RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy1249
         (64 letters)



>gnl|CDD|188673 cd08718, RGS_RZ-like, Regulator of G protein signaling (RGS) domain
           found in the RZ protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RZ subfamily of the RGS protein family.  They are a
           diverse group of multifunctional proteins that regulate
           cellular signaling events downstream of G-protein
           coupled receptors (GPCRs). RGS proteins play critical
           regulatory roles as GTPase activating proteins (GAPs) of
           the heterotrimeric G-protein G-alpha-subunits.
           Deactivation of G-protein signaling is controlled by RGS
           domains, which accelerate GTPase activity of the alpha
           subunit by hydrolysis of GTP to GDP, which results in
           reassociation of the alpha-subunit with the
           beta-gamma-dimer and inhibition of downstream activity.
           As a major G-protein regulator, RGS domain containing
           proteins are involved in many crucial cellular processes
           such as regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis. The RZ subfamily of RGS proteins includes
           RGS17, RGS19 (former GAIP), RGS20, and its splice
           variant Ret-RGS.
          Length = 118

 Score = 77.5 bits (191), Expect = 1e-20
 Identities = 28/35 (80%), Positives = 32/35 (91%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYK 35
           M+ PS HTFD+AQLQIYTLMHRDSYPRF+NS +YK
Sbjct: 83  MLEPSPHTFDDAQLQIYTLMHRDSYPRFLNSAIYK 117


>gnl|CDD|188700 cd08746, RGS_RGS20, Regulator of G protein signaling (RGS) domain
           found in the RGS20 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS20 protein (also known as RGSZ1), a member of the RZ
           subfamily of the RGS protein family.  They are a diverse
           group of multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). RGS proteins play critical regulatory
           roles as GTPase activating proteins (GAPs) of the
           heterotrimeric G-protein G-alpha-subunits. Deactivation
           of G-protein signaling is controlled by the RGS domain,
           which accelerates GTPase activity of the alpha subunit
           by hydrolysis of GTP to GDP resulting in reassociation
           of the alpha-subunit with the beta-gamma-dimer and
           inhibition of downstream activity. As a major G-protein
           regulator, the RGS domain containing proteins are
           involved in many crucial cellular processes such as
           regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis. The RZ subfamily of RGS proteins include
           RGS17, RGS19 (former GAIP), and the splice variant of
           RGS20, Ret-RGS. RGS20 is expressed exclusively in brain,
           with the highest concentrations in the temporal lobe and
           the caudate nucleus and may play a role in signaling
           regulation in these brain regions. RGS20 acts as a GAP
           of both G-alpha-z and G-alpha-I and controls signaling
           in the mu opioid receptor pathway.
          Length = 167

 Score = 72.7 bits (178), Expect = 3e-18
 Identities = 28/35 (80%), Positives = 32/35 (91%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYK 35
           M+ PS HTFD+AQLQIYTLMHRDSYPRF+NS +YK
Sbjct: 132 MLEPSQHTFDDAQLQIYTLMHRDSYPRFMNSAIYK 166


>gnl|CDD|188699 cd08745, RGS_RGS19, Regulator of G protein signaling (RGS) domain
           found in the RGS19 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS19 protein (also known as GAIP), a member of the RZ
           subfamily of the RGS protein family. They are a diverse
           group of multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). RGS proteins play critical regulatory
           roles as GTPase activating proteins (GAPs) of the
           heterotrimeric G-protein G-alpha-subunits. Deactivation
           of G-protein signaling is controlled by RGS domains,
           which accelerate GTPase activity of the alpha subunit by
           hydrolysis of GTP to GDP, resulting in a reassociation
           of the alpha-subunit with the beta-gamma-dimer and an
           inhibition of downstream activity. As a major G-protein
           regulator, the RGS domain containing proteins are
           involved in many crucial cellular processes such as
           regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis. The RZ subfamily of RGS proteins includes
           RGS17, RGS20, and its splice variant Ret-RGS. RGS19
           participates in regulation of dopamine receptor D2R and
           D3R, as well as beta-adrenergic receptors .
          Length = 118

 Score = 67.0 bits (163), Expect = 2e-16
 Identities = 28/35 (80%), Positives = 32/35 (91%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYK 35
           M  PS+HTFD+AQLQIYTLMHRDSYPRF+NS +YK
Sbjct: 83  MQEPSSHTFDDAQLQIYTLMHRDSYPRFLNSPIYK 117


>gnl|CDD|188698 cd08744, RGS_RGS17, Regulator of G protein signaling (RGS) domain
           found in the RGS17 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS17 protein, a member of  the RZ subfamily of the RGS
           protein family.  They are a diverse group of
           multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). As a major G-protein regulator, the
           RGS domain containing proteins are involved in many
           crucial cellular processes such as regulation of
           intracellular trafficking, glial differentiation,
           embryonic axis formation, skeletal and muscle
           development, and cell migration during early
           embryogenesis. RGS proteins play critical regulatory
           roles as GTPase activating proteins (GAPs) of the
           heterotrimeric G-protein G-alpha-subunits. Deactivation
           of the G-protein signaling controlled by the RGS domain,
           which accelerates GTPase activity of the alpha subunit
           by hydrolysis of GTP to GDP, results in reassociation of
           the alpha-subunit with the beta-gamma-dimer and
           inhibition of downstream activity. The RZ subfamily of
           RGS proteins includes RGS19 (former GAIP), RGS20, and
           its splice variant Ret-RGS. RGS17 is a relatively
           non-selective GAP for G-alpha-z and other G-alpha-i/o
           proteins. RGS17 blocks dopamine receptor-mediated
           inhibition of cAMP accumulation; it also blocks
           thyrotropin releasing hormone-stimulated Ca++
           mobilization. RGS17, like other members of RZ subfamily,
           can act either as a GAP or as G-protein effector
           antogonist.
          Length = 118

 Score = 57.0 bits (137), Expect = 1e-12
 Identities = 22/35 (62%), Positives = 31/35 (88%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYK 35
           ++ P+ H +++AQLQIYTLMHRDS+PRF+NS +YK
Sbjct: 83  LLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYK 117


>gnl|CDD|188660 cd08705, RGS_R7-like, Regulator of G protein signaling (RGS) domain
           found in the R7 subfamily of proteins.  The RGS
           (Regulator of G-protein Signaling) domain is an
           essential part of the R7 (Neuronal RGS) protein
           subfamily of the RGS protein family, a diverse group of
           multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). As a major G-protein regulator, RGS
           domain containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis. The R7 subfamily
           includes RGS6, RGS7, RGS9, and RGS11, all of which, in
           humans, are expressed predominantly in the nervous
           system, form an obligatory complex with G-beta-5, and
           play important roles in the regulation of crucial
           neuronal processes. In addition, R7 proteins were found
           to bind many other proteins outside of the G protein
           signaling pathways including: m-opioid receptor,
           beta-arrestin, alpha-actinin-2, NMDAR, polycystin,
           spinophilin, guanylyl cyclase, among others.
          Length = 121

 Score = 56.1 bits (136), Expect = 3e-12
 Identities = 19/36 (52%), Positives = 25/36 (69%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
           +  P  +TFD AQ  IY LM +DSYPRF+ S +YK+
Sbjct: 86  LKDPHRYTFDAAQEHIYMLMKKDSYPRFLRSDIYKE 121


>gnl|CDD|216023 pfam00615, RGS, Regulator of G protein signaling domain.  RGS
           family members are GTPase-activating proteins for
           heterotrimeric G-protein alpha-subunits.
          Length = 117

 Score = 54.2 bits (131), Expect = 2e-11
 Identities = 19/35 (54%), Positives = 25/35 (71%)

Query: 3   SPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQL 37
            PS   FDEAQ ++Y LM +DSYPRF+ S +Y +L
Sbjct: 83  QPSPDLFDEAQEEVYDLMEKDSYPRFLKSPLYLRL 117


>gnl|CDD|188661 cd08706, RGS_R12-like, Regulator of G protein signaling (RGS)
           domain found in the R12 subfamily of proteins.  The RGS
           (Regulator of G-protein Signaling) domain is an
           essential part of the R12 (Neuronal RGS) protein
           subfamily of the RGS protein family, a diverse group of
           multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). RGS proteins play a critical
           regulatory role as GTPase activating proteins (GAPs) of
           the heterotrimeric G-protein G-alpha-subunits.
           Deactivation of G-protein signaling, controlled by RGS
           domain, accelerates GTPase activity of the alpha subunit
           by hydrolysis of GTP to GDP that results in
           reassociation of the alpha-subunit with the
           beta-gamma-dimer and thereby inhibition of downstream
           activity. As a major G-protein regulator, RGS domain
           containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis. The R12 RGS
           subfamily includes RGS10, RGS12 and RGS14 all of which
           are highly selective for G-alpha-i1 over G-alpha-q.
          Length = 113

 Score = 53.5 bits (129), Expect = 3e-11
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 3   SPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
            P    F + QLQI+ LM  DSY RF+ S +Y+Q
Sbjct: 80  EPHPDMFQKQQLQIFNLMKFDSYSRFLKSPLYQQ 113


>gnl|CDD|188668 cd08713, RGS_RGS3, Regulator of G protein signaling (RGS) domain
           found in the RGS3 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS3 protein. RGS3 is a member of the R4/RGS subfamily
           of the RGS family, a diverse group of multifunctional
           proteins that regulate cellular signaling events
           downstream of G-protein coupled receptors (GPCRs). As a
           major G-protein regulator, RGS domain containing
           proteins are involved in many crucial cellular processes
           such as regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis. RGS proteins play critical regulatory
           roles as GTPase activating proteins (GAPs) of the
           heterotrimeric G-protein G-alpha subunits. The RGS
           domain controls G-protein signaling by accelerating the
           GTPase activity of the G-alpha subunit which leads to G
           protein deactivation and promotes desensitization. As a
           major G-protein regulator, RGS domain containing
           proteins are involved in many crucial cellular
           processes. RGS3 induces apoptosis when overexpressed and
           is involved in cell migration through interaction with
           the Ephrin receptor. RGS3 exits as several splice
           isoforms and interacts with neuroligin, estrogen
           receptor-alpha, and 14-3-3 outside of the GPCR pathways.
          Length = 114

 Score = 51.4 bits (123), Expect = 2e-10
 Identities = 17/34 (50%), Positives = 24/34 (70%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVY 34
           + +P+   FD AQ +IY LM +DSYPRF+ S +Y
Sbjct: 79  LQNPTRGCFDLAQKRIYGLMEKDSYPRFLRSDLY 112


>gnl|CDD|188670 cd08715, RGS_RGS1, Regulator of G protein signaling (RGS) domain
           found in the RGS1 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS1 protein. RGS1 is a member of the R4/RGS subfamily
           of the RGS family, a diverse group of multifunctional
           proteins that regulate cellular signaling events
           downstream of G-protein coupled receptors (GPCRs). RGS
           proteins play critical regulatory roles as GTPase
           activating proteins (GAPs) of the heterotrimeric
           G-protein G-alpha subunits. The RGS domain controls
           G-protein signaling by accelerating the GTPase activity
           of the G-alpha subunit which leads to G protein
           deactivation and promotes desensitization. As a major
           G-protein regulator, RGS domain containing proteins are
           involved in many crucial cellular processes such as
           regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis.  RGS 1 is expressed predominantly in
           hematopoietic compartments, including T and B
           lymphocytes, and may play a major role in
           chemokine-mediated homing of lymphocytes to secondary
           lymphoid organs. In addition, RGS1 interacts with
           calmodulin and 14-3-3 protein outside of the GPCR
           pathway.
          Length = 114

 Score = 50.3 bits (120), Expect = 5e-10
 Identities = 20/34 (58%), Positives = 23/34 (67%)

Query: 4   PSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQL 37
           P+   FDEAQ  IY LM RDSYPRF+ S +Y  L
Sbjct: 81  PTPTCFDEAQKVIYILMERDSYPRFLKSDIYLNL 114


>gnl|CDD|214613 smart00315, RGS, Regulator of G protein signalling domain.  RGS
           family members are GTPase-activating proteins for
           heterotrimeric G-protein alpha-subunits.
          Length = 118

 Score = 48.4 bits (116), Expect = 2e-09
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 2   VSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQL 37
             P    FDEAQ ++Y L+ +DS+PRF+ S  Y + 
Sbjct: 83  EEPPPDLFDEAQREVYELLEKDSFPRFLESDYYLRF 118


>gnl|CDD|188694 cd08740, RGS_RGS11, Regulator of G protein signaling (RGS) domain
           found in the RGS11 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS11 protein, a member of R7 subfamily of the RGS
           protein family. RGS is a diverse group of
           multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). As a major G-protein regulator, RGS
           domain containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis. Other members of
           the R7 subfamily (Neuronal RGS) include: RGS6, RGS7, and
           RGS9, all of which are expressed predominantly in the
           nervous system, form an obligatory complex with
           G-beta-5, and play important roles in the regulation of
           crucial neuronal processes such as vision and motor
           control.  Additionally they have been implicated in many
           neurological conditions such as anxiety, schizophrenia,
           and drug dependence. RGS11 is expressed exclusively in
           retinal ON-bipolar neurons in which it forms complexes
           with G-beta-5  and  R7AP (RGS7 anchor protein ) and
           plays crucial roles in processing the light responses of
           retinal neurons.
          Length = 126

 Score = 48.8 bits (116), Expect = 3e-09
 Identities = 18/35 (51%), Positives = 24/35 (68%)

Query: 3   SPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQL 37
            P  +  D+AQ+ IY LM +DSYPRF+ S +YK L
Sbjct: 89  QPHRYVLDDAQMHIYMLMKKDSYPRFLKSDLYKNL 123


>gnl|CDD|188667 cd08712, RGS_RGS18, Regulator of G protein signaling (RGS) domain
           found in the RGS18 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS18 protein.  RGS18 is a member of the RGS protein
           family, a diverse group of multifunctional proteins that
           regulate cellular signaling events downstream of
           G-protein coupled receptors (GPCRs). RGS proteins play
           critical regulatory roles as GTPase activating proteins
           (GAPs) of the heterotrimeric G-protein G-alpha subunits.
           The RGS domain controls G-protein signaling by
           accelerating the GTPase activity of the G-alpha subunit
           which leads to G protein deactivation and promotes
           desensitization. As a major G-protein regulator, RGS
           domain containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis. RGS18 is a member
           of the R4/RGS subfamily and is expressed predominantly
           in osteoclasts where it acts as a negative regulator of
           the acidosis-induced osteoclastogenic OGR1/NFAT
           signaling pathway. RANKL (receptor activator of nuclear
           factor B ligand) stimulates osteoclastogenesis by
           inhibiting expression of RGS18.
          Length = 114

 Score = 47.2 bits (112), Expect = 7e-09
 Identities = 16/31 (51%), Positives = 23/31 (74%)

Query: 4   PSNHTFDEAQLQIYTLMHRDSYPRFINSTVY 34
           P+  +FD AQ ++Y LM +DSYPRF+ S +Y
Sbjct: 82  PTLTSFDAAQSRVYQLMEQDSYPRFLKSDIY 112


>gnl|CDD|188659 cd07440, RGS, Regulator of G protein signaling (RGS) domain
           superfamily.  The RGS domain is an essential part of the
           Regulator of G-protein Signaling (RGS) protein family, a
           diverse group of multifunctional proteins that regulate
           cellular signaling events downstream of G-protein
           coupled receptors (GPCRs). RGS proteins play critical
           regulatory roles as GTPase activating proteins (GAPs) of
           the heterotrimeric G-protein G-alpha-subunits. While
           inactive, G-alpha-subunits bind GDP, which is released
           and replaced by GTP upon agonist activation. GTP binding
           leads to dissociation of the alpha-subunit and the
           beta-gamma-dimer, allowing them to interact with
           effectors molecules and propagate signaling cascades
           associated with cellular growth, survival, migration,
           and invasion. Deactivation of the G-protein signaling
           controlled by the RGS domain accelerates GTPase activity
           of the alpha subunit by hydrolysis of GTP to GDP, which
           results in the reassociation of the alpha-subunit with
           the beta-gamma-dimer and thereby inhibition of
           downstream activity. As a major G-protein regulator, RGS
           domain containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis. RGS proteins are
           also involved in apoptosis and cell proliferation, as
           well as modulation of cardiac development. Several RGS
           proteins can fine-tune immune responses, while others
           play important roles in neuronal signals modulation.
           Some RGS proteins are principal elements needed for
           proper vision.
          Length = 113

 Score = 45.8 bits (109), Expect = 2e-08
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 4   PSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
           P    FDEAQ  I  L+ +DSYPRF+ S +Y +
Sbjct: 81  PDPDCFDEAQEHILNLLEKDSYPRFLKSDLYLK 113


>gnl|CDD|188678 cd08723, RGS_RGS21, Regulator of G protein signaling (RGS) domain
           found in the RGS21 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part RGS21
           protein, a member of RGS protein family. They are a
           diverse group of multifunctional proteins that regulate
           cellular signaling events downstream of G-protein
           coupled receptors (GPCRs). RGS proteins play critical
           regulatory roles as GTPase activating proteins (GAPs) of
           the heterotrimeric G-protein G-alpha-subunits. As a
           major G-protein regulator, RGS domain containing
           proteins are involved in many crucial cellular
           processes. RGS proteins regulate many aspects of
           embryonic development such as glial differentiation,
           embryonic axis formation, skeletal and muscle
           development, cell migration during early embryogenesis,
           apoptosis, and cell proliferation, as well as modulation
           of cardiac development.  RGS21 is a member of the R4/RGS
           subfamily and its mRNA was detected only in sensory
           taste cells that express sweet taste receptors and the
           taste G-alpha subunit, gustducin, suggesting a potential
           role in regulating taste transduction.
          Length = 111

 Score = 45.4 bits (107), Expect = 4e-08
 Identities = 19/33 (57%), Positives = 24/33 (72%)

Query: 4   PSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
           P+   FDEAQ  IY LM +DS+PRF+ S VYK+
Sbjct: 79  PTLKCFDEAQSLIYCLMAKDSFPRFLKSEVYKK 111


>gnl|CDD|188672 cd08717, RGS_RGS5, Regulator of G protein signaling (RGS) domain
           found in the RGS5 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS5 protein. RGS5 is member of the R4/RGS subfamily of
           the RGS family, a diverse group of multifunctional
           proteins that regulate cellular signaling events
           downstream of G-protein coupled receptors (GPCRs). RGS
           proteins play critical regulatory roles as GTPase
           activating proteins (GAPs) of the heterotrimeric
           G-protein G-alpha subunits. The RGS domain controls
           G-protein signaling by accelerating the GTPase activity
           of the G-alpha subunit which leads to G protein
           deactivation and promotes desensitization. As a major
           G-protein regulator, RGS domain containing proteins are
           involved in many crucial cellular processes such as
           regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis.  Two splice isoforms of RGS5 has been
           found: RGS5L (long) which is expressed in smooth muscle
           cells (pericytes) and heart and RGS5S (short) which is
           highly expressed in the ciliary body of the eye, kidney,
           brain, spleen, skeletal muscle, and small intestine.
           Outside of the GPCR pathway, RGS5 interacts with the
           14-3-3 protein.
          Length = 114

 Score = 45.4 bits (107), Expect = 5e-08
 Identities = 17/36 (47%), Positives = 26/36 (72%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
           +V PS+ +FD AQ +I+ LM +DS PRF+ S  Y++
Sbjct: 79  LVEPSSSSFDLAQKRIFALMEKDSLPRFVRSEFYQE 114


>gnl|CDD|188669 cd08714, RGS_RGS4, Regulator of G protein signaling (RGS) domain
           found in the RGS4 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS4 protein. RGS4 is a member of the R4/RGS subfamily
           of the RGS family, a diverse group of multifunctional
           proteins that regulate cellular signaling events
           downstream of G-protein coupled receptors (GPCRs). As a
           major G-protein regulator, RGS domain containing
           proteins are involved in many crucial cellular processes
           such as regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis. RGS proteins play critical regulatory
           roles as GTPase activating proteins (GAPs) of the
           heterotrimeric G-protein G-alpha subunits. The RGS
           domain controls G-protein signaling by accelerating the
           GTPase activity of the G-alpha subunit which leads to G
           protein deactivation and promotes desensitization. RGS4
           is expressed widely in brain including prefrontal
           cortex, striatum, locus coeruleus (LC), and hippocampus
           and has been implicated in regulation of opioid,
           cholinergic, and serotonergic signaling. Dysfunctions in
           RGS4 proteins are involved  in etiology of Parkinson's
           disease, addiction, and schizophrenia. RGS4 also is
           up-regulated in the failing human heart. RGS4 interacts
           with many binding partners outside of GPCR pathways,
           including calmodulin, COP, Kir3, PIP, calcium/CaM, PA,
           ErbB3, and 14-3-3.
          Length = 114

 Score = 44.9 bits (106), Expect = 6e-08
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVY 34
           M+ P+   FDEAQ +I+TLM +DSY RF+ S  Y
Sbjct: 79  MLEPTISCFDEAQKKIFTLMEKDSYRRFLKSRFY 112


>gnl|CDD|188671 cd08716, RGS_RGS13, Regulator of G protein signaling (RGS) domain
           found in the RGS13 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS13 protein. RGS13 is member of the R4/RGS subfamily
           of the RGS family, a diverse group of multifunctional
           proteins that regulate cellular signaling events
           downstream of G-protein coupled receptors (GPCRs). RGS
           proteins play critical regulatory roles as GTPase
           activating proteins (GAPs) of the heterotrimeric
           G-protein G-alpha subunits. The RGS domain controls
           G-protein signaling by accelerating the GTPase activity
           of the G-alpha subunit which leads to G protein
           deactivation and promotes desensitization. As a major
           G-protein regulator, RGS domain containing proteins are
           involved in many crucial cellular processes such as
           regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis.  RGS13 is predominantly expressed in T
           and B lymphocytes and in mast cells, and plays a role in
           adaptive immune responses. RGS13 also found in Rgs13,
           which is also expressed in dendritic cells and in
           neuroendocrine cells of the thymus, gastrointestinal,
           and respiratory tracts. Outside of the GPCR pathway,
           RGS5 interacts with the PIP3 protein.
          Length = 114

 Score = 44.1 bits (104), Expect = 1e-07
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 4   PSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
           P+   FDEAQ  +Y  M RDSYPRF+ S  Y++
Sbjct: 82  PTQSCFDEAQRIVYMHMERDSYPRFLESKFYQK 114


>gnl|CDD|188692 cd08738, RGS_RGS7, Regulator of G protein signaling (RGS) domain
           found in the RGS7 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS7 protein, a member of R7 subfamily of the RGS
           protein family. RGS is a diverse group of
           multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs).  As a major G-protein regulator, RGS
           domain containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis. As a major
           G-protein regulator, RGS domain containing proteins are
           involved in many crucial cellular processes such as
           regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis. Other members of the R7 subfamily
           (Neuronal RGS) include: RGS6, RGS9, and RGS11, all of
           which are expressed predominantly in the nervous system,
           form an obligatory complex with G-beta-5, and play
           important roles in the regulation of crucial neuronal
           processes such as vision and motor control.
           Additionally they have been implicated in many
           neurological conditions such as anxiety, schizophrenia,
           and drug dependence. R7 RGS proteins are key modulators
           of the pharmacological effects of drugs involved in the
           development of tolerance and addiction. In addition,
           RGS7 was found to bind a component of the synaptic
           fusion complex, snapin, and some other proteins outside
           of G protein signaling pathways.
          Length = 121

 Score = 43.6 bits (102), Expect = 3e-07
 Identities = 18/33 (54%), Positives = 24/33 (72%)

Query: 4   PSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
           P  +TF++AQ  IY LM  DSYPRFI S+ Y++
Sbjct: 89  PGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQE 121


>gnl|CDD|188691 cd08737, RGS_RGS6, Regulator of G protein signaling (RGS) domain
           found in the RGS6 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS6 protein, a member of R7 subfamily of the RGS
           protein family. RGS is a diverse group of
           multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). Other members of the R7 subfamily
           (Neuronal RGS) include: RGS7, RGS9, and RGS11, all of
           which are expressed predominantly in the nervous system,
           form an obligatory complex with G-beta-5, and play
           important roles in the regulation of crucial neuronal
           processes such as vision and motor control.
           Additionally they have been implicated in many
           neurological conditions such as anxiety, schizophrenia,
           and drug dependence. RGS6 exists in multiple splice
           isoforms with identical RGS domains, but possess
           complete or incomplete GGL domains and distinct N- and
           C-terminal domains. RGS6 interacts with SCG10, a
           neuronal growth-associated protein and therefore
           regulates neuronal differentiation. Another RGS6-binding
           protein is DMAP1, a component of the Dnmt1 complex
           involved in repression of newly replicated genes.
           Mutations of a critical residue required for interaction
           of RGS6 protein with G proteins did not affect the
           ability of RGS6 to interact with both SCG10 and DMAP1.
           As a major G-protein regulator, RGS domain containing
           proteins are involved in many crucial cellular processes
           such as regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis.
          Length = 125

 Score = 42.3 bits (99), Expect = 9e-07
 Identities = 17/34 (50%), Positives = 22/34 (64%)

Query: 4   PSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQL 37
           P  +TF++AQ  IY LM  DSY RF+ S  Y+ L
Sbjct: 90  PGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDL 123


>gnl|CDD|188693 cd08739, RGS_RGS9, Regulator of G protein signaling (RGS) domain
           found in the RGS9 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS9 protein, a member of R7 subfamily of the RGS
           protein family. RGS is a diverse group of
           multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). As a major G-protein regulator, RGS
           domain containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis.  Other members of
           the R7 subfamily (Neuronal RGS) include: RGS6, RGS7, and
           RGS11, all of which are expressed predominantly in the
           nervous system, form an obligatory complex with
           G-beta-5, and play important roles in the regulation of
           crucial neuronal processes such as vision and motor
           control.  Additionally they have been implicated in many
           neurological conditions such as anxiety, schizophrenia,
           and drug dependence. RGS9 forms constitutive complexes
           with G-beta-5 subunit and controls such fundamental
           functions as vision and behavior. RGS9 exists in two
           splice isoforms: RGS9-1 which regulates
           phototransduction in rods and cones and RGS9-2 which
           regulates dopamine and opioid signaling in the basal
           ganglia. In addition, RGS9 was found to bind many other
           proteins outside of G protein signaling pathways
           including: mu-opioid receptor, beta-arrestin,
           alpha-actinin-2, NMDAR, polycystin, spinophilin, and
           guanylyl cyclase, among others.
          Length = 121

 Score = 41.9 bits (98), Expect = 1e-06
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 4   PSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
           P  +  D AQ  IY LM +DSY R++ S +YK+
Sbjct: 89  PHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKE 121


>gnl|CDD|188666 cd08711, RGS_RGS8, Regulator of G protein signaling (RGS) domain
           found in the RGS8 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS8 protein. RGS8 is a member of R4/RGS subfamily of
           RGS family, a diverse group of multifunctional proteins
           that regulate cellular signaling events downstream of
           G-protein coupled receptors (GPCRs). RGS proteins play
           critical regulatory roles as GTPase activating proteins
           (GAPs) of the heterotrimeric G-protein G-alpha subunits.
           The RGS domain controls G-protein signaling by
           accelerating the GTPase activity of the G-alpha subunit
           which leads to G protein deactivation and promotes
           desensitization. As a major G-protein regulator, RGS
           domain containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis. RGS8 is involved
           in G-protein-gated potassium channels regulation and
           predominantly expressed in the brain. RGS8 also is
           selectively expressed in the hematopoietic system (NK
           cells).
          Length = 125

 Score = 41.6 bits (97), Expect = 1e-06
 Identities = 16/34 (47%), Positives = 25/34 (73%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVY 34
           +  PS   FD+AQ ++++LM +DSYPRF+ S +Y
Sbjct: 90  LQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMY 123


>gnl|CDD|188665 cd08710, RGS_RGS16, Regulator of G protein signaling (RGS) domain
           found in the RGS16 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS16 protein. RGS16 is a member of the RGS protein
           family, a diverse group of multifunctional proteins that
           regulate cellular signaling events downstream of
           G-protein coupled receptors (GPCRs). RGS proteins play
           critical regulatory roles as GTPase activating proteins
           (GAPs) of the heterotrimeric G-protein G-alpha subunits.
           The RGS domain controls G-protein signaling by
           accelerating the GTPase activity of the G-alpha subunit
           which leads to G protein deactivation and promotes
           desensitization. As a major G-protein regulator, RGS
           domain containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis. RGS16 is a member
           of the R4/RGS subfamily and interacts with neuronal
           G-alpha0. RGS16 expression is upregulated by IL-17 of
           the NF-kappaB signaling pathway in autoimmune B cells.
          Length = 114

 Score = 38.1 bits (88), Expect = 3e-05
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 9   FDEAQLQIYTLMHRDSYPRFINSTVYK 35
           FD AQ +  TLM +DSYPRF+ S  Y+
Sbjct: 87  FDVAQGKTRTLMEKDSYPRFLKSPAYR 113


>gnl|CDD|188697 cd08743, RGS_RGS14, Regulator of G protein signaling (RGS) domain
           found in the RGS14 protein.  RGS (Regulator of G-protein
           Signaling) domain is an essential part of the RGS14
           protein. RGS14 is a member of the RA/RGS subfamily of
           RGS proteins family, a diverse group of multifunctional
           proteins that regulate cellular signaling events
           downstream of G-protein coupled receptors (GPCRs). As a
           major G-protein regulator, RGS domain containing
           proteins are involved in many crucial cellular processes
           such as regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis. RGS14 belong to the R12 RGS subfamily,
           which includes RGS10 and RGS12, all of which are highly
           selective for G-alpha-i1 over G-alpha-q.  RGS14 binds
           and regulates the subcellular localization and
           activities of H-Ras and Raf  kinases in cells and
           thereby integrates G protein and Ras/Raf signaling
           pathways.
          Length = 129

 Score = 37.7 bits (87), Expect = 5e-05
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
           + +PS   F   QLQI+ LM  DSY RF+ S +Y+ 
Sbjct: 90  LATPSPDMFRAQQLQIFNLMKFDSYARFVKSPLYQD 125


>gnl|CDD|188664 cd08709, RGS_RGS2, Regulator of G protein signaling (RGS) domain
           found in the RGS2 protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           RGS2 protein. RGS2 is a member of R4/RGS subfamily of
           RGS family, a diverse group of multifunctional proteins
           that regulate cellular signaling events downstream of
           G-protein coupled receptors (GPCRs). RGS proteins play
           critical regulatory roles as GTPase activating proteins
           (GAPs) of the heterotrimeric G-protein G-alpha-subunits.
           The RGS domain controls G-protein signaling by
           accelerating the GTPase activity of the G- alpha subunit
           which leads to G protein deactivation and promotes
           desensitization. As a major G-protein regulator, RGS
           domain containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis. RGS2 plays
           important roles in the regulation of blood pressure and
           the pathogenesis of human hypertension, as well as in
           bone formation in osteoblasts. Outside of the GPCR
           pathway RGS2 interacts with calmodulin, beta- COP,
           tubulin, PKG1-alpha, and TRPV6.
          Length = 114

 Score = 37.0 bits (85), Expect = 8e-05
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 4   PSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
            ++  F  AQ ++Y+LM  +SYPRF+ S  Y++
Sbjct: 82  ATSGCFTAAQKRVYSLMENNSYPRFLESEFYQE 114


>gnl|CDD|188696 cd08742, RGS_RGS12, Regulator of G protein signaling (RGS) domain
           found in the RGS12 protein.  RGS (Regulator of G-protein
           Signaling) domain is an essential part of the RGS12
           protein. RGS12 is a member of the RA/RGS subfamily of
           RGS proteins family, a diverse group of multifunctional
           proteins that regulate cellular signaling events
           downstream of G-protein coupled receptors (GPCRs). As a
           major G-protein regulator, RGS domain containing
           proteins are involved in many crucial cellular processes
           such as regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis. RGS12 belong to the R12 RGS subfamily,
           which includes RGS10 and RGS14, all of which are highly
           selective for G-alpha-i1 over G-alpha-q.  RGS12 exist in
           multiple splice variants: RGS12s (short) contains the
           core RGS/RBD/GoLoco domains, while RGS12L (long) has
           additional N-terminal PDZ and PTB domains. RGS12 splice
           variants show distinct expression patterns, suggesting
           that they have discrete functions during mouse
           embryogenesis. RGS12 also may play a critical role in
           coordinating Ras-dependent signals that are required for
           promoting and maintaining neuronal differentiation.
          Length = 115

 Score = 36.6 bits (84), Expect = 1e-04
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 3   SPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
           +P    F E QLQI+ LM  DSY RF+ S +Y++
Sbjct: 82  APHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQE 115


>gnl|CDD|188662 cd08707, RGS_Axin, Regulator of G protein signaling (RGS) domain
           found in the Axin protein.  The RGS (Regulator of
           G-protein Signaling) domain is an essential part of the
           Axin protein. Axin is a member of the RA/RGS subfamily
           of the RGS protein family, a diverse group of
           multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). As a major G-protein regulator, RGS
           domain containing proteins are involved in many crucial
           cellular processes such as regulation of intracellular
           trafficking, glial differentiation, embryonic axis
           formation, skeletal and muscle development, and cell
           migration during early embryogenesis. RGS proteins
           regulate many aspects of embryonic development such as
           glial differentiation, embryonic axis formation, and
           skeletal and muscle development. The RGS domain of Axin
           is specifically interacts with the heterotrimeric
           G-alpha12 protein, but not with closely related
           G-alpha13, and provides a unique tool to regulate
           G-alpha12-mediated signaling processes. The RGS domain
           of Axin also interacts with the tumor suppressor protein
           APC (Adenomatous Polyposis Coli) in order to control the
           cytoplasmic level of the proto-oncogene, beta-catenin.
          Length = 117

 Score = 36.7 bits (85), Expect = 1e-04
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 4   PSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
                FD+AQ +I T M  ++YP F+ S +Y +
Sbjct: 85  LDPAMFDQAQTEIQTTMEENTYPSFLKSDIYLE 117


>gnl|CDD|188674 cd08719, RGS_SNX13, Regulator of G protein signaling (RGS) domain
           found in the Sorting Nexin 13 (SNX13) protein.  The RGS
           (Regulator of G-protein Signaling) domain is an
           essential part of the SNX13 (Sorting Nexin 13) protein,
           a member of  the RGS protein family.  They are a diverse
           group of multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). RGS proteins regulate many aspects of
           embryonic development such as glial differentiation,
           embryonic axis formation, skeletal and muscle
           development, cell migration during early embryogenesis,
           as well as apoptosis, cell proliferation, and modulation
           of cardiac development. The RGS-domain of SNX13 plays a
           major role through attenuation of Galphas-mediated
           signaling and regulates endocytic trafficking and
           degradation of the epidermal growth factor receptor.
           Snx13-null mice were embryonic lethal around
           midgestation which supports an essential role for SNX13
           in mouse development and regulation of endocytosis
           dynamics.
          Length = 135

 Score = 30.8 bits (70), Expect = 0.016
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 4   PSNHTFDEAQLQIYTLMHRDS--YPRFINSTVY 34
           PS+  FD+ Q +++ +M  D   YP F  S  Y
Sbjct: 101 PSDLWFDDIQQKVFDIMQEDERFYPAFKKSPAY 133


>gnl|CDD|188695 cd08741, RGS_RGS10, Regulator of G protein signaling (RGS) domain
           found in the RGS10 protein.  RGS (Regulator of G-protein
           Signaling) domain is an essential part of the RGS10
           protein. RGS10 is a member of the RA/RGS subfamily of
           RGS proteins family, a diverse group of multifunctional
           proteins that regulate cellular signaling events
           downstream of G-protein coupled receptors (GPCRs). As a
           major G-protein regulator, RGS domain containing
           proteins are involved in many crucial cellular processes
           such as regulation of intracellular trafficking, glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, and cell migration during early
           embryogenesis. RGS10 belong to the R12 RGS subfamily,
           which includes RGS12 and RGS14, all of which are highly
           selective for G-alpha-i1 over G-alpha-q. RGS10 exists in
           2 splice isoforms. RGS10A is specifically expressed in
           osteoclasts and is a key component in the RANKL
           signaling mechanism for osteoclast differentiation,
           whereas RGS10B expressed in brain and in immune tissues
           and  has been implicated in diverse processes including:
           promoting of  dopaminergic neuron survival via
           regulation of the microglial inflammatory response,
           modulation of presynaptic and postsynaptic G-protein
           signalling, as well as a possible role in regulation of
           gene expression.
          Length = 113

 Score = 30.4 bits (68), Expect = 0.021
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 3   SPSNHTFDEAQLQIYTLMHRDSYPRFINSTVY 34
            P    F + Q QI+ LM  DSY RF+ S ++
Sbjct: 80  EPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLF 111


>gnl|CDD|188675 cd08720, RGS_SNX25, Regulator of G protein signaling (RGS) domain
           found in the Sorting Nexin 25 (SNX25) protein.  The RGS
           (Regulator of G-protein Signaling) domain is an
           essential part of the SNX25 (Sorting Nexin 25) protein,
           a member of  the RGS protein family. They are a diverse
           group of multifunctional proteins that regulate cellular
           signaling events downstream of G-protein coupled
           receptors (GPCRs). RGS proteins regulate many aspects of
           embryonic development such as glial differentiation,
           embryonic axis formation, skeletal and muscle
           development, cell migration during early embryogenesis,
           as well as apoptosis, cell proliferation, and modulation
           of cardiac development. SNX25 is a member of the
           Dopamine receptors (DAR) signalplex and regulates the
           trafficking of D1 and D2 DARs.
          Length = 110

 Score = 25.8 bits (57), Expect = 1.3
 Identities = 10/28 (35%), Positives = 13/28 (46%)

Query: 9   FDEAQLQIYTLMHRDSYPRFINSTVYKQ 36
           F E Q  +   +    YP F+ S  YKQ
Sbjct: 83  FYEVQENVVETLEEKYYPSFVVSDQYKQ 110


>gnl|CDD|151468 pfam11021, DUF2613, Protein of unknown function (DUF2613).  This
          is a family of putative small secreted proteins
          expressed by Actinobacteria. The function is not known.
          Length = 56

 Score = 24.3 bits (53), Expect = 2.0
 Identities = 8/22 (36%), Positives = 12/22 (54%)

Query: 37 LAQLDSSPGDTGGNSDSSTPAR 58
          + Q DS P    G++DS+   R
Sbjct: 29 MVQQDSRPSIQAGDADSALLNR 50


>gnl|CDD|188676 cd08721, RGS_AKAP2_2, Regulator of G protein signaling (RGS) domain
           2 found in the A-kinase anchoring protein, D-AKAP2.  The
           RGS (Regulator of G-protein Signaling) domain is an
           essential part of the D-AKAP2 (A-kinase anchoring
           protein), a member of the RGS protein family. They are a
           diverse group of multifunctional proteins that regulate
           cellular signaling events downstream of G-protein
           coupled receptors (GPCRs). RGS proteins regulate many
           aspects of embryonic development such as glial
           differentiation, embryonic axis formation, skeletal and
           muscle development, cell migration during early
           embryogenesis, as well as apoptosis, cell proliferation,
           and modulation of cardiac development. D-AKAP2 contains
           two RGS domains which play an important role in
           spatiotemporal localization of cAMP-dependent PKA
           (cyclic AMP-dependent protein kinase) that regulates
           many different signaling pathways by phosphorylation of
           target proteins. This cd contains the second RGS domain.
          Length = 121

 Score = 25.0 bits (55), Expect = 2.5
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 9   FDEAQLQIYTLMHRDSYPRFINSTVY 34
           F+   LQ  T + +   P F++S +Y
Sbjct: 94  FEAPLLQALTTLEQHYLPGFLSSQLY 119


>gnl|CDD|181836 PRK09416, lstR, lineage-specific thermal regulator protein;
          Provisional.
          Length = 135

 Score = 24.7 bits (54), Expect = 3.2
 Identities = 11/25 (44%), Positives = 15/25 (60%)

Query: 7  HTFDEAQLQIYTLMHRDSYPRFINS 31
           TF+  +  +YTL+HR    RFI S
Sbjct: 71 LTFEGNEGSLYTLLHRLEQNRFIQS 95


>gnl|CDD|176913 cd08904, START_STARD6-like, Lipid-binding START domain of mammalian
           STARD6 and related proteins.  This subgroup includes the
           steroidogenic acute regulatory protein (StAR)-related
           lipid transfer (START) domains of mammalian STARD6 and
           related domains. It belongs to the START domain family,
           and in turn to the SRPBCC
           (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain
           superfamily of proteins that bind hydrophobic ligands.
           SRPBCC domains have a deep hydrophobic ligand-binding
           pocket. STARD6 is expressed in male germ cells of normal
           rats, and in the steroidogenic Leydig cells of
           perinatal hypothyroid testes. It may play a pivotal role
           in the steroidogenesis as well as in the spermatogenesis
           of normal rats. STARD6 has also been detected in the rat
           nervous system, and may participate in neurosteroid
           synthesis.
          Length = 204

 Score = 24.5 bits (53), Expect = 4.5
 Identities = 13/46 (28%), Positives = 20/46 (43%)

Query: 1   MVSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYKQLAQLDSSPGD 46
           M  P +    +  LQ+Y ++ R     FI  T+ +  A    SP D
Sbjct: 65  MYQPEHRIKWDKSLQVYKMLQRIDSDTFICHTITQSFAMGSISPRD 110


>gnl|CDD|163651 cd07408, MPP_SA0022_N, Staphylococcus aureus SA0022 and related
           proteins, N-terminal metallophosphatase domain.  SA0022
           is an uncharacterized Staphylococcus aureus UshA-like
           protein with two putative domains, an N-terminal
           metallophosphatase domain and  a C-terminal nucleotidase
           domain.  SA0022 also contains a putative C-terminal cell
           wall anchor domain.  The N-terminal metallophosphatase
           domain belongs to a large superfamily of distantly
           related metallophosphatases (MPPs) that includes:
           Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat
           debranching enzymes, YfcE-like phosphodiesterases,
           purple acid phosphatases (PAPs), YbbF-like
           UDP-2,3-diacylglucosamine hydrolases, and acid
           sphingomyelinases (ASMases).  MPPs are functionally
           diverse, but all share a conserved domain with an active
           site consisting of two metal ions (usually manganese,
           iron, or zinc) coordinated with octahedral geometry by a
           cage of histidine, aspartate, and asparagine residues.
           The conserved domain is a double beta-sheet sandwich
           with a di-metal active site made up of residues located
           at the C-terminal side of the sheets. This domain is
           thought to allow for productive metal coordination.
          Length = 257

 Score = 24.2 bits (53), Expect = 5.9
 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 2   VSPSNHTFDEAQLQIYTLMHRDSYPRFINSTVYK 35
           V+P NH FD    ++  L     +P F+++ VY 
Sbjct: 74  VTPGNHEFDYGLDRLKELSKEADFP-FLSANVYD 106


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.308    0.122    0.339 

Gapped
Lambda     K      H
   0.267   0.0750    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 2,959,790
Number of extensions: 187829
Number of successful extensions: 122
Number of sequences better than 10.0: 1
Number of HSP's gapped: 122
Number of HSP's successfully gapped: 37
Length of query: 64
Length of database: 10,937,602
Length adjustment: 35
Effective length of query: 29
Effective length of database: 9,385,212
Effective search space: 272171148
Effective search space used: 272171148
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 53 (24.2 bits)