obg, and is functionally uncharacterised. ; GO: 0000166 nucleotide binding; PDB: 1UDX_A.
Probab=22.00  E-value=46  Score=20.07  Aligned_cols=15  Identities=27%  Similarity=0.415  Sum_probs=9.0

Q ss_pred             cCcccCCCEEEcCCC
Q psy12488         49 KPVVNVGDKVLLPKF   63 (91)
Q Consensus        49 p~~VkvGD~Vlf~~y   63 (91)
                      ..-++.||+|.+.+|
T Consensus        51 ~~G~~~GD~V~Ig~~   65 (69)
T PF09269_consen   51 KAGAKEGDTVRIGDY   65 (69)
T ss_dssp             TTT--TT-EEEETTE
T ss_pred             HcCCCCCCEEEEcCE
Confidence            346899999998765


No 243
>PRK08983 fliN flagellar motor switch protein; Validated
Probab=21.64  E-value=2.2e+02  Score=19.32  Aligned_cols=46  Identities=20%  Similarity=0.228  Sum_probs=28.3

Q ss_pred             ceeEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCc--eEEEECCEEEE
Q psy12488         28 VNNAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGG--TKIEVEGQELH   76 (91)
Q Consensus        28 ~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g--~ev~~dg~~y~   76 (91)
                      ...-..+.+|.-...-   +-=+.+++||.+.+.....  .++.++|...+
T Consensus        51 v~V~v~v~LG~t~ltl---~dlL~L~~GDVI~Ld~~~ddpv~v~Vng~~~f   98 (127)
T PRK08983         51 IPVTISMEVGRSFISI---RNLLQLNQGSVVELDRVAGEPLDVMVNGTLIA   98 (127)
T ss_pred             CeeEEEEEEecCcccH---HHHhCCCCCCEEEeCCCCCCCEEEEECCEEEE
Confidence            3444556666644321   0113789999999988655  56677886544


No 244
>PRK03760 hypothetical protein; Provisional
Probab=21.30  E-value=72  Score=21.21  Aligned_cols=15  Identities=27%  Similarity=0.215  Sum_probs=10.7

Q ss_pred             ecCcccCCCEEEcCC
Q psy12488         48 IKPVVNVGDKVLLPK   62 (91)
Q Consensus        48 ~p~~VkvGD~Vlf~~   62 (91)
                      ....+++||+|.|.+
T Consensus       102 ~~~gi~~Gd~v~~~~  116 (117)
T PRK03760        102 RVLKVEVGDEIEWID  116 (117)
T ss_pred             HHcCCCCCCEEEEee
Confidence            344689999987753


No 245
>TIGR02375 pseudoazurin pseudoazurin. Pseudoazurin, also called cupredoxin, is a small, blue periplasmic protein with a single bound copper atom. Pseudoazurin is related plastocyanins. Several examples of pseudoazurin are encoded by a neighboring gene for, or have been shown to transfer electrons to, copper-containing nitrite reductases (TIGR02376) of the same species.
Probab=21.23  E-value=51  Score=21.93  Aligned_cols=20  Identities=25%  Similarity=0.290  Sum_probs=13.5

Q ss_pred             cccCCCEEEcCC-CCceEEEE
Q psy12488         51 VVNVGDKVLLPK-FGGTKIEV   70 (91)
Q Consensus        51 ~VkvGD~Vlf~~-y~g~ev~~   70 (91)
                      .|++||+|.|-. -.+-.+..
T Consensus        18 ~V~~GdTV~f~n~d~~Hnv~~   38 (116)
T TIGR02375        18 RAAPGDTVTFVPTDKGHNVET   38 (116)
T ss_pred             EECCCCEEEEEECCCCeeEEE
Confidence            799999999943 23444443


No 246
>PF13533 Biotin_lipoyl_2:  Biotin-lipoyl like
Probab=21.16  E-value=59  Score=18.07  Aligned_cols=9  Identities=44%  Similarity=0.608  Sum_probs=5.0

Q ss_pred             cccCCCEEE
Q psy12488         51 VVNVGDKVL   59 (91)
Q Consensus        51 ~VkvGD~Vl   59 (91)
                      .||.||..+
T Consensus        23 ~VkkGd~L~   31 (50)
T PF13533_consen   23 QVKKGDVLL   31 (50)
T ss_pred             EEcCCCEEE
Confidence            466666554


No 247
>TIGR00849 gutA PTS system, glucitol/sorbitol-specific IIA component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. This family consists only of glucitol-specific transporters, and occur both in Gram-negative and Gram-positive bacteria.The system in E.Coli consists of a IIA protein, and a IIBC protein. This family is specific for the IIA component.
Probab=21.10  E-value=2.7e+02  Score=18.74  Aligned_cols=13  Identities=15%  Similarity=0.299  Sum_probs=6.5

Q ss_pred             ceEEEECCEEEEE
Q psy12488         65 GTKIEVEGQELHL   77 (91)
Q Consensus        65 g~ev~~dg~~y~i   77 (91)
                      |..+.+|+++|.+
T Consensus        55 Gd~l~i~~~~Y~I   67 (121)
T TIGR00849        55 GQVFMIGGIAYPV   67 (121)
T ss_pred             CCEEEECCEEEEE
Confidence            3344455555554


No 248
>cd06813 PLPDE_III_DSD_D-TA_like_2 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 2. This subfamily is composed of uncharacterized bacterial proteins with similarity to eukaryotic D-serine dehydratases (DSD) and D-threonine aldolases (D-TA). DSD catalyzes the dehydration of D-serine to aminoacrylate, which is rapidly hydrolyzed to pyruvate and ammonia. D-TA reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. DSD and D-TA are fold type III PLP-dependent enzymes, similar to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on their similarity to AR, it is possible mem
Probab=21.06  E-value=1.2e+02  Score=23.76  Aligned_cols=37  Identities=24%  Similarity=0.432  Sum_probs=24.7

Q ss_pred             cccCCCEEEcCC-CCceEEEECCEEEEEEecCcEEEEee
Q psy12488         51 VVNVGDKVLLPK-FGGTKIEVEGQELHLFKEADLLAVIE   88 (91)
Q Consensus        51 ~VkvGD~Vlf~~-y~g~ev~~dg~~y~ii~~~DIlavi~   88 (91)
                      .+++||+|.|.. .++.-+..= .++++++...|.+++.
T Consensus       342 ~l~~gd~v~~r~~~~~~~~~~~-~~~~~~~~~~v~~~~~  379 (388)
T cd06813         342 RLGIGDPVWFRHAKAGELCERF-NELHLVRGGEIVGTVP  379 (388)
T ss_pred             cCCCCCEEEEecCCcchhhhhc-CeEEEEECCEEEEEEe
Confidence            489999999955 334333322 4677788888887653


No 249
>cd06821 PLPDE_III_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme D-Threonine Aldolase. D-threonine aldolase (D-TA, EC 4.3.1.18) reversibly catalyzes the aldol cleavage of D-threonine into glycine and acetaldehyde, and the synthesis of D-threonine from glycine and acetaldehyde. Its activity is present in several genera of bacteria but not in fungi. It requires PLP and a divalent cation such as Co2+, Ni2+, Mn2+, or Mg2+ as cofactors for catalytic activity and thermal stability. Members of this subfamily show similarity to bacterial alanine racemase (AR), a fold type III PLP-dependent enzyme which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on its similarity to AR, it is possible that low specificity D-TAs also form dimers in solution. Experimental data show that
Probab=20.96  E-value=1.7e+02  Score=22.18  Aligned_cols=36  Identities=8%  Similarity=0.090  Sum_probs=23.4

Q ss_pred             cccCCCEEEcCCCCc-eEEEECCEEEEEEecCcEEEEe
Q psy12488         51 VVNVGDKVLLPKFGG-TKIEVEGQELHLFKEADLLAVI   87 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g-~ev~~dg~~y~ii~~~DIlavi   87 (91)
                      .+++||+|.+-+... ..+..- ..|++++.+.+...+
T Consensus       315 ~~~vGd~v~~~p~H~c~t~~~~-~~~~~v~~~~v~~~w  351 (361)
T cd06821         315 RPEIGDVLYGIPRHICPTVALY-DEALVVRDGRIVGTW  351 (361)
T ss_pred             CCCCCCEEEEeCCCcCcchhcc-CEEEEEECCEEEEEE
Confidence            489999999966443 334322 457777877666554


No 250
>PF06865 DUF1255:  Protein of unknown function (DUF1255);  InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown; PDB: 2OYZ_A 3HQX_A.
Probab=20.90  E-value=86  Score=20.48  Aligned_cols=30  Identities=17%  Similarity=0.110  Sum_probs=16.9

Q ss_pred             eecceeEEecCCccccceeEEEEEEcCCee
Q psy12488         12 LLFPGGVLIPEKAQQEVNNAVVVAVGPGAR   41 (91)
Q Consensus        12 ~~T~~GI~LP~~~~~k~~~G~VVAVG~G~~   41 (91)
                      .+-.-|+++|..-.=.....++..|=.|..
T Consensus        23 ~~~TlGVm~pGeY~F~T~~~E~M~vvsG~l   52 (94)
T PF06865_consen   23 SKKTLGVMLPGEYTFGTSAPERMEVVSGEL   52 (94)
T ss_dssp             EEEEEEEE-SECEEEEESS-EEEEEEESEE
T ss_pred             CcceEEEEeeeEEEEcCCCCEEEEEEEeEE
Confidence            344568888877544455556666655654


No 251
>TIGR01694 MTAP 5'-deoxy-5'-methylthioadenosine phosphorylase. In between the trusted and noise cutoffs are: 1) several archaeal sequences which appear to contain several residues characteristic of phosphorylases which act on guanosine or inosine (according to the crystal structure of MTAP and alignments). In any case, these residues are not conserved. 2) sequences from Mycobacterium tuberculosis and Streptomyces coelicolor which have better, although not perfect retention of the active site residues, but considering the general observation that bacteria utilize the MTA/SAH nucleotidase enzyme and a kinase to do this reaction, these have been excluded pending stronger evidence of their function, and 3) a sequence from Drosophila which appears to be a recent divergence (long branch in neighbor-joining trees) and lacks some of the conserved active site residues.
Probab=20.78  E-value=88  Score=22.81  Aligned_cols=13  Identities=31%  Similarity=0.365  Sum_probs=11.1

Q ss_pred             cccCCCEEEcCCC
Q psy12488         51 VVNVGDKVLLPKF   63 (91)
Q Consensus        51 ~VkvGD~Vlf~~y   63 (91)
                      .+++||.|+-.++
T Consensus        91 ~l~~GDlVI~~~~  103 (241)
T TIGR01694        91 EYPPGDLVVPDQF  103 (241)
T ss_pred             CCCCCCEEEEhhH
Confidence            6999999998764


No 252
>PRK12426 elongation factor P; Provisional
Probab=20.77  E-value=1.5e+02  Score=21.43  Aligned_cols=40  Identities=18%  Similarity=0.303  Sum_probs=28.8

Q ss_pred             CCCeEecCcccCCCEEEcCCCCceEEEE---CCEEEEEEecCc
Q psy12488         43 PNGEYIKPVVNVGDKVLLPKFGGTKIEV---EGQELHLFKEAD   82 (91)
Q Consensus        43 ~~G~~~p~~VkvGD~Vlf~~y~g~ev~~---dg~~y~ii~~~D   82 (91)
                      .+|..+....+.||++--....-.+..|   ||..|+||..+.
T Consensus        45 ~tG~~~e~tf~s~ek~e~a~ve~~~~qylY~dg~~~~FMd~et   87 (185)
T PRK12426         45 DSDVVVERNFKAGQEVKEAQFEPRNLEYLYLEGDEYLFLDLGN   87 (185)
T ss_pred             CCCCeEEEEECCCCeEEEeEEEeeEeEEEEECCCeEEEecCCC
Confidence            5777777889999998765555455444   788888887653


No 253
>cd05828 Sortase_D_4 Sortase D (SrtD) is a membrane transpeptidase found in gram-positive bacteria that anchors surface proteins to peptidoglycans of the bacterial cell wall envelope. This involves a transpeptidation reaction in which the surface protein substrate is cleaved at the cell wall sorting signal and covalently linked to peptidoglycan for display on the bacterial surface. Sortases are grouped into different classes and subfamilies based on sequence, membrane topology, genomic positioning, and cleavage site preference. Class D sortases are further classified into subfamilies 4 and 5. This group contains a subset of Class D sortases belonging to subfamily-4. These sortases recognize a unique sorting signal (LPXTA) and they constitute a specialized sorting pathway found in bacilli. Their substrates are predicted to be predominantly enzymes such as 5'-nucleotidases, glycosyl hydrolase, and subtilase.
Probab=20.74  E-value=1.3e+02  Score=19.70  Aligned_cols=48  Identities=15%  Similarity=0.221  Sum_probs=25.3

Q ss_pred             eEEEEEEcCCeeCCCCeEecC-cccCCCEEEcCCCCceEEEECCEEEEEEecCc
Q psy12488         30 NAVVVAVGPGARTPNGEYIKP-VVNVGDKVLLPKFGGTKIEVEGQELHLFKEAD   82 (91)
Q Consensus        30 ~G~VVAVG~G~~~~~G~~~p~-~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~~~D   82 (91)
                      .|-+|=.|.-    +.-+..+ .+++||.|.+... +...+|.=.+...++.+|
T Consensus        43 ~gn~vIaGH~----~~~F~~L~~l~~Gd~i~v~~~-~~~~~Y~V~~~~~v~~~~   91 (127)
T cd05828          43 GGNIVIAGHR----DTHFRFLGELEPGDIITLQTL-GGTYTYRVTSTRIVDADD   91 (127)
T ss_pred             CCcEEEEEeC----chhhhChhcCCCCCEEEEEEC-CEEEEEEEeeEEEECccc
Confidence            4555555542    1223333 7899999999776 554444322333334333


No 254
>PF15436 PGBA_N:  Plasminogen-binding protein pgbA N-terminal
Probab=20.56  E-value=2.9e+02  Score=20.67  Aligned_cols=53  Identities=19%  Similarity=0.230  Sum_probs=30.5

Q ss_pred             eecceeEEecCC-ccccce--eEEEEEEcCCeeC--------CCCeEec---CcccCCCEEEcCCCC
Q psy12488         12 LLFPGGVLIPEK-AQQEVN--NAVVVAVGPGART--------PNGEYIK---PVVNVGDKVLLPKFG   64 (91)
Q Consensus        12 ~~T~~GI~LP~~-~~~k~~--~G~VVAVG~G~~~--------~~G~~~p---~~VkvGD~Vlf~~y~   64 (91)
                      ..-.||+++-.- ..-...  .+.|+++-.|...        -..+-.|   +..++||.|+|..+.
T Consensus        26 ~vG~SGiV~h~~~~~~~~IiA~a~V~~~~~g~A~~kf~~fd~L~Q~aLP~p~~~pk~GD~vil~~~Y   92 (218)
T PF15436_consen   26 KVGESGIVVHKFDKDHSSIIARAVVISKKNGVAKAKFSVFDSLKQDALPTPKMVPKKGDEVILNYLY   92 (218)
T ss_pred             ccCCceEEEEEecCCcceeeeEEEEEEecCCeeEEEEeehhhhhhhcCCCCccccCCCCEEEEeecc
Confidence            445789988655 223334  4445666555322        0111222   278999999998843


No 255
>PF07883 Cupin_2:  Cupin domain;  InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel). ; PDB: 2OPK_C 3BU7_B 2PHD_D 3NVC_A 3NKT_A 3NJZ_A 3NW4_A 3NST_A 3NL1_A 2H0V_A ....
Probab=20.54  E-value=98  Score=17.22  Aligned_cols=29  Identities=10%  Similarity=0.208  Sum_probs=18.8

Q ss_pred             cCcccCCCEEEcCCCCceEEEE-CCEEEEE
Q psy12488         49 KPVVNVGDKVLLPKFGGTKIEV-EGQELHL   77 (91)
Q Consensus        49 p~~VkvGD~Vlf~~y~g~ev~~-dg~~y~i   77 (91)
                      ...+++||.++++...--.+.- .++.+.+
T Consensus        38 ~~~l~~Gd~~~i~~~~~H~~~n~~~~~~~~   67 (71)
T PF07883_consen   38 RVELKPGDAIYIPPGVPHQVRNPGDEPARF   67 (71)
T ss_dssp             EEEEETTEEEEEETTSEEEEEEESSSEEEE
T ss_pred             EeEccCCEEEEECCCCeEEEEECCCCCEEE
Confidence            4589999999998875544433 3344443


No 256
>KOG2107|consensus
Probab=20.43  E-value=1.3e+02  Score=22.02  Aligned_cols=33  Identities=24%  Similarity=0.451  Sum_probs=27.0

Q ss_pred             eEEEEEEcCCeeC---CCCeEecCcccCCCEEEcCC
Q psy12488         30 NAVVVAVGPGART---PNGEYIKPVVNVGDKVLLPK   62 (91)
Q Consensus        30 ~G~VVAVG~G~~~---~~G~~~p~~VkvGD~Vlf~~   62 (91)
                      .-..+--|+|..+   .++..+...|+.||.|+++.
T Consensus        95 eiR~il~GtgYfDVrd~dd~WIRi~vekGDlivlPa  130 (179)
T KOG2107|consen   95 EIRYILEGTGYFDVRDKDDQWIRIFVEKGDLIVLPA  130 (179)
T ss_pred             heEEEeecceEEeeccCCCCEEEEEEecCCEEEecC
Confidence            4456667888755   67888999999999999997


No 257
>PRK11507 ribosome-associated protein; Provisional
Probab=20.42  E-value=2.1e+02  Score=17.65  Aligned_cols=15  Identities=13%  Similarity=0.523  Sum_probs=8.0

Q ss_pred             CCceEEEECCEEEEE
Q psy12488         63 FGGTKIEVEGQELHL   77 (91)
Q Consensus        63 y~g~ev~~dg~~y~i   77 (91)
                      |.|.-|+++|+.|.+
T Consensus        54 ~~GD~V~~~g~~~~v   68 (70)
T PRK11507         54 VAGQTVSFAGHSVQV   68 (70)
T ss_pred             CCCCEEEECCEEEEE
Confidence            444455556655554


No 258
>PRK02290 3-dehydroquinate synthase; Provisional
Probab=20.40  E-value=77  Score=25.32  Aligned_cols=19  Identities=32%  Similarity=0.461  Sum_probs=14.0

Q ss_pred             CCCeEecC-cccCCCEEEcC
Q psy12488         43 PNGEYIKP-VVNVGDKVLLP   61 (91)
Q Consensus        43 ~~G~~~p~-~VkvGD~Vlf~   61 (91)
                      ++|+.++. ++|+||.|+..
T Consensus       306 ~dG~~vsVt~Lk~GD~VL~~  325 (344)
T PRK02290        306 PDGKPVSVVDLKPGDEVLGY  325 (344)
T ss_pred             CCCCEeeeeecCCCCEEEEE
Confidence            35665554 89999999974


No 259
>PRK08564 5'-methylthioadenosine phosphorylase II; Reviewed
Probab=20.36  E-value=1.1e+02  Score=23.24  Aligned_cols=13  Identities=31%  Similarity=0.378  Sum_probs=11.5

Q ss_pred             cccCCCEEEcCCC
Q psy12488         51 VVNVGDKVLLPKF   63 (91)
Q Consensus        51 ~VkvGD~Vlf~~y   63 (91)
                      .+++||.|+..++
T Consensus        99 ~~~pGDlVv~~D~  111 (267)
T PRK08564         99 DYKPGDFVIPDQF  111 (267)
T ss_pred             CCCCCCEEeehhh
Confidence            6999999998885


No 260
>PRK09838 periplasmic copper-binding protein; Provisional
Probab=20.19  E-value=1.6e+02  Score=19.69  Aligned_cols=23  Identities=26%  Similarity=0.338  Sum_probs=15.0

Q ss_pred             cccCCCEEEcCCCCceEEEECCEEEEEEe
Q psy12488         51 VVNVGDKVLLPKFGGTKIEVEGQELHLFK   79 (91)
Q Consensus        51 ~VkvGD~Vlf~~y~g~ev~~dg~~y~ii~   79 (91)
                      .+++||+|.|      ++..++..|.+.+
T Consensus        88 ~lk~G~~V~F------~~~~~~~~~~i~~  110 (115)
T PRK09838         88 EIKTGDKVAF------NFVQQGNLSLLQD  110 (115)
T ss_pred             cCCCCCEEEE------EEEEcCCcEEEEE
Confidence            5788888876      3455666665543


No 261
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements. May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases.
Probab=20.08  E-value=1.9e+02  Score=16.44  Aligned_cols=39  Identities=23%  Similarity=0.313  Sum_probs=21.5

Q ss_pred             ceeEEecCCccccceeEEEEEEcCCeeCCCCeEecCcccCCCEEE
Q psy12488         15 PGGVLIPEKAQQEVNNAVVVAVGPGARTPNGEYIKPVVNVGDKVL   59 (91)
Q Consensus        15 ~~GI~LP~~~~~k~~~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vl   59 (91)
                      .-|+.+...... .....|..|.++..-..     ..+++||.|+
T Consensus        13 ~~G~~~~~~~~~-~~~~~V~~v~~~s~a~~-----~gl~~GD~I~   51 (82)
T cd00992          13 GLGFSLRGGKDS-GGGIFVSRVEPGGPAER-----GGLRVGDRIL   51 (82)
T ss_pred             CcCEEEeCcccC-CCCeEEEEECCCChHHh-----CCCCCCCEEE
Confidence            346666543221 23455666666553322     2589999886


No 262
>PRK05698 fliN flagellar motor switch protein; Validated
Probab=20.03  E-value=2.2e+02  Score=20.17  Aligned_cols=44  Identities=18%  Similarity=0.237  Sum_probs=27.0

Q ss_pred             eEEEEEEcCCeeCCCCeEecCcccCCCEEEcCCCCc--eEEEECCEEEE
Q psy12488         30 NAVVVAVGPGARTPNGEYIKPVVNVGDKVLLPKFGG--TKIEVEGQELH   76 (91)
Q Consensus        30 ~G~VVAVG~G~~~~~G~~~p~~VkvGD~Vlf~~y~g--~ev~~dg~~y~   76 (91)
                      .-..+.+|.-...-   +-=+.+++||.|.+....+  .+|.++|...+
T Consensus        81 V~lsveLG~t~itl---rdLL~L~~GDVI~Ldk~~~epv~V~VnG~~~f  126 (155)
T PRK05698         81 VSISMEVGSTDINI---RNLLQLNQGSVIELDRLAGEPLDVLVNGTLIA  126 (155)
T ss_pred             eEEEEEEecCcccH---HHHhCCCCCCEEEeCCCCCCCEEEEECCEEEE
Confidence            34455566543320   0113789999999988766  56777886443


No 263
>PF11963 DUF3477:  Protein of unknown function (DUF3477);  InterPro: IPR022570  This entry represents the N-terminal region of the coronovirus polyprotein, which contains non-structural protein 1 (Nsp1); the function of Nsp1 is not known.
Probab=20.02  E-value=44  Score=26.57  Aligned_cols=30  Identities=20%  Similarity=0.135  Sum_probs=25.0

Q ss_pred             cccccccceecceeEEecCCccccceeEEE
Q psy12488          4 SHNKLSIYLLFPGGVLIPEKAQQEVNNAVV   33 (91)
Q Consensus         4 ~~~k~~~e~~T~~GI~LP~~~~~k~~~G~V   33 (91)
                      .+|||..++.+.-|++-|.++|+.-..|+.
T Consensus        24 a~EkL~nP~~Se~~~~CpttaQ~~~~~g~~   53 (355)
T PF11963_consen   24 AEEKLDNPSSSEVGGVCPTTAQELETKGIT   53 (355)
T ss_pred             hHHhhCCCcccccCcccCchhhccccCcee
Confidence            578999999999999999999876555554


No 264
>PRK00529 elongation factor P; Validated
Probab=20.01  E-value=2.2e+02  Score=20.24  Aligned_cols=44  Identities=23%  Similarity=0.367  Sum_probs=24.4

Q ss_pred             ceeEEecCCccccceeEEEEEEcCCeeC------------CCC--eEecCcccCCCEEEcCCC
Q psy12488         15 PGGVLIPEKAQQEVNNAVVVAVGPGART------------PNG--EYIKPVVNVGDKVLLPKF   63 (91)
Q Consensus        15 ~~GI~LP~~~~~k~~~G~VVAVG~G~~~------------~~G--~~~p~~VkvGD~Vlf~~y   63 (91)
                      .-+|-||.+.     .=+|+..=|+.+.            ++|  -.+|+-++.||+|.++--
T Consensus       120 ~i~v~lP~~v-----~l~V~~t~p~~kg~t~~~~~K~A~letG~~v~VP~fI~~Gd~I~v~T~  177 (186)
T PRK00529        120 PISVELPNFV-----ELEVTETEPGVKGDTASGGTKPATLETGAVVQVPLFINEGEKIKVDTR  177 (186)
T ss_pred             EEEEECCCEE-----EEEEEECCCCccCcccCCCcccEEEcCCCEEEeCCeecCCCEEEEECC
Confidence            3466777653     4455555443332            334  236777777777766543


Done!