Diaphorina citri psyllid: psy12523


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540----
MGSQDNKGIIPRLCDSLFDLIAKQESSELTYNPYIRTPIRKYEMIYSCRVSMLKMIYGLKASNSTHAVFSVVLTQTLVDTKSGVEGEKVARLSLVDLAGSERAVKTGAVGERLKEGSNINKQEALESMGISVQASGIKVEKNKYYLVNLNADPSLNELLVYYLKDCTLIGSSDKNDIQLSGNLKINFGLFFCFQVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQEIDSLMAEGNKSRTVAATNMNSESSRSHAVFSVVLTQTLVDTKSGVEGEKVARLSLVDLASEEIDSLMAEGNKSRTVAATNMNSESSRSHAVFSVVLTQTLVDTKSGVEGEKVARLSLVDLAGSERAVKTGAVGERLKEGSNINKSLTTLGLVISKLADSTSSSKNKDKFVPYRDSVLTWLLKDNLGGNSKTVMVATVSPAADNYEETLSTLRYADRAKRIVNHAVDNLGGNSKTVMVATVSPAADNYEETLSTLRYADRAKRIVNHAVVNEDPNARIIRELRQEVDKLKEMLISAGVPHGAKYLLISQASR
ccccccccccHHHHHHHHHHHHHccccccccccEEEccccccccccccHHHHHHHHHccccccccccEEEEEEEEEECccccccccEEEEEEEccccccccccccccccccccccccccccccccccccEEEEEEccccccccEEEcccccccccccccccHHHHccccccccccccccccCECccHHHHccccccccccccccccccCEEEccccccccccccHHHHHHHHHHHHHHHccccEEEEECcCEEEEcccccccccccccccEECcccccccccccccccccccHHHHHHHHHHccccccHHcccccccccccEEEEEEEEEEEECccccccccEEEEEEEEEEcccccccccccccccccccccccccHHcccccHHHHcccccccccccccccccccHHHHHHHHcccccccHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcc
*****NKGIIPRLCDSLFDLIAKQESSELTYNPYIRTPIRKYEMIYSCRVSMLKMIYGLKASNSTHAVFSVVLTQTLVDTKSGVEGEKVARLSLVDLAGSERAVKTGAVGERLKEGSNINKQEALESMGISVQASGIKVEKNKYYLVNLNADPSLNELLVYYLKDCTLIGSSDKNDIQLSGNLKINFGLFFCFQVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQEIDSLMAEGNKSRTVAATNMNSESSRSHAVFSVVLTQTLVDTKSGVEGEKVARLSLVDLASEEIDSLMAEGNKSRTVAATNMNSESSRSHAVFSVVLTQTLVDTKSGVEGEKVARLSLVDLAG**************KEGSNINKSLTTLGLVISKLA***********FVPYRDSVLTWLLKDNLGGNSKTVMVATVSPAADNYEETLSTLRYADRAKRIVNHAVDNLGGNSKTVMVATVSPAADNYEETLSTLRYADRAKRIVNHAVVNEDPNARIIRELRQEVDKLKEMLISA****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSQDNKGIIPRLCDSLFDLIAKQESSELTYNPYIRTPIRKYEMIYSCRVSMLKMIYGLKASNSTHAVFSVVLTQTLVDTKSGVEGEKVARLSLVDLAGSERAVKTGAVGERLKEGSNINKQEALESMGISVQASGIKVEKNKYYLVNLNADPSLNELLVYYLKDCTLIGSSDKNDIQLSGNLKINFGLFFCFQVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQEIDSLMAEGNKSRTVAATNMNSESSRSHAVFSVVLTQTLVDTKSGVEGEKVARLSLVDLASEEIDSLMAEGNKSRTVAATNMNSESSRSHAVFSVVLTQTLVDTKSGVEGEKVARLSLVDLAGSERAVKTGAVGERLKEGSNINKSLTTLGLVISKLADSTSSSKNKDKFVPYRDSVLTWLLKDNLGGNSKTVMVATVSPAADNYEETLSTLRYADRAKRIVNHAVDNLGGNSKTVMVATVSPAADNYEETLSTLRYADRAKRIVNHAVVNEDPNARIIRELRQEVDKLKEMLISAGVPHGAKYLLISQASR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kinesin-like protein KIF13A Plus end-directed microtubule-dependent motor protein involved in intracellular transport and regulating various processes such as mannose-6-phosphate receptor (M6PR) transport to the plasma membrane, endosomal sorting during melanosome biogenesis and cytokinesis. During melanosome maturation, required for delivering melanogenic enzymes from recycling endosomes to nascent melanosomes by creating peripheral recycling endosomal subdomains in melanocytes. Also required for the abcission step in cytokinesis: mediates translocation of ZFYVE26, and possibly TTC19, to the midbody during cytokinesis (By similarity). Mediates the transport of M6PR-containing vesicles from trans-Golgi network to the plasma membrane via direct interaction with the AP-1 complex.confidentQ9EQW7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0003777 [MF]microtubule motor activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774
GO:0005876 [CC]spindle microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0010008 [CC]endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0071889 [MF]14-3-3 protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0022402 [BP]cell cycle processprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0051640 [BP]organelle localizationprobableGO:0009987, GO:0008150, GO:0044763, GO:0051179, GO:0044699, GO:0051641
GO:0050770 [BP]regulation of axonogenesisprobableGO:0022604, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0006996 [BP]organelle organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0010970 [BP]microtubule-based transportprobableGO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0006928, GO:0044765, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0030705, GO:0051179, GO:0044699, GO:0051641
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0071822 [BP]protein complex subunit organizationprobableGO:0043933, GO:0008150, GO:0071840, GO:0016043
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B6U, chain A
Confidence level:very confident
Coverage over the Query: 122-271,340-356,367-411,455-504
View the alignment between query and template
View the model in PyMOL
Template: 2OWM, chain A
Confidence level:very confident
Coverage over the Query: 122-271,341-358,373-391,445-504
View the alignment between query and template
View the model in PyMOL
Template: 3GBJ, chain A
Confidence level:very confident
Coverage over the Query: 1-137
View the alignment between query and template
View the model in PyMOL
Template: 1IA0, chain K
Confidence level:very confident
Coverage over the Query: 280-357,373-457
View the alignment between query and template
View the model in PyMOL