Diaphorina citri psyllid: psy12509


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
MFRLKSVLGSHKPSAFKAAFSTRLFSVLRFESVIHEFDPYFNYRTTKFLVEEGYYKFHNWFDDRAWYPLGRIIGGTIYPGLMVTSAVLYHLMWLLNITIDIRNVCVFLAPFFSSLTTIVTYLLTKEVKDTGSGLVAAAMISIVPGYISRSVAGSYDNEAIAIFCMLLTYYSWIKAVKTGSILWSALTALAYFYM
ccCEHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcc
****KSVLGSHKPSAFKAAFSTRLFSVLRFESVIHEFDPYFNYRTTKFLVEEGYYKFHNWFDDRAWYPLGRIIGGTIYPGLMVTSAVLYHLMWLLNITIDIRNVCVFLAPFFSSLTTIVTYLLTKEVKDTGSGLVAAAMISIVPGYISRSVAGSYDNEAIAIFCMLLTYYSWIKAVKTGSILWSALTALAYFYM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRLKSVLGSHKPSAFKAAFSTRLFSVLRFESVIHEFDPYFNYRTTKFLVEEGYYKFHNWFDDRAWYPLGRIIGGTIYPGLMVTSAVLYHLMWLLNITIDIRNVCVFLAPFFSSLTTIVTYLLTKEVKDTGSGLVAAAMISIVPGYISRSVAGSYDNEAIAIFCMLLTYYSWIKAVKTGSILWSALTALAYFYM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3A seems to be involved in complex substrate specificity.confidentP46977
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3A seems to be involved in complex substrate specificity.confidentP46978
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). SST3A seems to be involved in complex substrate specificity.confidentQ2KJI2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008250 [CC]oligosaccharyltransferase complexprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0018279 [BP]protein N-linked glycosylation via asparagineprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0006487, GO:0018196, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0004579 [MF]dolichyl-diphosphooligosaccharide-protein glycotransferase activityprobableGO:0003674, GO:0003824, GO:0016740, GO:0004576, GO:0016757, GO:0016758
GO:0006986 [BP]response to unfolded proteinprobableGO:0050896, GO:0006950, GO:0035966, GO:0008150, GO:0042221, GO:0010033
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0006516 [BP]glycoprotein catabolic processprobableGO:0044238, GO:1901575, GO:0044265, GO:0044260, GO:0019538, GO:1901136, GO:1901135, GO:0009987, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0009056, GO:0009100, GO:0009057
GO:0035220 [BP]wing disc developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0043687 [BP]post-translational protein modificationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0043686 [BP]co-translational protein modificationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0022416 [BP]chaeta developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0030433 [BP]ER-associated protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RCE, chain A
Confidence level:very confident
Coverage over the Query: 16-192
View the alignment between query and template
View the model in PyMOL