Query         psy12524
Match_columns 151
No_of_seqs    131 out of 1087
Neff          8.2 
Searched_HMMs 46136
Date          Fri Aug 16 21:33:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12524.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12524hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4280|consensus              100.0 6.2E-42 1.3E-46  285.6   9.8  141    1-150    49-190 (574)
  2 cd01370 KISc_KIP3_like Kinesin 100.0 5.5E-40 1.2E-44  263.5  17.0  139    2-150    52-190 (338)
  3 cd01365 KISc_KIF1A_KIF1B Kines 100.0   1E-39 2.2E-44  263.6  18.2  149    2-150    46-195 (356)
  4 KOG0245|consensus              100.0 2.5E-41 5.4E-46  290.8   8.2  149    2-150    45-195 (1221)
  5 KOG0242|consensus              100.0 4.5E-40 9.8E-45  281.7  13.6  137    3-150    52-188 (675)
  6 cd01368 KISc_KIF23_like Kinesi 100.0 3.6E-39 7.9E-44  259.4  17.3  135    2-150    53-191 (345)
  7 cd01373 KISc_KLP2_like Kinesin 100.0 4.8E-39   1E-43  258.0  17.3  140    2-150    39-189 (337)
  8 cd01367 KISc_KIF2_like Kinesin 100.0 9.8E-39 2.1E-43  254.8  14.9  135    3-150    50-184 (322)
  9 cd01376 KISc_KID_like Kinesin  100.0 6.9E-38 1.5E-42  249.6  16.8  137    2-150    45-181 (319)
 10 cd01374 KISc_CENP_E Kinesin mo 100.0 1.2E-37 2.7E-42  248.3  17.1  138    2-150    38-175 (321)
 11 cd01371 KISc_KIF3 Kinesin moto 100.0 1.4E-37 2.9E-42  249.2  16.4  139    2-150    46-187 (333)
 12 KOG0243|consensus              100.0   1E-38 2.3E-43  277.2  10.0  138    3-150    94-245 (1041)
 13 KOG0241|consensus              100.0 1.1E-38 2.4E-43  272.7   8.8  150    1-150    50-199 (1714)
 14 cd01375 KISc_KIF9_like Kinesin 100.0 4.4E-37 9.5E-42  246.4  16.2  139    2-150    46-191 (334)
 15 PF00225 Kinesin:  Kinesin moto 100.0 3.6E-37 7.7E-42  246.5  14.8  142    2-150    39-186 (335)
 16 cd01369 KISc_KHC_KIF5 Kinesin  100.0 8.4E-37 1.8E-41  243.8  16.3  139    2-150    41-182 (325)
 17 PLN03188 kinesin-12 family pro 100.0 3.9E-37 8.4E-42  270.3  15.6  139    3-150   131-283 (1320)
 18 cd01366 KISc_C_terminal Kinesi 100.0 1.7E-36 3.7E-41  242.3  18.0  141    2-150    43-184 (329)
 19 cd01372 KISc_KIF4 Kinesin moto 100.0 8.4E-37 1.8E-41  245.2  15.8  140    3-150    39-185 (341)
 20 cd01364 KISc_BimC_Eg5 Kinesin  100.0 1.3E-36 2.7E-41  245.2  16.5  139    2-150    46-198 (352)
 21 cd00106 KISc Kinesin motor dom 100.0 4.1E-36 8.9E-41  239.8  18.0  142    2-150    43-184 (328)
 22 smart00129 KISc Kinesin motor, 100.0 2.9E-35 6.3E-40  235.6  17.6  139    2-150    44-182 (335)
 23 KOG0240|consensus              100.0 3.3E-36 7.1E-41  247.6  11.9  138    3-150    48-188 (607)
 24 KOG0239|consensus              100.0 3.1E-35 6.8E-40  251.4   9.9  137    5-150   361-498 (670)
 25 KOG0246|consensus              100.0 1.1E-31 2.4E-36  221.0  12.4  137    4-150   258-400 (676)
 26 COG5059 KIP1 Kinesin-like prot 100.0 1.5E-30 3.2E-35  220.6   9.9  138    3-150    55-192 (568)
 27 KOG0247|consensus              100.0 7.2E-31 1.6E-35  221.0   7.7  141    3-150    80-287 (809)
 28 KOG0244|consensus               99.9   2E-26 4.3E-31  198.4   6.1  138    2-149    30-171 (913)
 29 cd01363 Motor_domain Myosin an  99.6 1.7E-14 3.6E-19  107.0  10.2   57   28-85      8-64  (186)
 30 PF00308 Bac_DnaA:  Bacterial d  96.1  0.0021 4.6E-08   48.8   0.7   50    5-64      4-53  (219)
 31 COG0556 UvrB Helicase subunit   95.6    0.03 6.6E-07   47.9   5.7   82   20-107    12-100 (663)
 32 PRK06620 hypothetical protein;  94.9   0.017 3.7E-07   43.8   2.1   50    4-64     11-63  (214)
 33 PRK06893 DNA replication initi  94.6    0.03 6.5E-07   42.7   2.8   23   42-64     36-58  (229)
 34 PRK09087 hypothetical protein;  94.3   0.032 6.8E-07   42.6   2.3   20   45-64     44-63  (226)
 35 PRK14086 dnaA chromosomal repl  93.5    0.04 8.7E-07   48.0   1.7   39   24-64    295-333 (617)
 36 COG1474 CDC6 Cdc6-related prot  93.5    0.24 5.3E-06   40.6   6.2   37   26-62     23-59  (366)
 37 COG2805 PilT Tfp pilus assembl  93.1    0.05 1.1E-06   43.6   1.6   30   33-62    113-142 (353)
 38 PRK08084 DNA replication initi  93.1   0.081 1.8E-06   40.5   2.6   19   46-64     46-64  (235)
 39 PRK12377 putative replication   92.9    0.14 3.1E-06   39.7   3.7   40   23-64     81-120 (248)
 40 PRK08181 transposase; Validate  92.7   0.087 1.9E-06   41.4   2.4   18   47-64    108-125 (269)
 41 TIGR02928 orc1/cdc6 family rep  92.7     0.1 2.2E-06   42.1   2.8   39   23-62     18-57  (365)
 42 PRK00411 cdc6 cell division co  92.7    0.12 2.5E-06   42.2   3.2   39   23-62     33-72  (394)
 43 PRK06526 transposase; Provisio  92.7   0.057 1.2E-06   42.0   1.3   49   11-64     69-117 (254)
 44 PRK05642 DNA replication initi  92.4   0.089 1.9E-06   40.2   2.1   19   46-64     46-64  (234)
 45 TIGR00362 DnaA chromosomal rep  92.4     0.1 2.2E-06   43.0   2.5   40   23-64    116-155 (405)
 46 PRK08116 hypothetical protein;  92.3    0.12 2.6E-06   40.4   2.8   42   22-64     90-133 (268)
 47 cd00009 AAA The AAA+ (ATPases   92.3    0.12 2.6E-06   34.8   2.5   25   38-62     12-36  (151)
 48 COG0593 DnaA ATPase involved i  92.1    0.11 2.3E-06   43.3   2.3   66    5-80     83-155 (408)
 49 PRK00149 dnaA chromosomal repl  92.1     0.1 2.2E-06   43.7   2.2   39   24-64    129-167 (450)
 50 PRK14088 dnaA chromosomal repl  91.6    0.13 2.8E-06   43.2   2.3   38   23-64    111-149 (440)
 51 PRK07952 DNA replication prote  91.3    0.21 4.5E-06   38.7   3.1   39   24-64     80-118 (244)
 52 PF13245 AAA_19:  Part of AAA d  91.2    0.11 2.4E-06   32.8   1.2   24   38-62      4-27  (76)
 53 PRK06835 DNA replication prote  90.9     0.3 6.6E-06   39.5   3.7   30   34-64    173-202 (329)
 54 PRK08903 DnaA regulatory inact  90.2    0.24 5.2E-06   37.3   2.5   20   44-63     41-60  (227)
 55 COG2804 PulE Type II secretory  90.1    0.19 4.1E-06   42.7   2.0   30   35-64    248-277 (500)
 56 PF04851 ResIII:  Type III rest  90.0    0.24 5.3E-06   35.1   2.3   31   34-64     13-44  (184)
 57 PF05673 DUF815:  Protein of un  89.9    0.44 9.4E-06   37.1   3.7   26   38-63     44-70  (249)
 58 PF05970 PIF1:  PIF1-like helic  89.3    0.28 6.1E-06   40.0   2.4   37   22-62      3-39  (364)
 59 KOG0989|consensus               89.3    0.34 7.3E-06   39.0   2.7   37   26-62     37-74  (346)
 60 PRK06921 hypothetical protein;  89.3     0.3 6.5E-06   38.2   2.4   31   34-64    103-136 (266)
 61 PRK14087 dnaA chromosomal repl  89.2    0.27 5.7E-06   41.4   2.2   40   23-64    121-160 (450)
 62 PRK12422 chromosomal replicati  89.1    0.36 7.9E-06   40.6   2.9   39   23-63    117-159 (445)
 63 COG1484 DnaC DNA replication p  89.1    0.41 8.8E-06   37.2   3.0   40   22-64     85-124 (254)
 64 TIGR03420 DnaA_homol_Hda DnaA   89.0    0.36 7.7E-06   36.0   2.6   22   42-63     35-56  (226)
 65 PRK08939 primosomal protein Dn  88.8    0.26 5.6E-06   39.4   1.7   40   24-64    135-175 (306)
 66 PF01695 IstB_IS21:  IstB-like   88.6    0.35 7.5E-06   35.5   2.2   20   44-63     46-65  (178)
 67 PRK08727 hypothetical protein;  88.1     0.4 8.7E-06   36.6   2.4   19   46-64     42-60  (233)
 68 PF01637 Arch_ATPase:  Archaeal  87.5    0.29 6.3E-06   36.1   1.3   29   35-63     10-38  (234)
 69 TIGR03015 pepcterm_ATPase puta  87.4     0.6 1.3E-05   35.8   3.0   47   17-63     11-61  (269)
 70 PF13401 AAA_22:  AAA domain; P  87.1    0.19   4E-06   34.1   0.0   18   45-62      4-21  (131)
 71 smart00382 AAA ATPases associa  86.6    0.26 5.5E-06   32.7   0.5   18   46-63      3-20  (148)
 72 PF00437 T2SE:  Type II/IV secr  86.3    0.38 8.2E-06   37.2   1.3   18   45-62    127-144 (270)
 73 PF00004 AAA:  ATPase family as  86.2    0.25 5.4E-06   33.2   0.3   39   48-86      1-56  (132)
 74 PF13604 AAA_30:  AAA domain; P  85.9    0.46   1E-05   35.3   1.6   27   36-62      9-35  (196)
 75 PRK10436 hypothetical protein;  85.8    0.43 9.4E-06   40.4   1.5   28   36-63    209-236 (462)
 76 TIGR01420 pilT_fam pilus retra  85.7    0.46   1E-05   38.4   1.6   28   35-62    112-139 (343)
 77 TIGR02533 type_II_gspE general  85.7    0.47   1E-05   40.4   1.7   28   36-63    233-260 (486)
 78 PHA00729 NTP-binding motif con  85.7    0.77 1.7E-05   35.2   2.7   30   34-63      6-35  (226)
 79 PRK12402 replication factor C   85.7    0.69 1.5E-05   36.6   2.6   21   42-62     33-53  (337)
 80 PRK09183 transposase/IS protei  85.7    0.37   8E-06   37.5   1.0   18   47-64    104-121 (259)
 81 TIGR02538 type_IV_pilB type IV  85.6    0.44 9.4E-06   41.3   1.5   27   36-62    307-333 (564)
 82 PF13191 AAA_16:  AAA ATPase do  85.4     0.2 4.4E-06   35.9  -0.5   22   41-62     20-41  (185)
 83 cd00046 DEXDc DEAD-like helica  85.4    0.32 6.9E-06   32.3   0.5   17   48-64      3-19  (144)
 84 PF13086 AAA_11:  AAA domain; P  85.2    0.37   8E-06   35.5   0.8   25   37-62     10-34  (236)
 85 PF07693 KAP_NTPase:  KAP famil  84.9    0.75 1.6E-05   36.2   2.5   32   31-62      6-37  (325)
 86 PF01935 DUF87:  Domain of unkn  84.8    0.34 7.3E-06   36.5   0.4   15   48-62     26-40  (229)
 87 KOG1514|consensus               84.2     2.8   6E-05   37.4   5.7   29   35-63    410-440 (767)
 88 TIGR02524 dot_icm_DotB Dot/Icm  83.9    0.63 1.4E-05   38.0   1.7   24   39-62    128-151 (358)
 89 COG5008 PilU Tfp pilus assembl  83.9    0.79 1.7E-05   36.5   2.1   29   34-62    116-144 (375)
 90 PF12846 AAA_10:  AAA-like doma  83.8    0.39 8.5E-06   36.9   0.4   18   45-62      1-18  (304)
 91 cd01129 PulE-GspE PulE/GspE Th  83.7    0.64 1.4E-05   36.3   1.6   27   36-62     71-97  (264)
 92 TIGR02525 plasmid_TraJ plasmid  83.7    0.69 1.5E-05   38.1   1.8   27   35-62    140-166 (372)
 93 PF13479 AAA_24:  AAA domain     83.2    0.55 1.2E-05   35.3   1.0   20   45-64      3-22  (213)
 94 cd01131 PilT Pilus retraction   82.8    0.49 1.1E-05   35.2   0.5   17   46-62      2-18  (198)
 95 PF06309 Torsin:  Torsin;  Inte  82.6     3.4 7.3E-05   28.9   4.6   25   47-81     54-79  (127)
 96 PF00270 DEAD:  DEAD/DEAH box h  82.4     1.2 2.5E-05   31.3   2.4   27   36-64      7-33  (169)
 97 PF00580 UvrD-helicase:  UvrD/R  81.7    0.62 1.3E-05   36.1   0.8   20   44-63     12-31  (315)
 98 PF05496 RuvB_N:  Holliday junc  81.5     3.3 7.2E-05   31.9   4.6   43   19-62     23-67  (233)
 99 TIGR00631 uvrb excinuclease AB  81.4     3.2 6.9E-05   36.8   5.1   84   18-107     7-97  (655)
100 PF00063 Myosin_head:  Myosin h  81.4     1.2 2.6E-05   39.4   2.6   21   42-62     82-102 (689)
101 TIGR00635 ruvB Holliday juncti  81.0     1.1 2.5E-05   35.1   2.1   43   20-63      4-48  (305)
102 PLN00020 ribulose bisphosphate  80.8     1.6 3.5E-05   36.2   2.9   62   24-85    123-205 (413)
103 PLN03025 replication factor C   80.7     1.5 3.2E-05   35.0   2.6   22   42-63     31-52  (319)
104 PF13671 AAA_33:  AAA domain; P  80.5    0.76 1.6E-05   31.5   0.8   15   48-62      2-16  (143)
105 PF00910 RNA_helicase:  RNA hel  80.4    0.49 1.1E-05   31.6  -0.2   26   48-83      1-26  (107)
106 COG4962 CpaF Flp pilus assembl  80.3     1.1 2.3E-05   36.6   1.7   17   46-62    174-190 (355)
107 PF13207 AAA_17:  AAA domain; P  80.2    0.63 1.4E-05   31.1   0.3   16   47-62      1-16  (121)
108 COG4096 HsdR Type I site-speci  80.0     2.3   5E-05   38.4   3.8   37   26-63    166-203 (875)
109 TIGR02782 TrbB_P P-type conjug  79.4       1 2.3E-05   35.8   1.4   28   34-62    122-149 (299)
110 smart00242 MYSc Myosin. Large   79.3     2.2 4.8E-05   37.8   3.5   21   42-62     89-109 (677)
111 PF07728 AAA_5:  AAA domain (dy  79.3    0.66 1.4E-05   32.0   0.2   15   48-62      2-16  (139)
112 PTZ00112 origin recognition co  79.2       2 4.3E-05   39.6   3.2   36   26-62    761-798 (1164)
113 COG1223 Predicted ATPase (AAA+  79.2     0.8 1.7E-05   36.4   0.6   41   45-85    151-208 (368)
114 PRK00440 rfc replication facto  78.6     1.8   4E-05   33.8   2.5   21   42-62     35-55  (319)
115 PF07724 AAA_2:  AAA domain (Cd  78.5    0.86 1.9E-05   33.2   0.6   17   46-62      4-20  (171)
116 cd01384 MYSc_type_XI Myosin mo  78.2     2.6 5.7E-05   37.4   3.6   21   42-62     85-105 (674)
117 cd01377 MYSc_type_II Myosin mo  78.1     2.5 5.4E-05   37.7   3.4   21   42-62     88-108 (693)
118 cd01383 MYSc_type_VIII Myosin   78.1     2.8 6.2E-05   37.2   3.8   21   42-62     89-109 (677)
119 cd00124 MYSc Myosin motor doma  77.8     2.6 5.6E-05   37.4   3.5   25   38-62     78-103 (679)
120 PRK13894 conjugal transfer ATP  77.5     1.6 3.5E-05   35.1   2.0   27   35-62    139-165 (319)
121 cd01381 MYSc_type_VII Myosin m  77.2       3 6.5E-05   37.0   3.7   21   42-62     83-103 (671)
122 cd01130 VirB11-like_ATPase Typ  77.2     1.7 3.7E-05   31.8   1.9   28   34-62     15-42  (186)
123 PRK06547 hypothetical protein;  77.0     2.8 6.2E-05   30.5   3.0   26   37-62      7-32  (172)
124 cd01378 MYSc_type_I Myosin mot  77.0       3 6.6E-05   37.0   3.7   21   42-62     83-103 (674)
125 cd01382 MYSc_type_VI Myosin mo  76.9     2.7 5.9E-05   37.6   3.4   21   42-62     88-108 (717)
126 TIGR02881 spore_V_K stage V sp  76.5     1.2 2.6E-05   34.4   1.0   18   45-62     42-59  (261)
127 PHA02544 44 clamp loader, smal  76.3     2.2 4.7E-05   33.7   2.4   21   42-62     39-60  (316)
128 cd01385 MYSc_type_IX Myosin mo  76.2     3.1 6.7E-05   37.1   3.5   21   42-62     91-111 (692)
129 cd01380 MYSc_type_V Myosin mot  76.2       3 6.6E-05   37.1   3.5   21   42-62     83-103 (691)
130 PRK13342 recombination factor   76.0     1.5 3.2E-05   36.4   1.4   39   24-63     16-54  (413)
131 cd01387 MYSc_type_XV Myosin mo  75.6     3.6 7.8E-05   36.6   3.7   21   42-62     84-104 (677)
132 PF06414 Zeta_toxin:  Zeta toxi  75.1     1.6 3.4E-05   32.3   1.2   20   43-62     13-32  (199)
133 COG1201 Lhr Lhr-like helicases  75.0     5.6 0.00012   36.1   4.8   25   36-62     30-54  (814)
134 PF02562 PhoH:  PhoH-like prote  75.0     2.3   5E-05   32.1   2.1   19   44-62     18-36  (205)
135 PF01580 FtsK_SpoIIIE:  FtsK/Sp  74.8    0.99 2.1E-05   33.4   0.1   17   46-62     39-55  (205)
136 PF00448 SRP54:  SRP54-type pro  74.8     1.1 2.4E-05   33.4   0.3   16   47-62      3-18  (196)
137 PF02456 Adeno_IVa2:  Adenoviru  74.7     1.1 2.4E-05   36.2   0.3   17   47-63     89-105 (369)
138 PF03668 ATP_bind_2:  P-loop AT  74.7       5 0.00011   31.9   3.9   16   47-62      3-18  (284)
139 smart00487 DEXDc DEAD-like hel  74.1     2.3 5.1E-05   29.9   1.9   19   46-64     25-43  (201)
140 PRK13833 conjugal transfer pro  74.1     2.2 4.8E-05   34.5   1.9   27   35-62    135-161 (323)
141 PRK13900 type IV secretion sys  74.1     2.4 5.1E-05   34.3   2.1   27   35-62    151-177 (332)
142 cd01120 RecA-like_NTPases RecA  74.0     1.2 2.6E-05   30.7   0.3   15   48-62      2-16  (165)
143 PF03215 Rad17:  Rad17 cell cyc  73.8     2.5 5.5E-05   36.3   2.3   29   34-62     32-62  (519)
144 PRK04195 replication factor C   73.7     2.6 5.5E-05   35.7   2.3   29   34-62     27-56  (482)
145 PRK13851 type IV secretion sys  73.7     1.3 2.7E-05   36.1   0.4   27   35-62    153-179 (344)
146 TIGR03499 FlhF flagellar biosy  73.2     4.6  0.0001   31.7   3.5   16   47-62    196-211 (282)
147 KOG0736|consensus               73.1     4.6  0.0001   36.6   3.7   21   68-88    786-806 (953)
148 PF13238 AAA_18:  AAA domain; P  73.0     1.7 3.7E-05   28.9   0.9   15   48-62      1-15  (129)
149 TIGR01242 26Sp45 26S proteasom  72.6     1.4 3.1E-05   35.7   0.5   19   45-63    156-174 (364)
150 cd01123 Rad51_DMC1_radA Rad51_  72.6     2.2 4.9E-05   32.0   1.6   28   35-62      6-36  (235)
151 cd01386 MYSc_type_XVIII Myosin  72.4     4.2   9E-05   36.7   3.4   21   42-62     83-103 (767)
152 PRK04328 hypothetical protein;  72.3     3.2 6.9E-05   32.0   2.4   28   35-62     10-40  (249)
153 PRK12723 flagellar biosynthesi  72.2     4.7  0.0001   33.4   3.4   18   45-62    174-191 (388)
154 PF12775 AAA_7:  P-loop contain  71.4     2.5 5.4E-05   33.2   1.6   27   36-63     25-51  (272)
155 TIGR02903 spore_lon_C ATP-depe  71.0     2.9 6.3E-05   36.7   2.1   27   36-62    166-192 (615)
156 COG1222 RPT1 ATP-dependent 26S  71.0       2 4.2E-05   35.5   0.9   61   26-86    161-243 (406)
157 PF13555 AAA_29:  P-loop contai  70.6     1.7 3.7E-05   26.4   0.4   16   47-62     25-40  (62)
158 smart00763 AAA_PrkA PrkA AAA d  70.5     6.7 0.00015   32.3   3.9   39   23-62     54-95  (361)
159 PF05729 NACHT:  NACHT domain    70.3       2 4.3E-05   29.9   0.7   16   47-62      2-17  (166)
160 PRK13341 recombination factor   70.3     3.1 6.7E-05   37.3   2.1   22   42-63     49-70  (725)
161 PF13476 AAA_23:  AAA domain; P  69.6       2 4.2E-05   30.9   0.6   17   46-62     20-36  (202)
162 KOG3859|consensus               69.4     2.6 5.6E-05   33.8   1.3   29   34-62     30-59  (406)
163 PF00158 Sigma54_activat:  Sigm  69.3     4.1 8.8E-05   29.6   2.2   21   42-62     19-39  (168)
164 PRK00080 ruvB Holliday junctio  69.1     1.7 3.6E-05   34.8   0.2   39   23-62     28-68  (328)
165 PF00931 NB-ARC:  NB-ARC domain  69.1     6.6 0.00014   30.2   3.5   30   33-62      5-36  (287)
166 PRK03992 proteasome-activating  69.0     1.9   4E-05   35.6   0.4   40   45-84    165-221 (389)
167 TIGR02639 ClpA ATP-dependent C  69.0     3.4 7.5E-05   36.9   2.1   23   42-64    200-222 (731)
168 PHA02244 ATPase-like protein    68.9     5.1 0.00011   33.2   2.9   19   42-62    118-136 (383)
169 TIGR01618 phage_P_loop phage n  68.8       2 4.3E-05   32.8   0.5   20   45-64     12-31  (220)
170 PRK09270 nucleoside triphospha  68.7     5.8 0.00013   29.9   3.1   37   26-62     13-50  (229)
171 KOG2543|consensus               68.7     2.2 4.8E-05   35.4   0.8   19   45-63     30-48  (438)
172 COG2607 Predicted ATPase (AAA+  68.3     6.3 0.00014   30.9   3.2   25   38-62     77-102 (287)
173 TIGR02640 gas_vesic_GvpN gas v  68.1     4.9 0.00011   31.1   2.6   27   34-62     12-38  (262)
174 KOG1803|consensus               68.0     2.8 6.1E-05   36.6   1.3   17   46-62    202-218 (649)
175 PRK11776 ATP-dependent RNA hel  67.9     4.5 9.7E-05   33.8   2.5   24   36-61     34-57  (460)
176 PF10923 DUF2791:  P-loop Domai  67.4     5.5 0.00012   33.4   2.9   29   34-62     38-66  (416)
177 PRK13764 ATPase; Provisional    67.4       3 6.6E-05   36.5   1.4   19   44-62    256-274 (602)
178 PRK14722 flhF flagellar biosyn  67.1     2.4 5.1E-05   35.0   0.7   18   45-62    137-154 (374)
179 PTZ00014 myosin-A; Provisional  67.1     6.6 0.00014   35.8   3.5   21   42-62    180-200 (821)
180 PRK11331 5-methylcytosine-spec  67.1     5.2 0.00011   33.9   2.7   27   34-62    185-211 (459)
181 KOG0651|consensus               66.9     2.7 5.8E-05   34.2   0.9   78    2-87    125-225 (388)
182 COG1219 ClpX ATP-dependent pro  66.7     2.7 5.9E-05   34.3   0.9   17   46-62     98-114 (408)
183 PF10236 DAP3:  Mitochondrial r  66.5     4.6  0.0001   32.3   2.2   23   41-63     19-41  (309)
184 COG0606 Predicted ATPase with   66.4       2 4.3E-05   36.6   0.1   24   48-74    201-224 (490)
185 PRK15455 PrkA family serine pr  66.3     9.6 0.00021   33.6   4.2   39   23-61     79-119 (644)
186 TIGR01241 FtsH_fam ATP-depende  66.0     2.2 4.8E-05   36.2   0.3   18   46-63     89-106 (495)
187 TIGR02237 recomb_radB DNA repa  65.6     4.1 8.8E-05   30.0   1.7   18   45-62     12-29  (209)
188 PF06048 DUF927:  Domain of unk  65.3     6.7 0.00014   30.9   2.9   30   32-62    181-210 (286)
189 cd00268 DEADc DEAD-box helicas  65.3     6.1 0.00013   28.7   2.5   25   36-62     29-53  (203)
190 PF00735 Septin:  Septin;  Inte  65.3     2.7 5.8E-05   33.2   0.6   20   43-62      2-21  (281)
191 PTZ00454 26S protease regulato  65.1     2.5 5.5E-05   35.1   0.5   40   45-84    179-235 (398)
192 PTZ00424 helicase 45; Provisio  64.8     5.3 0.00012   32.4   2.3   26   35-62     57-82  (401)
193 PF08477 Miro:  Miro-like prote  64.7     2.4 5.2E-05   27.9   0.3   15   48-62      2-16  (119)
194 COG2256 MGS1 ATPase related to  64.4     3.9 8.4E-05   34.2   1.4   39   23-62     27-65  (436)
195 PRK11192 ATP-dependent RNA hel  64.3     5.6 0.00012   32.9   2.4   24   36-61     31-54  (434)
196 PF14532 Sigma54_activ_2:  Sigm  64.2       7 0.00015   26.9   2.6   20   43-62     19-38  (138)
197 cd01124 KaiC KaiC is a circadi  64.1     3.4 7.3E-05   29.6   1.0   15   48-62      2-16  (187)
198 PRK06696 uridine kinase; Valid  64.1     9.8 0.00021   28.6   3.5   21   42-62     19-39  (223)
199 cd02021 GntK Gluconate kinase   64.0     2.8   6E-05   29.2   0.5   15   48-62      2-16  (150)
200 PRK07261 topology modulation p  63.9     3.6 7.8E-05   29.7   1.1   15   48-62      3-17  (171)
201 PRK10536 hypothetical protein;  63.8     3.2   7E-05   32.6   0.8   17   46-62     75-91  (262)
202 PRK14962 DNA polymerase III su  63.6     4.9 0.00011   34.2   1.9   23   40-62     30-53  (472)
203 KOG0953|consensus               63.5     6.5 0.00014   34.3   2.6   40   47-86    193-238 (700)
204 cd01379 MYSc_type_III Myosin m  63.5     7.8 0.00017   34.4   3.2   21   42-62     83-103 (653)
205 cd01127 TrwB Bacterial conjuga  63.2     2.8 6.1E-05   34.7   0.4   18   45-62     42-59  (410)
206 PTZ00361 26 proteosome regulat  63.0     2.7 5.8E-05   35.4   0.3   17   46-62    218-234 (438)
207 PRK10590 ATP-dependent RNA hel  62.9     6.6 0.00014   32.9   2.6   25   36-62     31-55  (456)
208 PRK00131 aroK shikimate kinase  62.7     3.8 8.3E-05   28.8   1.0   17   46-62      5-21  (175)
209 KOG0926|consensus               62.7     5.6 0.00012   36.3   2.1   19   44-62    270-288 (1172)
210 PF00025 Arf:  ADP-ribosylation  62.4     4.9 0.00011   29.0   1.5   28   35-62      3-31  (175)
211 PRK10917 ATP-dependent DNA hel  62.1     9.8 0.00021   33.8   3.6   27   36-62    273-299 (681)
212 cd00464 SK Shikimate kinase (S  62.1     3.6 7.7E-05   28.5   0.7   16   47-62      1-16  (154)
213 TIGR02880 cbbX_cfxQ probable R  62.0     3.1 6.7E-05   32.8   0.4   16   47-62     60-75  (284)
214 COG1419 FlhF Flagellar GTP-bin  61.9     7.6 0.00016   32.4   2.7   37   26-62    180-220 (407)
215 TIGR00376 DNA helicase, putati  61.9     2.9 6.3E-05   36.8   0.3   17   47-63    175-191 (637)
216 TIGR01359 UMP_CMP_kin_fam UMP-  61.9     4.1   9E-05   29.2   1.1   15   48-62      2-16  (183)
217 TIGR00643 recG ATP-dependent D  61.8       8 0.00017   33.9   3.0   27   36-62    247-273 (630)
218 PRK09361 radB DNA repair and r  61.7     8.1 0.00018   28.8   2.7   28   35-62     10-40  (225)
219 COG1126 GlnQ ABC-type polar am  61.6     3.2   7E-05   31.9   0.5   15   48-62     31-45  (240)
220 PRK08118 topology modulation p  61.6     4.2 9.1E-05   29.3   1.1   15   48-62      4-18  (167)
221 PRK04837 ATP-dependent RNA hel  61.6     6.5 0.00014   32.5   2.3   25   36-62     38-62  (423)
222 COG3829 RocR Transcriptional r  61.5     6.1 0.00013   34.2   2.1   19   41-59    264-282 (560)
223 PRK10416 signal recognition pa  61.2      12 0.00026   30.1   3.7   18   45-62    114-131 (318)
224 TIGR02788 VirB11 P-type DNA tr  61.1     7.4 0.00016   31.0   2.5   28   34-62    134-161 (308)
225 PF04548 AIG1:  AIG1 family;  I  61.1     3.6 7.7E-05   30.8   0.6   16   47-62      2-17  (212)
226 KOG0726|consensus               61.1     4.5 9.6E-05   32.8   1.2   41   47-87    221-278 (440)
227 PRK14974 cell division protein  61.0      14  0.0003   30.0   4.0   18   45-62    140-157 (336)
228 PHA02653 RNA helicase NPH-II;   60.9      10 0.00023   33.7   3.6   33   23-61    163-195 (675)
229 CHL00081 chlI Mg-protoporyphyr  60.8     6.7 0.00014   32.1   2.2   35   24-62     21-55  (350)
230 PRK14970 DNA polymerase III su  60.7     7.9 0.00017   31.3   2.6   27   36-62     29-56  (367)
231 PHA01747 putative ATP-dependen  60.7     6.4 0.00014   32.7   2.0   31   32-62    177-207 (425)
232 TIGR02322 phosphon_PhnN phosph  60.7     3.4 7.4E-05   29.6   0.5   16   47-62      3-18  (179)
233 TIGR02902 spore_lonB ATP-depen  60.7     9.8 0.00021   32.8   3.3   25   38-62     79-103 (531)
234 PRK11448 hsdR type I restricti  60.5     5.5 0.00012   37.5   1.8   30   34-64    423-452 (1123)
235 cd01393 recA_like RecA is a  b  60.5     6.9 0.00015   29.1   2.1   28   35-62      6-36  (226)
236 PRK14961 DNA polymerase III su  60.5     8.2 0.00018   31.4   2.7   35   24-62     20-55  (363)
237 COG1125 OpuBA ABC-type proline  60.4     3.5 7.6E-05   32.7   0.5   14   49-62     31-44  (309)
238 PRK00771 signal recognition pa  60.0      14  0.0003   31.2   4.0   19   45-63     95-113 (437)
239 PHA02624 large T antigen; Prov  60.0     9.5 0.00021   33.7   3.1   28   35-62    419-448 (647)
240 CHL00181 cbbX CbbX; Provisiona  59.8       4 8.7E-05   32.2   0.7   16   47-62     61-76  (287)
241 TIGR03819 heli_sec_ATPase heli  59.7     6.5 0.00014   31.9   2.0   28   34-62    168-195 (340)
242 TIGR00348 hsdR type I site-spe  59.7     8.3 0.00018   34.2   2.7   31   32-63    246-281 (667)
243 PRK06067 flagellar accessory p  59.6       8 0.00017   29.1   2.3   28   35-62     12-42  (234)
244 KOG2228|consensus               59.4      17 0.00038   30.0   4.3   54   34-87     37-107 (408)
245 cd01850 CDC_Septin CDC/Septin.  59.4     4.3 9.3E-05   31.8   0.8   21   42-62      1-21  (276)
246 cd00820 PEPCK_HprK Phosphoenol  59.3     4.1 8.9E-05   27.5   0.6   17   46-62     16-32  (107)
247 PRK10865 protein disaggregatio  59.1      10 0.00023   34.6   3.3   17   46-62    599-615 (857)
248 TIGR03689 pup_AAA proteasome A  58.8     3.5 7.6E-05   35.4   0.3   17   46-62    217-233 (512)
249 CHL00195 ycf46 Ycf46; Provisio  58.8     3.8 8.2E-05   35.0   0.5   40   45-84    259-315 (489)
250 PRK06217 hypothetical protein;  58.3       5 0.00011   29.1   1.0   15   48-62      4-18  (183)
251 TIGR02688 conserved hypothetic  58.3     4.1 8.9E-05   34.4   0.6   20   45-64    209-228 (449)
252 cd01126 TraG_VirD4 The TraG/Tr  58.0     6.3 0.00014   32.1   1.6   16   48-63      2-17  (384)
253 KOG0652|consensus               58.0     5.1 0.00011   32.0   1.0   16   47-62    207-222 (424)
254 PF12774 AAA_6:  Hydrolytic ATP  57.9     7.3 0.00016   29.9   1.9   36   48-83     35-81  (231)
255 COG5019 CDC3 Septin family pro  57.7       7 0.00015   32.2   1.8   21   42-62     20-40  (373)
256 PF13173 AAA_14:  AAA domain     57.3     4.4 9.5E-05   27.6   0.5   16   47-62      4-19  (128)
257 TIGR03238 dnd_assoc_3 dnd syst  57.1     8.1 0.00018   33.1   2.1   19   46-64     33-51  (504)
258 TIGR01074 rep ATP-dependent DN  56.9     5.1 0.00011   35.2   0.9   20   45-64     14-33  (664)
259 cd01428 ADK Adenylate kinase (  56.7     5.7 0.00012   28.6   1.1   15   48-62      2-16  (194)
260 PF06745 KaiC:  KaiC;  InterPro  56.7       6 0.00013   29.6   1.2   26   37-62      8-36  (226)
261 TIGR00231 small_GTP small GTP-  56.7     4.1 8.8E-05   27.3   0.3   16   47-62      3-18  (161)
262 TIGR02397 dnaX_nterm DNA polym  56.6     9.9 0.00021   30.3   2.5   24   39-62     29-53  (355)
263 TIGR02236 recomb_radA DNA repa  56.6     7.5 0.00016   30.7   1.8   28   35-62     82-112 (310)
264 TIGR01313 therm_gnt_kin carboh  56.5       4 8.7E-05   28.8   0.2   14   49-62      2-15  (163)
265 cd01394 radB RadB. The archaea  56.2      12 0.00026   27.7   2.8   27   36-62      7-36  (218)
266 KOG0729|consensus               55.8     6.5 0.00014   31.5   1.3   51   34-84    195-267 (435)
267 KOG0354|consensus               55.6     9.8 0.00021   34.2   2.5   25   35-62     69-93  (746)
268 PF03969 AFG1_ATPase:  AFG1-lik  55.6     4.8 0.00011   33.0   0.6   18   45-62     62-79  (362)
269 TIGR01360 aden_kin_iso1 adenyl  55.5     6.3 0.00014   28.2   1.1   16   47-62      5-20  (188)
270 KOG1532|consensus               55.5      11 0.00024   30.3   2.5   19   44-62     18-36  (366)
271 PRK14531 adenylate kinase; Pro  55.3     6.3 0.00014   28.6   1.1   16   47-62      4-19  (183)
272 TIGR03744 traC_PFL_4706 conjug  55.2     4.4 9.5E-05   37.1   0.3   19   44-62    474-492 (893)
273 TIGR03158 cas3_cyano CRISPR-as  54.8      11 0.00025   30.5   2.6   26   37-62      6-31  (357)
274 TIGR00614 recQ_fam ATP-depende  54.6      12 0.00025   31.6   2.7   25   36-62     19-43  (470)
275 PRK11034 clpA ATP-dependent Cl  54.4     6.9 0.00015   35.3   1.4   20   45-64    207-226 (758)
276 PRK14532 adenylate kinase; Pro  54.3     7.4 0.00016   28.2   1.3   16   47-62      2-17  (188)
277 TIGR02746 TraC-F-type type-IV   54.2     4.8  0.0001   36.1   0.4   18   45-62    430-447 (797)
278 cd02019 NK Nucleoside/nucleoti  54.0       7 0.00015   23.7   1.0   15   48-62      2-16  (69)
279 KOG0739|consensus               53.9     6.1 0.00013   32.1   0.9   60   28-87    145-225 (439)
280 TIGR03263 guanyl_kin guanylate  53.8     7.4 0.00016   27.8   1.3   16   47-62      3-18  (180)
281 PF02534 T4SS-DNA_transf:  Type  53.8      10 0.00023   31.6   2.3   18   46-63     45-62  (469)
282 PF10412 TrwB_AAD_bind:  Type I  53.7     4.3 9.4E-05   33.4   0.0   17   46-62     16-32  (386)
283 TIGR00618 sbcc exonuclease Sbc  53.7      18  0.0004   33.7   4.0   17   46-62     27-43  (1042)
284 cd02020 CMPK Cytidine monophos  53.6       7 0.00015   26.6   1.1   15   48-62      2-16  (147)
285 PRK05703 flhF flagellar biosyn  53.6     5.4 0.00012   33.4   0.6   16   47-62    223-238 (424)
286 PRK06762 hypothetical protein;  53.6     7.3 0.00016   27.5   1.2   15   47-61      4-18  (166)
287 COG1136 SalX ABC-type antimicr  53.2       5 0.00011   30.8   0.3   15   48-62     34-48  (226)
288 TIGR01817 nifA Nif-specific re  53.2     9.1  0.0002   32.8   1.9   20   43-62    217-236 (534)
289 TIGR01243 CDC48 AAA family ATP  53.2     5.7 0.00012   35.5   0.7   17   46-62    213-229 (733)
290 PF01926 MMR_HSR1:  50S ribosom  53.2     4.7  0.0001   26.6   0.1   15   48-62      2-16  (116)
291 PLN00206 DEAD-box ATP-dependen  53.2      13 0.00029   31.7   2.9   24   36-61    151-174 (518)
292 PRK11634 ATP-dependent RNA hel  52.9      11 0.00025   33.1   2.4   25   36-62     36-60  (629)
293 KOG0744|consensus               52.7     5.8 0.00013   32.5   0.6   20   45-64    177-196 (423)
294 KOG0727|consensus               52.6       7 0.00015   31.1   1.0   64   22-85    161-246 (408)
295 TIGR02238 recomb_DMC1 meiotic   52.6      11 0.00024   30.2   2.2   28   35-62     83-113 (313)
296 PRK08233 hypothetical protein;  52.5     7.1 0.00015   27.8   1.0   16   47-62      5-20  (182)
297 cd03240 ABC_Rad50 The catalyti  52.3     5.8 0.00013   29.5   0.5   16   47-62     24-39  (204)
298 TIGR03880 KaiC_arch_3 KaiC dom  52.2      13 0.00028   27.8   2.4   26   37-62      5-33  (224)
299 PRK13531 regulatory ATPase Rav  52.0      12 0.00027   32.1   2.4   18   45-62     39-56  (498)
300 COG3842 PotA ABC-type spermidi  52.0     5.5 0.00012   32.6   0.3   15   48-62     34-48  (352)
301 TIGR00580 mfd transcription-re  51.9      15 0.00033   33.9   3.2   32   31-62    458-489 (926)
302 PRK04040 adenylate kinase; Pro  51.8     6.8 0.00015   28.9   0.8   16   47-62      4-19  (188)
303 PF09439 SRPRB:  Signal recogni  51.6       8 0.00017   28.6   1.1   17   46-62      4-20  (181)
304 TIGR03881 KaiC_arch_4 KaiC dom  51.6      14 0.00031   27.5   2.6   27   36-62      8-37  (229)
305 PRK00300 gmk guanylate kinase;  51.5     8.7 0.00019   28.1   1.4   17   46-62      6-22  (205)
306 COG0552 FtsY Signal recognitio  51.5     8.8 0.00019   31.3   1.4   20   43-62    137-156 (340)
307 COG0630 VirB11 Type IV secreto  51.4     5.4 0.00012   32.0   0.2   17   46-62    144-160 (312)
308 PRK04301 radA DNA repair and r  51.4      11 0.00023   30.1   1.9   28   35-62     89-119 (317)
309 PF00005 ABC_tran:  ABC transpo  51.2     5.8 0.00013   26.9   0.3   16   47-62     13-28  (137)
310 PRK01297 ATP-dependent RNA hel  51.1      12 0.00026   31.5   2.2   26   35-62    116-141 (475)
311 TIGR03877 thermo_KaiC_1 KaiC d  51.1     9.2  0.0002   29.0   1.5   27   36-62      9-38  (237)
312 PF02367 UPF0079:  Uncharacteri  50.7     5.3 0.00012   27.7   0.1   18   46-63     16-33  (123)
313 PF01443 Viral_helicase1:  Vira  50.6     4.7  0.0001   30.0  -0.2   15   49-63      2-16  (234)
314 PRK13700 conjugal transfer pro  50.5     7.8 0.00017   34.8   1.1   16   47-62    187-202 (732)
315 PRK14729 miaA tRNA delta(2)-is  50.4     8.6 0.00019   30.8   1.2   16   47-62      6-21  (300)
316 PRK11889 flhF flagellar biosyn  50.3      21 0.00046   30.1   3.5   17   46-62    242-258 (436)
317 cd00071 GMPK Guanosine monopho  50.3     8.2 0.00018   26.8   1.0   15   48-62      2-16  (137)
318 PHA02774 E1; Provisional        50.2      14 0.00031   32.4   2.6   27   36-62    423-451 (613)
319 PRK14527 adenylate kinase; Pro  50.2     9.1  0.0002   27.9   1.3   18   45-62      6-23  (191)
320 PRK11034 clpA ATP-dependent Cl  50.2      19  0.0004   32.6   3.4   17   46-62    489-505 (758)
321 PRK05580 primosome assembly pr  50.2      12 0.00026   33.2   2.2   17   46-62    163-179 (679)
322 cd01876 YihA_EngB The YihA (En  50.1     5.9 0.00013   27.1   0.2   15   48-62      2-16  (170)
323 TIGR03878 thermo_KaiC_2 KaiC d  50.0     9.3  0.0002   29.6   1.3   18   45-62     36-53  (259)
324 PLN03187 meiotic recombination  50.0      11 0.00024   30.7   1.8   29   34-62    112-143 (344)
325 COG0467 RAD55 RecA-superfamily  50.0     9.4  0.0002   29.3   1.4   26   37-62     12-40  (260)
326 PRK04537 ATP-dependent RNA hel  50.0      13 0.00029   32.2   2.4   25   36-62     39-63  (572)
327 KOG0745|consensus               49.8     8.2 0.00018   32.9   1.0   17   46-62    227-243 (564)
328 PRK05342 clpX ATP-dependent pr  49.7       8 0.00017   32.3   1.0   17   46-62    109-125 (412)
329 KOG0742|consensus               49.6     8.4 0.00018   32.7   1.1   14   47-60    386-399 (630)
330 PRK05986 cob(I)alamin adenolsy  49.6     6.9 0.00015   29.3   0.5   20   45-64     22-41  (191)
331 COG3596 Predicted GTPase [Gene  49.6      13 0.00028   29.7   2.0   24   39-62     33-56  (296)
332 PRK09302 circadian clock prote  49.5      14  0.0003   31.5   2.4   28   35-62     18-48  (509)
333 PRK06995 flhF flagellar biosyn  49.5     6.8 0.00015   33.5   0.5   17   46-62    257-273 (484)
334 PRK03839 putative kinase; Prov  49.4     8.4 0.00018   27.7   1.0   15   48-62      3-17  (180)
335 TIGR00382 clpX endopeptidase C  49.4     6.7 0.00014   32.8   0.5   17   46-62    117-133 (413)
336 PRK11057 ATP-dependent DNA hel  49.2      14  0.0003   32.3   2.4   25   35-61     32-56  (607)
337 CHL00095 clpC Clp protease ATP  49.2      11 0.00023   34.3   1.7   20   45-64    200-219 (821)
338 TIGR01351 adk adenylate kinase  49.1     8.9 0.00019   28.4   1.1   15   48-62      2-16  (210)
339 cd02023 UMPK Uridine monophosp  49.1     6.3 0.00014   28.8   0.3   15   48-62      2-16  (198)
340 cd02027 APSK Adenosine 5'-phos  49.0     8.4 0.00018   27.1   0.9   15   48-62      2-16  (149)
341 PF00485 PRK:  Phosphoribulokin  49.0     6.6 0.00014   28.7   0.4   15   48-62      2-16  (194)
342 PRK01172 ski2-like helicase; P  48.8      14  0.0003   32.6   2.4   24   37-62     31-54  (674)
343 TIGR02655 circ_KaiC circadian   48.8      14 0.00031   31.3   2.4   28   35-62      8-38  (484)
344 PF13304 AAA_21:  AAA domain; P  48.7     5.8 0.00013   28.8   0.0   14   49-62      3-16  (303)
345 PRK10078 ribose 1,5-bisphospho  48.5     9.7 0.00021   27.7   1.2   16   47-62      4-19  (186)
346 CHL00176 ftsH cell division pr  48.5     6.6 0.00014   34.7   0.3   17   46-62    217-233 (638)
347 PRK14530 adenylate kinase; Pro  48.5     8.9 0.00019   28.6   1.0   16   47-62      5-20  (215)
348 KOG0743|consensus               48.4     5.8 0.00013   33.5  -0.0   15   48-62    238-252 (457)
349 TIGR01243 CDC48 AAA family ATP  48.4     7.2 0.00016   34.8   0.5   39   46-84    488-543 (733)
350 KOG2035|consensus               48.4      17 0.00038   29.2   2.6   36   27-62     15-51  (351)
351 cd03274 ABC_SMC4_euk Eukaryoti  48.3     7.6 0.00016   29.1   0.6   16   47-62     27-42  (212)
352 TIGR00763 lon ATP-dependent pr  48.3      19 0.00042   32.5   3.2   17   46-62    348-364 (775)
353 PRK06851 hypothetical protein;  48.3     9.9 0.00021   31.3   1.3   27   36-62     21-47  (367)
354 PF02463 SMC_N:  RecF/RecN/SMC   48.2     9.5 0.00021   28.3   1.1   16   47-62     26-41  (220)
355 TIGR00235 udk uridine kinase.   48.2     7.2 0.00016   28.9   0.4   16   47-62      8-23  (207)
356 PRK10865 protein disaggregatio  48.1      12 0.00026   34.3   1.9   31   34-64    188-218 (857)
357 PRK00454 engB GTP-binding prot  48.0      13 0.00028   26.7   1.7   28   35-62     14-41  (196)
358 COG0563 Adk Adenylate kinase a  48.0     9.9 0.00022   27.9   1.2   15   48-62      3-17  (178)
359 COG3839 MalK ABC-type sugar tr  48.0     6.9 0.00015   31.9   0.3   15   48-62     32-46  (338)
360 KOG0738|consensus               47.7      18  0.0004   30.4   2.7   57   31-87    227-304 (491)
361 KOG0741|consensus               47.6      10 0.00023   33.1   1.4   16   47-62    258-273 (744)
362 KOG1547|consensus               47.6      25 0.00055   27.8   3.3   33   30-62     30-63  (336)
363 PRK10246 exonuclease subunit S  47.6      23  0.0005   33.2   3.7   18   45-62     30-47  (1047)
364 PRK11664 ATP-dependent RNA hel  47.5      21 0.00046   32.5   3.3   27   34-62     11-37  (812)
365 PRK12724 flagellar biosynthesi  47.5      24 0.00053   29.7   3.5   17   46-62    224-240 (432)
366 cd02025 PanK Pantothenate kina  47.5       5 0.00011   30.4  -0.5   13   50-62      4-16  (220)
367 TIGR01389 recQ ATP-dependent D  47.4      17 0.00036   31.6   2.6   26   35-62     20-45  (591)
368 PRK09825 idnK D-gluconate kina  47.3     7.6 0.00016   28.3   0.4   16   47-62      5-20  (176)
369 TIGR03345 VI_ClpV1 type VI sec  47.3      24 0.00052   32.3   3.7   37   24-61    570-612 (852)
370 cd03279 ABC_sbcCD SbcCD and ot  47.2     8.2 0.00018   28.7   0.6   17   46-62     29-45  (213)
371 TIGR03346 chaperone_ClpB ATP-d  47.0      12 0.00027   34.1   1.8   32   33-64    182-213 (852)
372 PRK00279 adk adenylate kinase;  46.9      10 0.00022   28.2   1.1   15   48-62      3-17  (215)
373 cd01853 Toc34_like Toc34-like   46.7     8.8 0.00019   29.7   0.7   20   43-62     29-48  (249)
374 TIGR02639 ClpA ATP-dependent C  46.6      22 0.00047   31.9   3.3   17   46-62    485-501 (731)
375 KOG0340|consensus               46.6      13 0.00029   30.7   1.8   28   35-64     36-63  (442)
376 cd03238 ABC_UvrA The excision   46.5     7.4 0.00016   28.4   0.3   16   47-62     23-38  (176)
377 PRK05480 uridine/cytidine kina  46.4     9.7 0.00021   28.1   0.9   18   45-62      6-23  (209)
378 smart00175 RAB Rab subfamily o  46.4     7.4 0.00016   26.8   0.3   15   48-62      3-17  (164)
379 TIGR02173 cyt_kin_arch cytidyl  46.1      10 0.00022   26.6   1.0   16   47-62      2-17  (171)
380 KOG0735|consensus               46.0     9.5 0.00021   34.5   0.9   42   43-84    699-757 (952)
381 cd00227 CPT Chloramphenicol (C  45.9      11 0.00024   27.0   1.2   16   47-62      4-19  (175)
382 cd04163 Era Era subfamily.  Er  45.9     8.6 0.00019   26.1   0.5   16   47-62      5-20  (168)
383 COG4525 TauB ABC-type taurine   45.6     8.9 0.00019   29.4   0.6   16   47-62     33-48  (259)
384 COG1198 PriA Primosomal protei  45.6      25 0.00054   31.7   3.4   41   43-83    215-269 (730)
385 PF03193 DUF258:  Protein of un  45.6      12 0.00026   27.1   1.3   23   38-62     30-52  (161)
386 TIGR01075 uvrD DNA helicase II  45.5      10 0.00022   33.8   1.0   20   45-64     17-36  (715)
387 PRK13767 ATP-dependent helicas  45.4      17 0.00037   33.3   2.5   24   37-62     41-64  (876)
388 PRK14738 gmk guanylate kinase;  45.3      10 0.00022   28.2   0.9   19   44-62     12-30  (206)
389 cd04159 Arl10_like Arl10-like   45.3     8.1 0.00018   26.1   0.3   15   48-62      2-16  (159)
390 TIGR00929 VirB4_CagE type IV s  45.2     8.4 0.00018   34.4   0.5   18   45-62    434-451 (785)
391 PRK11773 uvrD DNA-dependent he  45.2      10 0.00022   33.9   1.0   20   45-64     22-41  (721)
392 PRK02496 adk adenylate kinase;  45.2      11 0.00024   27.1   1.1   15   48-62      4-18  (184)
393 TIGR00064 ftsY signal recognit  44.9      11 0.00023   29.6   0.9   17   46-62     73-89  (272)
394 cd04114 Rab30 Rab30 subfamily.  44.8     9.9 0.00021   26.4   0.7   19   44-62      6-24  (169)
395 COG3854 SpoIIIAA ncharacterize  44.8      16 0.00035   28.7   1.9   35   27-62    120-154 (308)
396 TIGR01073 pcrA ATP-dependent D  44.7      10 0.00023   33.8   1.0   21   44-64     16-36  (726)
397 smart00173 RAS Ras subfamily o  44.5     8.3 0.00018   26.7   0.3   15   48-62      3-17  (164)
398 PRK05541 adenylylsulfate kinas  44.4      12 0.00026   26.7   1.2   17   46-62      8-24  (176)
399 PRK13721 conjugal transfer ATP  44.4     8.6 0.00019   35.0   0.4   18   45-62    449-466 (844)
400 PTZ00110 helicase; Provisional  44.2      17 0.00037   31.4   2.2   24   37-62    161-184 (545)
401 COG0324 MiaA tRNA delta(2)-iso  44.2      13 0.00027   30.0   1.3   16   47-62      5-20  (308)
402 PHA02530 pseT polynucleotide k  44.1      12 0.00026   29.2   1.2   16   47-62      4-19  (300)
403 PRK08533 flagellar accessory p  44.0      13 0.00029   28.2   1.4   18   45-62     24-41  (230)
404 TIGR00602 rad24 checkpoint pro  43.9      18 0.00039   32.1   2.3   16   47-62    112-127 (637)
405 PRK14721 flhF flagellar biosyn  43.6     8.9 0.00019   32.2   0.4   18   45-62    191-208 (420)
406 PRK10867 signal recognition pa  43.6      34 0.00074   28.8   3.8   18   45-62    100-117 (433)
407 KOG0336|consensus               43.4      17 0.00037   30.8   1.9   20   40-61    254-273 (629)
408 COG0464 SpoVK ATPases of the A  43.4     9.2  0.0002   32.3   0.4   42   43-84    274-332 (494)
409 PRK12726 flagellar biosynthesi  43.4     9.9 0.00022   31.7   0.6   18   46-63    207-224 (407)
410 PRK05416 glmZ(sRNA)-inactivati  43.4      28 0.00061   27.6   3.2   17   47-63      8-24  (288)
411 PRK06645 DNA polymerase III su  43.2      24 0.00051   30.4   2.8   23   40-62     37-60  (507)
412 PRK11545 gntK gluconate kinase  43.2     6.1 0.00013   28.3  -0.6   13   51-63      1-13  (163)
413 cd04155 Arl3 Arl3 subfamily.    43.1     9.2  0.0002   26.8   0.3   19   44-62     13-31  (173)
414 PRK05800 cobU adenosylcobinami  43.0      12 0.00027   27.1   1.0   16   47-62      3-18  (170)
415 PRK10820 DNA-binding transcrip  43.0      16 0.00034   31.4   1.8   20   43-62    225-244 (520)
416 TIGR00678 holB DNA polymerase   42.9      19 0.00042   26.0   2.0   24   39-62      7-31  (188)
417 PRK05057 aroK shikimate kinase  42.8      14  0.0003   26.7   1.2   17   46-62      5-21  (172)
418 PLN02200 adenylate kinase fami  42.8      14  0.0003   28.3   1.3   19   44-62     42-60  (234)
419 TIGR00554 panK_bact pantothena  42.8      22 0.00048   28.3   2.5   17   46-62     63-79  (290)
420 cd00876 Ras Ras family.  The R  42.8      12 0.00027   25.4   1.0   15   48-62      2-16  (160)
421 cd04156 ARLTS1 ARLTS1 subfamil  42.7     9.4  0.0002   26.3   0.3   15   48-62      2-16  (160)
422 TIGR03817 DECH_helic helicase/  42.7      20 0.00044   32.2   2.4   26   35-62     43-68  (742)
423 cd03278 ABC_SMC_barmotin Barmo  42.7     9.4  0.0002   28.2   0.3   16   47-62     24-39  (197)
424 PRK14964 DNA polymerase III su  42.5      24 0.00053   30.2   2.8   23   40-62     29-52  (491)
425 cd04164 trmE TrmE (MnmE, ThdF,  42.5     9.6 0.00021   25.8   0.3   16   47-62      3-18  (157)
426 COG1122 CbiO ABC-type cobalt t  42.5      14 0.00029   28.5   1.2   18   45-62     30-47  (235)
427 TIGR03574 selen_PSTK L-seryl-t  42.5      12 0.00026   28.5   0.9   15   48-62      2-16  (249)
428 PF13337 Lon_2:  Putative ATP-d  42.4      26 0.00056   29.8   2.9   32   26-62    194-225 (457)
429 cd00544 CobU Adenosylcobinamid  42.4      13 0.00028   27.0   1.1   15   48-62      2-16  (169)
430 PRK13889 conjugal transfer rel  42.4      16 0.00034   34.1   1.8   27   36-63    354-380 (988)
431 KOG3347|consensus               42.4      13 0.00027   27.2   0.9   17   46-62      8-24  (176)
432 KOG0922|consensus               42.4      16 0.00035   32.4   1.7   19   44-62     65-83  (674)
433 TIGR02329 propionate_PrpR prop  42.3      18 0.00039   31.2   2.0   21   42-62    232-252 (526)
434 cd03071 PDI_b'_NRX PDIb' famil  42.2     7.1 0.00015   26.6  -0.3   74   70-147    35-111 (116)
435 PRK00091 miaA tRNA delta(2)-is  42.2      14  0.0003   29.6   1.2   16   47-62      6-21  (307)
436 PRK15429 formate hydrogenlyase  42.2      18 0.00039   32.1   2.0   21   42-62    396-416 (686)
437 cd03272 ABC_SMC3_euk Eukaryoti  42.1      10 0.00022   28.6   0.4   16   47-62     25-40  (243)
438 TIGR02768 TraA_Ti Ti-type conj  42.0      16 0.00036   32.8   1.8   27   37-64    361-387 (744)
439 TIGR01425 SRP54_euk signal rec  42.0      40 0.00087   28.4   4.0   18   45-62    100-117 (429)
440 PF01745 IPT:  Isopentenyl tran  42.0      14  0.0003   28.5   1.1   15   48-62      4-18  (233)
441 KOG0924|consensus               42.0      15 0.00033   33.1   1.5   20   43-62    369-388 (1042)
442 PRK13949 shikimate kinase; Pro  41.9      14  0.0003   26.7   1.1   16   47-62      3-18  (169)
443 cd04139 RalA_RalB RalA/RalB su  41.9      13 0.00028   25.4   1.0   15   48-62      3-17  (164)
444 PRK14528 adenylate kinase; Pro  41.9      14  0.0003   27.0   1.1   16   47-62      3-18  (186)
445 cd01860 Rab5_related Rab5-rela  41.8      16 0.00034   25.1   1.4   16   47-62      3-18  (163)
446 COG5022 Myosin heavy chain [Cy  41.7      17 0.00037   35.0   1.9   21   42-62    149-169 (1463)
447 KOG0987|consensus               41.7      29 0.00064   30.0   3.2   35   23-62    120-154 (540)
448 PF13166 AAA_13:  AAA domain     41.7      12 0.00025   33.1   0.8   16   47-62     18-33  (712)
449 TIGR01447 recD exodeoxyribonuc  41.7      10 0.00022   33.2   0.4   17   46-62    161-177 (586)
450 TIGR02030 BchI-ChlI magnesium   41.7      21 0.00046   29.0   2.3   37   23-63      7-43  (337)
451 TIGR00150 HI0065_YjeE ATPase,   41.6     9.2  0.0002   26.8   0.1   19   46-64     23-41  (133)
452 cd00154 Rab Rab family.  Rab G  41.6     9.7 0.00021   25.6   0.3   16   47-62      2-17  (159)
453 COG1660 Predicted P-loop-conta  41.5 1.5E+02  0.0033   23.6   6.8   37   25-62    218-258 (286)
454 PTZ00035 Rad51 protein; Provis  41.4      21 0.00045   29.0   2.2   29   34-62    104-135 (337)
455 PRK10919 ATP-dependent DNA hel  41.2      13 0.00028   33.0   1.0   17   47-63     17-33  (672)
456 TIGR01613 primase_Cterm phage/  41.2      14  0.0003   29.2   1.1   19   44-62     75-93  (304)
457 COG0396 sufC Cysteine desulfur  41.2      19 0.00041   28.1   1.7   26   39-64     18-52  (251)
458 PRK14956 DNA polymerase III su  41.1      35 0.00075   29.3   3.5   25   38-62     32-57  (484)
459 cd03255 ABC_MJ0796_Lo1CDE_FtsE  41.1      11 0.00023   27.9   0.4   16   47-62     32-47  (218)
460 COG1763 MobB Molybdopterin-gua  41.1 1.2E+02  0.0025   22.0   5.8   13   50-62      7-19  (161)
461 cd03258 ABC_MetN_methionine_tr  41.0      11 0.00024   28.3   0.5   18   45-62     31-48  (233)
462 COG1162 Predicted GTPases [Gen  41.0      38 0.00082   27.2   3.5   64   37-109   158-222 (301)
463 PF04670 Gtr1_RagA:  Gtr1/RagA   41.0      13 0.00028   28.6   0.9   15   48-62      2-16  (232)
464 PRK14723 flhF flagellar biosyn  40.8      11 0.00025   34.0   0.6   17   46-62    186-202 (767)
465 cd00561 CobA_CobO_BtuR ATP:cor  40.8     9.7 0.00021   27.6   0.1   19   46-64      3-21  (159)
466 PF13481 AAA_25:  AAA domain; P  40.8     9.7 0.00021   27.4   0.1   27   36-62     20-49  (193)
467 cd00983 recA RecA is a  bacter  40.7      27 0.00059   28.3   2.7   29   34-62     40-72  (325)
468 KOG0925|consensus               40.7      18 0.00038   31.4   1.6   20   43-62     60-79  (699)
469 TIGR01587 cas3_core CRISPR-ass  40.6      14  0.0003   29.5   1.1   15   48-62      2-16  (358)
470 KOG0335|consensus               40.6      14  0.0003   31.5   1.1   58   41-105   109-189 (482)
471 cd01862 Rab7 Rab7 subfamily.    40.6      10 0.00022   26.3   0.3   16   47-62      2-17  (172)
472 COG0419 SbcC ATPase involved i  40.6      12 0.00025   34.4   0.7   26   45-70     25-57  (908)
473 PRK15424 propionate catabolism  40.5      20 0.00043   31.1   2.0   21   42-62    239-259 (538)
474 PRK13947 shikimate kinase; Pro  40.5      16 0.00034   25.8   1.2   16   47-62      3-18  (171)
475 cd02028 UMPK_like Uridine mono  40.5      14 0.00031   26.8   1.0   15   48-62      2-16  (179)
476 KOG0328|consensus               40.4      32  0.0007   27.8   3.0   25   36-62     57-81  (400)
477 PF01078 Mg_chelatase:  Magnesi  40.3      24 0.00053   26.7   2.2   17   46-62     23-39  (206)
478 cd04119 RJL RJL (RabJ-Like) su  40.3      10 0.00023   26.0   0.3   16   47-62      2-17  (168)
479 PF05872 DUF853:  Bacterial pro  40.3      13 0.00028   31.7   0.8   14   49-62     23-36  (502)
480 PLN03137 ATP-dependent DNA hel  40.3      23 0.00051   33.6   2.5   27   34-62    466-492 (1195)
481 PRK10689 transcription-repair   40.2      31 0.00067   32.8   3.3   37   21-61    601-637 (1147)
482 cd01983 Fer4_NifH The Fer4_Nif  40.2      12 0.00027   22.9   0.6   15   48-62      2-16  (99)
483 TIGR02974 phageshock_pspF psp   40.1      20 0.00043   28.8   1.9   20   43-62     20-39  (329)
484 TIGR00390 hslU ATP-dependent p  40.1      12 0.00026   31.6   0.6   17   46-62     48-64  (441)
485 TIGR03608 L_ocin_972_ABC putat  40.0      12 0.00025   27.5   0.5   16   47-62     26-41  (206)
486 TIGR00174 miaA tRNA isopenteny  40.0      15 0.00032   29.2   1.1   15   48-62      2-16  (287)
487 COG1100 GTPase SAR1 and relate  40.0      10 0.00023   27.7   0.2   17   46-62      6-22  (219)
488 cd03243 ABC_MutS_homologs The   39.9      13 0.00028   27.4   0.7   17   46-62     30-46  (202)
489 cd03226 ABC_cobalt_CbiO_domain  39.9      12 0.00025   27.5   0.5   16   47-62     28-43  (205)
490 COG1660 Predicted P-loop-conta  39.9      48   0.001   26.3   3.8   34   47-80      3-45  (286)
491 cd04160 Arfrp1 Arfrp1 subfamil  39.8      10 0.00023   26.3   0.2   16   47-62      1-16  (167)
492 PRK14955 DNA polymerase III su  39.8      33 0.00072   28.3   3.1   21   42-62     34-55  (397)
493 cd03275 ABC_SMC1_euk Eukaryoti  39.7      11 0.00025   28.7   0.4   16   47-62     24-39  (247)
494 cd03265 ABC_DrrA DrrA is the A  39.7      12 0.00025   27.9   0.5   17   46-62     27-43  (220)
495 COG3598 RepA RecA-family ATPas  39.6      13 0.00029   30.4   0.8   40   21-62     66-106 (402)
496 PLN02165 adenylate isopentenyl  39.6      15 0.00033   29.9   1.1   16   47-62     45-60  (334)
497 TIGR01166 cbiO cobalt transpor  39.4      12 0.00026   27.1   0.5   16   47-62     20-35  (190)
498 cd03218 ABC_YhbG The ABC trans  39.4      12 0.00026   28.0   0.5   17   46-62     27-43  (232)
499 cd04101 RabL4 RabL4 (Rab-like4  39.3      11 0.00024   26.0   0.3   15   48-62      3-17  (164)
500 cd03293 ABC_NrtD_SsuB_transpor  39.2      12 0.00026   27.8   0.5   16   47-62     32-47  (220)

No 1  
>KOG4280|consensus
Probab=100.00  E-value=6.2e-42  Score=285.56  Aligned_cols=141  Identities=39%  Similarity=0.725  Sum_probs=131.5

Q ss_pred             CCCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccC-CCCCCcHHHHHHHH
Q psy12524          1 KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGS-QDNKGIIPRLCDSL   79 (151)
Q Consensus         1 ~~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~-~~~~Gli~~~~~~l   79 (151)
                      +++|+|+||.||       +++++|++||+.++.|+|+++++|||+||||||+|||||||||+|. +...|||||++++|
T Consensus        49 ~~~~~ftfD~vf-------~~~stQ~dvy~~~~~~lV~svl~GyNgtvFaYGQTGsGKTyTM~G~~~~~~GiiPraf~~L  121 (574)
T KOG4280|consen   49 GKPKSFTFDAVF-------DSDSTQDDVYQETVAPLVESVLEGYNGTVFAYGQTGSGKTYTMIGPDPELRGLIPRAFEHL  121 (574)
T ss_pred             CCCCCceeeeee-------cCCCCHHHHHHHHhHHHHHHHhcccCceEEEeccCCCCCceEeeCCChhhCCchhHHHHHH
Confidence            468899999999       8899999999999999999999999999999999999999999998 56799999999999


Q ss_pred             HHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         80 FDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        80 f~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      |+.++..+... +|+|++||+|||||+|+|||++.+. +.|.++|+++.|+||+||+++.|.+++++..+|
T Consensus       122 F~~I~~~~~~~-~f~vrvS~lEiYnE~i~DLL~~~~~-~~l~lre~p~~Gv~V~nlse~~v~s~~d~~~~l  190 (574)
T KOG4280|consen  122 FRHIDERKEKT-RFLVRVSYLEIYNESIRDLLSPVNP-KGLELREDPKCGVYVENLSEMDVESAEDAQQLL  190 (574)
T ss_pred             HHHHHhccccc-eEEEEeehHHHHhHHHHHHhCccCc-CCceeeEcCCCceEecCcceeecCCHHHHHHHH
Confidence            99999776444 8999999999999999999998753 589999999999999999999999999998775


No 2  
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup. The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a sec
Probab=100.00  E-value=5.5e-40  Score=263.51  Aligned_cols=139  Identities=34%  Similarity=0.632  Sum_probs=130.2

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFD   81 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~   81 (151)
                      ++++|+||+||       +++++|++||+.++.|+|+++++|+|+||||||++||||||||+|+..++||+||++++||+
T Consensus        52 ~~~~f~Fd~vf-------~~~~~q~~vf~~~~~plv~~~~~G~n~~i~ayGqtGSGKTyTm~G~~~~~Giipr~~~~LF~  124 (338)
T cd01370          52 KELKYSFDRVF-------DETSTQEEVYENTTKPLVDGVLNGYNATVFAYGATGAGKTHTMLGTDSDPGLMVLTMKDLFD  124 (338)
T ss_pred             CceEEEecccc-------CCCCCHHHHHHHHHHHHHHHHHCCCCceEEeeCCCCCCCeEEEcCCCCCCchHHHHHHHHHH
Confidence            36899999999       88999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         82 LIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        82 ~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      .++... .++.+.|.+||+|||||+|+|||++.  ..++++++++.++++++|++++.|.|++|+.++|
T Consensus       125 ~i~~~~-~~~~~~v~vS~~EIyne~v~DLL~~~--~~~l~i~ed~~~~~~v~gl~~~~v~s~~e~~~~l  190 (338)
T cd01370         125 KIEERK-DDKEFEVSLSYLEIYNETIRDLLSPS--SGPLELREDPNQGIVVAGLTEHQPKSAEEILELL  190 (338)
T ss_pred             hhhhcc-cCceEEEEEEEEEEECCEEEECCCCC--CCCceEEEcCCCCEEeCCcEEEEeCCHHHHHHHH
Confidence            998654 45789999999999999999999975  4579999999999999999999999999998765


No 3  
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins. KIF1A (Unc104) transports synaptic vesicles to the nerve  terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively.
Probab=100.00  E-value=1e-39  Score=263.59  Aligned_cols=149  Identities=63%  Similarity=1.098  Sum_probs=137.1

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFD   81 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~   81 (151)
                      .+++|+||+|||+.|......++|++||+.++.|+|+++++|+|+||+|||++||||||||+|+..++||+||++++||+
T Consensus        46 ~~~~f~FD~vf~~~~~~~~~~~tq~~vf~~~~~p~v~~~l~G~n~~i~ayGqtGSGKT~Tm~G~~~~~Gli~r~~~~Lf~  125 (356)
T cd01365          46 KPKSFSFDHSYWSHDSEDPHYASQEDVFEDLGRELLDHAFEGYNVCLFAYGQTGSGKSYTMMGYKEEKGIIPRLCEELFQ  125 (356)
T ss_pred             CceEEECCeEecccCCCCCCCCCHHHHHHHHHHHHHHHHhCCCceEEEEecCCCCCCeEEecCCCCCCchHHHHHHHHHH
Confidence            46789999999887766666799999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCceEEEEEEEEEEECCeeeecCCCCC-CCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         82 LIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKA-NKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        82 ~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~-~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      .++........+.|.+||+|||||+|+|||++.. .+..+++++++.+|++|+|++++.|.|++|+.++|
T Consensus       126 ~~~~~~~~~~~~~v~~S~~EIy~e~v~DLL~~~~~~~~~l~i~~~~~~g~~v~gl~~~~v~s~~e~~~~l  195 (356)
T cd01365         126 RIESKKEQNLSYEVEVSYMEIYNEKVRDLLNPKKKNKGNLKVREHPVLGPYVEDLSKVAVTSYEDIQNLL  195 (356)
T ss_pred             HHhhccccCceEEEEEEEEEEECCeeeeCCCCCccCCcCceEEECCCCCEEeCCCEEEEeCCHHHHHHHH
Confidence            9987766567899999999999999999999764 34579999999999999999999999999998765


No 4  
>KOG0245|consensus
Probab=100.00  E-value=2.5e-41  Score=290.82  Aligned_cols=149  Identities=57%  Similarity=1.000  Sum_probs=139.9

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCC--CCCCcHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQ--DNKGIIPRLCDSL   79 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~--~~~Gli~~~~~~l   79 (151)
                      ....|+||+.||+||+.-+..++|..||+....++++++++|||+||||||+|||||+|||+|..  .++|||||++++|
T Consensus        45 ~~~~FtfD~SYWS~d~edPhfAsQ~qVYedlg~~mL~~AfEGYN~ClFAYGQTGSGKSYTMMG~~~~~e~GIIPrlCEeL  124 (1221)
T KOG0245|consen   45 DAPKFTFDYSYWSHDSEDPHFASQKQVYEDLGREMLDHAFEGYNVCLFAYGQTGSGKSYTMMGFQEPDEPGIIPRLCEEL  124 (1221)
T ss_pred             cCCceecceeeecCCCCCCchhhHHHHHHHHhHHHHHHHhcccceEEEEeccCCCCcceeeeccCCCCCCCchhHHHHHH
Confidence            34569999999999988777899999999999999999999999999999999999999999987  7899999999999


Q ss_pred             HHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         80 FDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        80 f~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      |+++.....++..|.|.|||+|||||+|+|||+..+++..|++||++..|+||++|+.+.|+|+.++.+|+
T Consensus       125 F~ri~~nq~~~~sy~VevSymEIYcErVrDLL~~p~~kg~LRVREHP~lGPYVedLS~~aV~Sy~dI~~~m  195 (1221)
T KOG0245|consen  125 FSRIADNQSQQMSYSVEVSYMEIYCERVRDLLNAPKSKGGLRVREHPILGPYVEDLSKLAVTSYADIQDLM  195 (1221)
T ss_pred             HHHHhhcccccceEEEEEeehhHHHHHHHHHhhCCCCCCCceeeccCccChhHhHhhhcccccHHHHHHHH
Confidence            99999988889999999999999999999999944467799999999999999999999999999998765


No 5  
>KOG0242|consensus
Probab=100.00  E-value=4.5e-40  Score=281.70  Aligned_cols=137  Identities=42%  Similarity=0.729  Sum_probs=130.3

Q ss_pred             CeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHHH
Q psy12524          3 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDL   82 (151)
Q Consensus         3 ~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~~   82 (151)
                      +..|.||+||       +++++|++||+..+.|+|.+++.|+|++|||||+|||||||||.|...+|||+|+++++||+.
T Consensus        52 ~~~y~FD~VF-------~~~~t~~~VYe~~tkpiv~~~l~G~N~TVFAYG~TgSGKTyTM~G~~~~PGii~la~~dif~~  124 (675)
T KOG0242|consen   52 PEKYEFDRVF-------GEESTQEDVYERTTKPLLLSVLEGFNATVFAYGQTGSGKTYTMSGSEDDPGIIPLAMKDIFEK  124 (675)
T ss_pred             ccceeeeeec-------CCCCCHHHHHHhccHHHHHHHhcCcccceeeecCCCCCCceEEeccCCCCCeeehHHHHHHHH
Confidence            4789999999       999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         83 IAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        83 ~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      +....  ++.|.+.+||+|||||.|+|||+++..  .|+|+||+.+|++|+||++..|.|.+++..||
T Consensus       125 I~~~~--~r~f~v~vSYlEIYNE~I~DLL~~~~~--~L~irED~~~gi~V~gL~e~~v~s~e~~~~ll  188 (675)
T KOG0242|consen  125 IDKSG--EREFSVRVSYLEIYNERIRDLLNPDGG--DLRLREDSEGGIVVPGLTEETVSSREELLELL  188 (675)
T ss_pred             HHhcC--CceeEEEEEEEEEeccccccccCCCCC--CceEeEcCCCCEEecCCeeecCCCHHHHHHHH
Confidence            98665  779999999999999999999998644  69999999999999999999999999999875


No 6  
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup. Members of this group may play a role in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, a
Probab=100.00  E-value=3.6e-39  Score=259.38  Aligned_cols=135  Identities=36%  Similarity=0.628  Sum_probs=126.4

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFD   81 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~   81 (151)
                      ++++|.||+||       +++++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+..++||+||++++||+
T Consensus        53 ~~~~f~Fd~vf-------~~~~tq~~vy~~~~~p~v~~~l~G~n~ti~aYGqtGSGKTyTm~G~~~~~Gli~r~~~~lF~  125 (345)
T cd01368          53 KETKFSFSKVF-------GPNTTQKEFFEGTALPLVQDLLKGKNSLLFTYGVTNSGKTYTMQGSPGDGGILPRSLDVIFN  125 (345)
T ss_pred             CceEeecCeEE-------CCCCCHHHHHHHHHHHHHHHHhCCCceEEEEeCCCCCCCeEEecCCCCCCchHHHHHHHHHH
Confidence            46789999999       89999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCC----CceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         82 LIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKAN----KQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        82 ~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~----~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      .+..       +.|.+||+|||||+|+|||++.+.    ++++++++++.++++|+|++++.|.|++|+.++|
T Consensus       126 ~~~~-------~~v~~S~~EIyne~v~DLL~~~~~~~~~~~~l~i~ed~~~~~~i~gl~~~~v~s~~e~~~~l  191 (345)
T cd01368         126 SIGG-------YSVFVSYVEIYNNYIYDLLEDSPSSTKKRQSLRLREDHNGNMYVAGLTEVEVSSTEEAREVF  191 (345)
T ss_pred             HHHh-------eeEEEEEEEEeCCEeEeCCCCccccccCCCceEEEECCCCCEEecCCEEEEeCCHHHHHHHH
Confidence            8764       889999999999999999987543    3579999999999999999999999999998764


No 7  
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup. Members of this subgroup seem to play a role in mitosis and meiosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second
Probab=100.00  E-value=4.8e-39  Score=257.96  Aligned_cols=140  Identities=44%  Similarity=0.830  Sum_probs=127.0

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCC--------CCCcHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQD--------NKGIIP   73 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~--------~~Gli~   73 (151)
                      ++++|+||+||       +++++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+..        ++||+|
T Consensus        39 ~~~~f~FD~vf-------~~~~~q~~vy~~~~~p~v~~~~~G~n~ti~aYGqTGSGKTyTm~G~~~~~~~~~~~~~Giip  111 (337)
T cd01373          39 PPRMFTFDHVA-------DSNTNQEDVFQSVGKPLVEDCLSGYNGSIFAYGQTGSGKTYTMMGPSSSDDESPHGLQGVIP  111 (337)
T ss_pred             CCcEEeCCeEe-------CCCCCHHHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCceEEecCCCCccccccccCCCHHH
Confidence            46899999999       889999999999999999999999999999999999999999999753        589999


Q ss_pred             HHHHHHHHHHHhhc---CCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         74 RLCDSLFDLIAKQE---SSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        74 ~~~~~lf~~~~~~~---~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      |++++||+.++...   .....+.|.+||+|||||+|+|||++..  ..+++++++.++++|+|++++.|.|++|+.++|
T Consensus       112 r~~~~Lf~~i~~~~~~~~~~~~~~v~~S~~EIyne~v~DLL~~~~--~~l~i~e~~~~~~~v~gl~~~~v~s~~e~~~ll  189 (337)
T cd01373         112 RIFEYLFSLIQREEEKRGDGLKFLCKCSFLEIYNEQITDLLDPTS--RNLKIREDIKKGVYVENLTEEYVSSYEDVYQVL  189 (337)
T ss_pred             HHHHHHHHHHHhhhhhcccCceEEEEEEEEeecCCEeeeCCCCCC--CCceEEECCCCCEEeCCCEEEEeCCHHHHHHHH
Confidence            99999999886542   2345789999999999999999998753  479999999999999999999999999998875


No 8  
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group. KIF2 is a protein expressed in neurons, which has been associated with axonal transport and neuron development; alternative splice forms have been implicated in lysosomal translocation. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found in the middle (M-type) of the protein chain. M-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second (KIF2 may be slower). To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and lo
Probab=100.00  E-value=9.8e-39  Score=254.79  Aligned_cols=135  Identities=34%  Similarity=0.556  Sum_probs=127.1

Q ss_pred             CeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHHH
Q psy12524          3 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDL   82 (151)
Q Consensus         3 ~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~~   82 (151)
                      +++|+||+||       +++++|++||+.++.|+|+.+++|+|+||||||++||||||||+|+..++||+||++++||+.
T Consensus        50 ~~~f~FD~vf-------~~~~~q~~vf~~~~~plv~~~~~G~n~~i~ayGqtGSGKTyTm~G~~~~~Glipr~~~~lf~~  122 (322)
T cd01367          50 KHTFRFDYVF-------DEAVTNEEVYRSTVKPLIPHVFEGGVATCFAYGQTGSGKTYTMLGDENQEGLYALAARDIFRL  122 (322)
T ss_pred             CceEecceEE-------CCCCCHHHHHHHHHHHHHHHHhCCCceEEEeccCCCCCCceEecCcCCcCccHHHHHHHHHHH
Confidence            5899999999       889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         83 IAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        83 ~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      ++...   ..+.|.+||+|||||+++|||++   +.++++++++.++++|+|+++++|.|++|+.++|
T Consensus       123 ~~~~~---~~~~v~~S~~EIy~e~v~DLL~~---~~~l~i~~~~~~~~~v~~l~~~~v~s~~e~~~~l  184 (322)
T cd01367         123 LAQPN---DDLGVTVSFFEIYGGKLFDLLND---RKRLSVLEDGKGNVQIVGLTEKPVTSVDELLELI  184 (322)
T ss_pred             Hhccc---cccEEEEEEEeeecCchhhhccC---ccceeEEEcCCCCEEeCCCEEEEeCCHHHHHHHH
Confidence            87544   57899999999999999999986   4579999999999999999999999999998764


No 9  
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup. Members of this group might play a role in regulating chromosomal movement along microtubules in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through
Probab=100.00  E-value=6.9e-38  Score=249.62  Aligned_cols=137  Identities=36%  Similarity=0.568  Sum_probs=127.2

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFD   81 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~   81 (151)
                      .+++|+||+||       +++++|++||+.++.|+|+.+++|+|+||++||++||||||||+|+..++||+||++++||+
T Consensus        45 ~~~~f~FD~vf-------~~~~~q~~vy~~~~~plv~~~~~G~n~~i~ayG~tgSGKTyTm~G~~~~~Glipr~~~~Lf~  117 (319)
T cd01376          45 ETKKYQFDAFY-------GTECTQEDIFSREVKPIVPHLLSGQNATVFAYGSTGAGKTHTMLGDPNEPGLIPRTLSDLLR  117 (319)
T ss_pred             CccEEecCeEE-------CCCCCHHHHHHHHHHHHHHHHhCCCceEEEEECCCCCCCcEEEeCCcCccchHHHHHHHHHH
Confidence            46899999999       88999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         82 LIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        82 ~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      .++..   .+.+.|.+||+|||+|+++|||++.  +..+++++++.++++++|++++.|.|++|+.+++
T Consensus       118 ~~~~~---~~~~~v~~S~~EIy~e~v~DLL~~~--~~~l~i~~~~~~~~~v~gl~~~~v~s~~e~~~~l  181 (319)
T cd01376         118 MGRKQ---AWTGAFSMSYYEIYNEKVYDLLEPA--KKELPIREDKDGNILIVGLTSKPIKSMAEFEEAY  181 (319)
T ss_pred             HHhhc---cccceEEEEEEEEECCEeeEccCCC--CCCceEEEcCCCCEEeeCCEEEEeCCHHHHHHHH
Confidence            87644   3578999999999999999999975  3479999999999999999999999999998764


No 10 
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to
Probab=100.00  E-value=1.2e-37  Score=248.32  Aligned_cols=138  Identities=38%  Similarity=0.690  Sum_probs=129.0

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFD   81 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~   81 (151)
                      .+++|+||+||       +++++|++||+.++.|+|+.+++|+|++|++||++||||||||+|+..++||+||++++||+
T Consensus        38 ~~~~f~fd~vf-------~~~~~q~~vy~~~~~p~v~~~l~G~n~~i~ayG~tgSGKT~T~~G~~~~~Gli~r~~~~lf~  110 (321)
T cd01374          38 PGQSFTFDRVF-------GGESTNREVYERIAKPVVRSALEGYNGTIFAYGQTSSGKTFTMSGDEQEPGIIPLAVRDIFQ  110 (321)
T ss_pred             CCeEEecCeEE-------CCCCCHHHHHHHHHHHHHHHHHCCCceeEEeecCCCCCCceeccCCCCCCchHHHHHHHHHH
Confidence            46899999999       88999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         82 LIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        82 ~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      .++...  +..+.|++||+|||||+|+|||++.+  ..+++++++.+|++++|++++.|.|++|+.++|
T Consensus       111 ~~~~~~--~~~~~v~~S~~Eiy~e~v~DLL~~~~--~~l~i~~~~~~~~~v~gl~~~~v~s~~e~~~~l  175 (321)
T cd01374         111 RIQDTP--DREFLLRVSYLEIYNEKIKDLLSPSP--QELRIREDPNKGVVVAGLTEEIVTSPEHLLQLI  175 (321)
T ss_pred             HHhccc--CceEEEEEEEEEEEcCEeEEccCCCC--CCceEEECCCCCEEeCCceEEEeCCHHHHHHHH
Confidence            987554  55899999999999999999999764  479999999999999999999999999998764


No 11 
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins. Subgroup of kinesins, which form heterotrimers composed of 2 kinesins and one non-motor accessory subunit. Kinesins II play important roles in ciliary transport, and have been implicated in neuronal transport, melanosome transport, the secretory pathway, and mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this group the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain
Probab=100.00  E-value=1.4e-37  Score=249.22  Aligned_cols=139  Identities=42%  Similarity=0.737  Sum_probs=128.8

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCC---CCCcHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQD---NKGIIPRLCDS   78 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~---~~Gli~~~~~~   78 (151)
                      .+++|+||+||       +++++|++||+.++.|+|+++++|+|+||+|||++||||||||+|+..   .+||+||++++
T Consensus        46 ~~~~f~fd~vf-------~~~~~q~~vy~~~~~plv~~~~~G~n~~i~ayG~tgSGKTyTm~G~~~~~~~~Glipr~~~~  118 (333)
T cd01371          46 PPKVFTFDAVY-------DPNSTQEDVYNETARPLVDSVLEGYNGTIFAYGQTGTGKTFTMEGVREPPELRGIIPNSFAH  118 (333)
T ss_pred             CCceeeecccc-------CCCccHHHHHHHHHHHHHHHHhCCCceeEEecCCCCCCCcEeecCCCCcccccchHHHHHHH
Confidence            46889999999       889999999999999999999999999999999999999999999887   89999999999


Q ss_pred             HHHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         79 LFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        79 lf~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      ||+.++....  ..+.|.+||+|||||+|+|||++.. ...+++++++.++++|+|++++.|.|++|+.++|
T Consensus       119 Lf~~~~~~~~--~~~~v~~S~~Eiy~e~v~DLL~~~~-~~~l~i~~~~~~~~~v~~l~~~~v~s~~~~~~~l  187 (333)
T cd01371         119 IFGHIAKAEN--VQFLVRVSYLEIYNEEVRDLLGKDQ-KKKLELKERPDRGVYVKDLSMFVVKNAEEMDKLM  187 (333)
T ss_pred             HHHHHhhccC--ccEEEEEEEEEeeCCeeeeCCCCCC-CCceeEEEcCCCCEEeCCCEEEEeCCHHHHHHHH
Confidence            9999876543  5799999999999999999999754 3579999999999999999999999999998764


No 12 
>KOG0243|consensus
Probab=100.00  E-value=1e-38  Score=277.18  Aligned_cols=138  Identities=38%  Similarity=0.671  Sum_probs=126.2

Q ss_pred             CeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc--------CCCCCCcHHH
Q psy12524          3 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG--------SQDNKGIIPR   74 (151)
Q Consensus         3 ~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G--------~~~~~Gli~~   74 (151)
                      .|+|+||+||       ++.+.|.++|+.++.|+|+.|+.||||||||||+||+||||||.|        .++++|||||
T Consensus        94 ~k~ftFDkVF-------Gpes~Q~d~Y~~~v~p~i~eVl~GyNCTIFAYGQTGTGKTyTMeG~~~~~~g~l~~~aGIIPR  166 (1041)
T KOG0243|consen   94 DKTFTFDKVF-------GPESQQEDLYDQAVSPIIKEVLEGYNCTIFAYGQTGTGKTYTMEGGERKKNGELPSEAGIIPR  166 (1041)
T ss_pred             cceeecceee-------CcchhHHHHHHHHHHHHHHHHhccCCceEEEecCCCCCceeeeecCcccccCCCCccCCcchH
Confidence            5789999999       999999999999999999999999999999999999999999999        4678999999


Q ss_pred             HHHHHHHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCC-ceeeEEecC-----CCCeEEcCceEEEcCCHHHHhc
Q psy12524         75 LCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANK-QSLKVREHN-----VLGPYVDGLSQLAVTSFQARAN  148 (151)
Q Consensus        75 ~~~~lf~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~-~~l~i~e~~-----~~g~~v~gl~~~~v~s~~e~~~  148 (151)
                      ++.+||..++...   ..|+|+|||+|+|||.++|||+++... ..+++++++     .+|++|+||.|+.|.++.|+.+
T Consensus       167 al~~IFd~Le~~~---~EYsvKVSfLELYNEEl~DLLa~~~~~~~~~~~k~~~~~~~~kggV~vkGlEEi~V~~A~ei~k  243 (1041)
T KOG0243|consen  167 ALRQIFDTLEAQG---AEYSVKVSFLELYNEELTDLLASEDTSDKKLRIKDDSTIVDGKGGVIVKGLEEIIVTNADEIYK  243 (1041)
T ss_pred             HHHHHHHHHHhcC---CeEEEEEEehhhhhHHHHHhcCCccccccccccccCCcccCCcCcEEEecceeeeecchhHHHH
Confidence            9999999988543   589999999999999999999987654 567777665     7889999999999999999998


Q ss_pred             CC
Q psy12524        149 PT  150 (151)
Q Consensus       149 ll  150 (151)
                      ||
T Consensus       244 lL  245 (1041)
T KOG0243|consen  244 LL  245 (1041)
T ss_pred             HH
Confidence            86


No 13 
>KOG0241|consensus
Probab=100.00  E-value=1.1e-38  Score=272.74  Aligned_cols=150  Identities=71%  Similarity=1.169  Sum_probs=144.5

Q ss_pred             CCCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHH
Q psy12524          1 KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLF   80 (151)
Q Consensus         1 ~~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf   80 (151)
                      |.||+|+||++||+.|+-...-++|+.||+....-+++.+|+|||+|+||||++||||+|+|+|...+||||||.++.||
T Consensus        50 k~pktFAFDhcF~s~dpes~n~agQE~Vf~~lG~~il~naf~GyNaCifaYGQtGsGKsYsmmGt~~QpGiIPrlc~~lF  129 (1714)
T KOG0241|consen   50 KGPKTFAFDHCFWSMDPESKNYAGQETVFKCLGEGILENAFQGYNACIFAYGQTGSGKSYSMMGTAEQPGIIPRLCESLF  129 (1714)
T ss_pred             CCCceeecccccccCCccccccccchhHHHhcchHHHHHHhhccceeeEEecccCCCceeEeeccCCCCCchhHHHHHHH
Confidence            57999999999999998777779999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         81 DLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        81 ~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      ..+......+..|+|.+||+|||||+++|||.|+.+++.|++++|.-.|+||.||++..|+|++|+..||
T Consensus       130 e~I~k~~n~~~tfkVeVSymEIynEkv~DLLdPk~ssqtlkVrehsvlGp~vdGLS~laV~S~qdId~lm  199 (1714)
T KOG0241|consen  130 ERIDKESNPSQTFKVEVSYMEIYNEKVRDLLDPKGSSQTLKVREHSVLGPYVDGLSQLAVTSFQDIDSLM  199 (1714)
T ss_pred             HHHHhccCCCceEEEEEEHHHHhhcchhhhhCCCCCcceeEEeecccccccccchhhhhcccHHHHHHHH
Confidence            9999998889999999999999999999999999999999999999999999999999999999998775


No 14 
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 
Probab=100.00  E-value=4.4e-37  Score=246.38  Aligned_cols=139  Identities=40%  Similarity=0.665  Sum_probs=126.8

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCC---CCCCcHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQ---DNKGIIPRLCDS   78 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~---~~~Gli~~~~~~   78 (151)
                      .+++|+||+||       ++ ++|++||+.++.|+|+++++|+|+||+|||++||||||||+|+.   .++||+||++++
T Consensus        46 ~~~~f~FD~vf-------~~-~~q~~vy~~~~~p~v~~~~~G~n~~i~ayG~tgSGKTyTm~G~~~~~~~~Glipr~~~~  117 (334)
T cd01375          46 EDFSFKFDGVF-------HN-ASQEEVYETVAKPVVDSALDGYNGTIFAYGQTGAGKTFTMTGGTESYKDRGLIPRALEQ  117 (334)
T ss_pred             CceEEEcCccc-------CC-CCHHHHHHHHHHHHHHHHhCCCccceeeecCCCCCCeEEccCCCCcccCCchHHHHHHH
Confidence            35789999999       78 99999999999999999999999999999999999999999976   479999999999


Q ss_pred             HHHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCC----CCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         79 LFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKA----NKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        79 lf~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~----~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      ||+.++...  +..+.|.+||+|||||+++|||++..    ....+++++++.++++|+|++++.|.+++|+.+++
T Consensus       118 lf~~~~~~~--~~~~~v~~S~~Eiy~e~v~DLL~~~~~~~~~~~~l~i~e~~~~~~~v~gl~~~~v~s~~e~~~~~  191 (334)
T cd01375         118 VFREVAMRA--TKTYTVHVSYLEIYNEQLYDLLGDTPEALESLPAVTILEDSEQNIHVKGLSLHSATTEEEALNLL  191 (334)
T ss_pred             HHHHHHhcc--CcceEEEEEEEEEECCEeecCCCCCccccccCCceEEEEcCCCCEEeCCcEEEEeCCHHHHHHHH
Confidence            999987654  45789999999999999999999874    24579999999999999999999999999998764


No 15 
>PF00225 Kinesin:  Kinesin motor domain;  InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport. The kinesin motor activity is directed toward the microtubule's plus end. Kinesin is an oligomeric complex composed of two heavy chains and two light chains. The maintenance of the quaternary structure does not require interchain disulphide bonds. The heavy chain is composed of three structural domains: a large globular N-terminal domain which is responsible for the motor activity of kinesin (it is known to hydrolyse ATP, to bind and move on microtubules), a central alpha-helical coiled coil domain that mediates the heavy chain dimerisation; and a small globular C-terminal domain which interacts with other proteins (such as the kinesin light chains), vesicles and membranous organelles. A number of proteins have been recently found that contain a domain similar to that of the kinesin 'motor' domain [, ]:   Drosophila melanogaster claret segregational protein (ncd). Ncd is required for normal chromosomal segregation in meiosis, in females, and in early mitotic divisions of the embryo. The ncd motor activity is directed toward the microtubule's minus end.  Homo sapiens CENP-E []. CENP-E is a protein that associates with kinetochores during chromosome congression, relocates to the spindle midzone at anaphase, and is quantitatively discarded at the end of the cell division. CENP-E is probably an important motor molecule in chromosome movement and/or spindle elongation. H. sapiens mitotic kinesin-like protein-1 (MKLP-1), a motor protein whose activity is directed toward the microtubule's plus end.  Saccharomyces cerevisiae KAR3 protein, which is essential for nuclear fusion during mating. KAR3 may mediate microtubule sliding during nuclear fusion and possibly mitosis. S. cerevisiae CIN8 and KIP1 proteins which are required for the assembly of the mitotic spindle. Both proteins seem to interact with spindle microtubules to produce an outwardly directed force acting upon the poles.  Emericella nidulans (Aspergillus nidulans) bimC, which plays an important role in nuclear division. A. nidulans klpA.  Caenorhabditis elegans unc-104, which may be required for the transport of substances needed for neuronal cell differentiation. C. elegans osm-3.  Xenopus laevis Eg5, which may be involved in mitosis.  Arabidopsis thaliana KatA, KatB and katC.  Chlamydomonas reinhardtii FLA10/KHP1 and KLP1. Both proteins seem to play a role in the rotation or twisting of the microtubules of the flagella. C. elegans hypothetical protein T09A5.2.   The kinesin motor domain is located in the N-terminal part of most of the above proteins, with the exception of KAR3, klpA, and ncd where it is located in the C-terminal section. The kinesin motor domain contains about 330 amino acids. An ATP-binding motif of type A is found near position 80 to 90, the C-terminal half of the domain is involved in microtubule-binding.; GO: 0003777 microtubule motor activity, 0005524 ATP binding, 0007018 microtubule-based movement; PDB: 3NWN_A 2Y5W_A 2Y65_C 3BFN_A 2WBE_C 2ZFL_A 2ZFI_A 1I6I_A 2ZFM_A 1IA0_K ....
Probab=100.00  E-value=3.6e-37  Score=246.52  Aligned_cols=142  Identities=44%  Similarity=0.760  Sum_probs=129.5

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccC--CCCCCcHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGS--QDNKGIIPRLCDSL   79 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~--~~~~Gli~~~~~~l   79 (151)
                      ..++|+||+||       +++++|++||+.++.|+|+++++|+|+||++||++||||||||+|+  ..++||+|+++++|
T Consensus        39 ~~~~f~FD~vf-------~~~~~q~~vy~~~~~~~v~~~l~G~n~~i~ayG~tgSGKT~Tm~G~~~~~~~Gli~~~~~~l  111 (335)
T PF00225_consen   39 KEKSFRFDRVF-------DEDATQEDVYEEVVSPLVDSVLDGYNATIFAYGQTGSGKTYTMFGSNDPSEPGLIPRALRDL  111 (335)
T ss_dssp             EEEEEEESEEE-------ETTSTHHHHHHHHTHHHHHHHHTT-EEEEEEEESTTSSHHHHHTBSTSTTTBSHHHHHHHHH
T ss_pred             CceEEEcCeEE-------CCCCCHHHHHHHHHHHHHHHhhcCCceEEEeeccccccccccccccccccccchhhhHHHHH
Confidence            35789999999       7899999999999999999999999999999999999999999999  88999999999999


Q ss_pred             HHHHHhhcCC-CceEEEEEEEEEEECCeeeecCCCCC--CCceeeEEecCCCC-eEEcCceEEEcCCHHHHhcCC
Q psy12524         80 FDLIAKQESS-ELTYKVEVSYMEIYNEKVHDLLDPKA--NKQSLKVREHNVLG-PYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        80 f~~~~~~~~~-~~~~~v~~S~~eiy~e~v~DLL~~~~--~~~~l~i~e~~~~g-~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      |+.++..... ...+.|++||+|||+|+|+|||++.+  ....+++++++..| ++++|++++.|.|++|+.++|
T Consensus       112 f~~~~~~~~~~~~~~~v~vS~~EIy~e~v~DLL~~~~~~~~~~l~i~~~~~~g~~~i~~l~~~~v~s~~~~~~~l  186 (335)
T PF00225_consen  112 FSQIEERKEKSGYEFSVSVSYLEIYNEKVYDLLSPNNSKSRKPLKIREDSNKGSVYIKGLTEVEVKSAEEALQLL  186 (335)
T ss_dssp             HHHHHHHTTTSTEEEEEEEEEEEEETTEEEETTSTTSSSTTSEBEEEEETTTEEEEETTSEEEEESSHHHHHHHH
T ss_pred             hhhhccccccccccccccccchhhhhhhhhhhcCccccccccccceeeccccccceeeccccccccccccccccc
Confidence            9999876543 46899999999999999999999873  34589999999987 999999999999999998764


No 16 
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup. Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-c
Probab=100.00  E-value=8.4e-37  Score=243.84  Aligned_cols=139  Identities=45%  Similarity=0.768  Sum_probs=128.9

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCC---CCCcHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQD---NKGIIPRLCDS   78 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~---~~Gli~~~~~~   78 (151)
                      ..++|.||+||       +++++|++||+.++.|+|+.+++|+|++|++||++||||||||+|+..   .+||+||++++
T Consensus        41 ~~~~f~FD~vf-------~~~~~q~~vy~~~~~~~v~~~~~G~n~~i~ayG~tgSGKT~Tm~G~~~~~~~~Giipr~~~~  113 (325)
T cd01369          41 DGKTFSFDRVF-------PPNTTQEDVYNFVAKPIVDDVLNGYNGTIFAYGQTGSGKTYTMEGPPGDPELKGIIPRIVHD  113 (325)
T ss_pred             CceEEEcCeEE-------CCCCCHHHHHHHHHHHHHHHHHcCccceEEEeCCCCCCceEEecCCCCccccCChHHHHHHH
Confidence            46899999999       789999999999999999999999999999999999999999999987   89999999999


Q ss_pred             HHHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         79 LFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        79 lf~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      ||+.+... ..+..+.|++||+|||+|+++|||++.  +..+++++++.+|++++|++++.|.|++|+.+++
T Consensus       114 Lf~~~~~~-~~~~~~~v~~S~~EIy~e~v~DLL~~~--~~~l~i~~~~~~~~~v~gl~~~~v~s~~e~~~~i  182 (325)
T cd01369         114 IFEHISSM-DENLEFHVKVSYLEIYMEKIRDLLDVS--KDNLQVHEDKNRGVYVKGLTERFVSSPEEVLEVI  182 (325)
T ss_pred             HHHHHhhc-cCCceEEEEEEEEEEECCChhhcccCc--cCCceEEEcCCCCEEEcCCEEEEcCCHHHHHHHH
Confidence            99998765 345679999999999999999999975  3479999999999999999999999999998764


No 17 
>PLN03188 kinesin-12 family protein; Provisional
Probab=100.00  E-value=3.9e-37  Score=270.33  Aligned_cols=139  Identities=38%  Similarity=0.730  Sum_probs=126.3

Q ss_pred             CeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCC----------CCCCcH
Q psy12524          3 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQ----------DNKGII   72 (151)
Q Consensus         3 ~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~----------~~~Gli   72 (151)
                      .++|+||+||       +++++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+.          .++||+
T Consensus       131 ~qtFtFD~VF-------dp~aTQedVFe~vv~PLV~svLdGyNaTIFAYGQTGSGKTYTM~G~~~~~~de~~s~~e~GII  203 (1320)
T PLN03188        131 GQTFTFDSIA-------DPESTQEDIFQLVGAPLVENCLAGFNSSVFAYGQTGSGKTYTMWGPANGLLEEHLSGDQQGLT  203 (1320)
T ss_pred             CcEEeCCeee-------CCCCCHHHHHHHHHHHHHHHHhcCCcceeecCCCCCCCCCEeeCCCCCcccccccccccCCch
Confidence            4689999999       88999999999999999999999999999999999999999999963          468999


Q ss_pred             HHHHHHHHHHHHhh----cCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhc
Q psy12524         73 PRLCDSLFDLIAKQ----ESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARAN  148 (151)
Q Consensus        73 ~~~~~~lf~~~~~~----~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~  148 (151)
                      ||++++||+.+...    ......|.|++||+|||||+|+|||++..  ..|+|++++.+|++|.||+++.|.|++++.+
T Consensus       204 PRaledLF~~I~e~q~k~~d~~~~y~V~vSyLEIYNEkI~DLLsp~~--k~L~IRED~kgGv~VeGLTEv~V~S~ED~l~  281 (1320)
T PLN03188        204 PRVFERLFARINEEQIKHADRQLKYQCRCSFLEIYNEQITDLLDPSQ--KNLQIREDVKSGVYVENLTEEYVKTMKDVTQ  281 (1320)
T ss_pred             HHHHHHHHHHHHhhhhhccccccceEEEEEEEeeecCcceecccccc--CCceEEEcCCCCeEeCCCeEEeCCCHHHHHH
Confidence            99999999998643    22455799999999999999999999753  4799999999999999999999999999987


Q ss_pred             CC
Q psy12524        149 PT  150 (151)
Q Consensus       149 ll  150 (151)
                      +|
T Consensus       282 LL  283 (1320)
T PLN03188        282 LL  283 (1320)
T ss_pred             HH
Confidence            75


No 18 
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for mi
Probab=100.00  E-value=1.7e-36  Score=242.34  Aligned_cols=141  Identities=40%  Similarity=0.694  Sum_probs=130.8

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFD   81 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~   81 (151)
                      ..++|+||+||       +++++|++||+. +.|+|+++++|+|+||++||++||||||||+|...++||+||++++||+
T Consensus        43 ~~~~f~fD~vf-------~~~~~q~~v~~~-v~p~v~~~~~G~~~~i~ayG~tgSGKT~tl~G~~~~~Gli~r~~~~lf~  114 (329)
T cd01366          43 KKKSFSFDRVF-------DPDASQEDVFEE-VSPLVQSALDGYNVCIFAYGQTGSGKTYTMEGPPENPGIIPRALEQLFN  114 (329)
T ss_pred             CceEEecCEEE-------CCCCCHHHHHHH-HHHHHHHHhCCCceEEEEeCCCCCCCcEEecCCCCCCCcHHHHHHHHHH
Confidence            45789999999       889999999998 5999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCceEEEEEEEEEEECCeeeecCCCCC-CCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         82 LIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKA-NKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        82 ~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~-~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      .++........+.|.+||+|||+|+++|||++.+ .+..+++++++.++++++|++++.|.|++|+.+++
T Consensus       115 ~~~~~~~~~~~~~v~~S~~EIy~e~v~DLL~~~~~~~~~l~i~~~~~~~~~i~~l~~~~v~s~~e~~~~l  184 (329)
T cd01366         115 TAEELKEKGWSYTITASMLEIYNETIRDLLATKPAPKKKLEIKHDSKGETYVTNLTEVPVSSPEEVTRLL  184 (329)
T ss_pred             HHHhhhccCceEEEEEEEEEEECCEeEECCCCCcCCCCceEEEECCCCCEEecCCEEEEeCCHHHHHHHH
Confidence            9987766577999999999999999999999753 35689999999999999999999999999998764


No 19 
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Members of this group seem to perform a variety of functions, and have been implicated in neuronal organelle transport and chromosome segregation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain,
Probab=100.00  E-value=8.4e-37  Score=245.19  Aligned_cols=140  Identities=39%  Similarity=0.662  Sum_probs=128.3

Q ss_pred             CeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCC------CCCCcHHHHH
Q psy12524          3 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQ------DNKGIIPRLC   76 (151)
Q Consensus         3 ~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~------~~~Gli~~~~   76 (151)
                      +++|+||+||       +++++|++||+.++.|+|+.+++|+|+|||+||++||||||||+|+.      .++||+||++
T Consensus        39 ~~~f~FD~vf-------~~~~~q~~vy~~~~~plv~~~~~G~n~~i~ayG~tgSGKT~Tm~G~~~~~~~~~~~Giipr~~  111 (341)
T cd01372          39 DKSFTFDYVF-------DPSTSQEEVYNTCVAPLVDGLFEGYNATVLAYGQTGSGKTYTMGTAFTASEDEEEVGIIPRAI  111 (341)
T ss_pred             CcEEeccccC-------CCCCCHHHHHHHHHHHHHHHHhCCCccceeeecCCCCCCcEEecCCCccccccccCChHHHHH
Confidence            5789999999       78999999999999999999999999999999999999999999974      4799999999


Q ss_pred             HHHHHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCC-CCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         77 DSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKA-NKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        77 ~~lf~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~-~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      ++||+.++.... ...+.|.+||+|||||+++|||++.+ .+..+++++++.++++|.|++++.|.|++|+.++|
T Consensus       112 ~~LF~~~~~~~~-~~~~~v~vS~~EIy~e~v~DLL~~~~~~~~~l~i~e~~~~~~~i~gl~~~~v~s~~e~~~~l  185 (341)
T cd01372         112 QHIFKKIDEKKD-EPDFQLKVSFLELYNEEVRDLLSPSTSEKSPIQIREDSKGNIIIVGLTEVTVNSAQEVMSCL  185 (341)
T ss_pred             HHHHHHHHhccc-cceEEEEEEEEEeECCeeecCCCCcccCCCCceEEECCCCCEecCCCEEEEECCHHHHHHHH
Confidence            999999986543 45899999999999999999999764 34589999999999999999999999999998764


No 20 
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil d
Probab=100.00  E-value=1.3e-36  Score=245.18  Aligned_cols=139  Identities=39%  Similarity=0.669  Sum_probs=126.7

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCC-----------CCC
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQD-----------NKG   70 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~-----------~~G   70 (151)
                      ..++|+||+||       +++++|++||+.++.|+|+++++|+|++|||||++||||||||+|+..           .+|
T Consensus        46 ~~~~f~Fd~vf-------~~~~~q~~vy~~~~~plv~~~~~G~n~~i~ayG~tgSGKTyTl~G~~~~~~~~~~~~~~~~G  118 (352)
T cd01364          46 STKTYTFDKVF-------GPEADQIEVYSQVVSPILDEVLMGYNCTIFAYGQTGTGKTYTMEGDRTDNKGSTWELSPHAG  118 (352)
T ss_pred             cceeEeccccC-------CCCCCHHHHHHHHHHHHHHHHhCCCeEEEEECCCCCCCCcEEecCCCcccccccccccccCC
Confidence            46789999999       889999999999999999999999999999999999999999999743           489


Q ss_pred             cHHHHHHHHHHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCC-CCceeeEEec--CCCCeEEcCceEEEcCCHHHHh
Q psy12524         71 IIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKA-NKQSLKVREH--NVLGPYVDGLSQLAVTSFQARA  147 (151)
Q Consensus        71 li~~~~~~lf~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~-~~~~l~i~e~--~~~g~~v~gl~~~~v~s~~e~~  147 (151)
                      |+||++++||+.++..   ...+.|++||+|||||+++|||++.. .+.+++++++  +.+|++|+|++++.|.|++|+.
T Consensus       119 lipr~~~~Lf~~~~~~---~~~~~v~~S~~EIy~e~v~DLL~~~~~~~~~l~i~e~~~~~~g~~v~gl~~~~v~s~~e~~  195 (352)
T cd01364         119 IIPRALYQLFEKLESQ---NTEYSVKVSYLELYNEELFDLLSSESDLNKPLRIFDDTNNKGGVVIQGLEEITVNNANEGL  195 (352)
T ss_pred             chHHHHHHHHHHHHhc---cceeEEEEEEEEeeCCeeeeCCCCccccCccceEEeccCcCCCEEeCCcEEEEeCCHHHHH
Confidence            9999999999998754   45899999999999999999999764 3557999999  6999999999999999999998


Q ss_pred             cCC
Q psy12524        148 NPT  150 (151)
Q Consensus       148 ~ll  150 (151)
                      ++|
T Consensus       196 ~~l  198 (352)
T cd01364         196 KLL  198 (352)
T ss_pred             HHH
Confidence            764


No 21 
>cd00106 KISc Kinesin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coil
Probab=100.00  E-value=4.1e-36  Score=239.78  Aligned_cols=142  Identities=44%  Similarity=0.793  Sum_probs=132.2

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFD   81 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~   81 (151)
                      ++++|.||+||       +++++|++||+.++.|+|+++++|+|++|++||++||||||||+|+..++||+|+++++||+
T Consensus        43 ~~~~f~fd~vf-------~~~~~q~~v~~~~~~~~v~~~~~G~~~~i~~yG~tgSGKT~tl~G~~~~~Gli~~~~~~Lf~  115 (328)
T cd00106          43 GPKSFTFDHVF-------DPNSTQEDVYETTAKPLVESVLEGYNGTIFAYGQTGSGKTYTMFGSPKDPGIIPRALEDLFN  115 (328)
T ss_pred             CceEEECCeEE-------cCCCCHHHHHHHHHHHHHHHHhCCCceeEEEecCCCCCCeEEecCCCCCCchHHHHHHHHHH
Confidence            36899999999       78899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         82 LIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        82 ~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      .+.........+.|.+||+|||+|+++|||++.+.+..+++++++.+++++.|++++.|.|++|+.+++
T Consensus       116 ~~~~~~~~~~~~~v~~S~~Ei~~e~v~DLL~~~~~~~~l~i~~~~~~~~~v~~l~~~~v~s~~e~~~~l  184 (328)
T cd00106         116 LIDERKEKNKSFSVSVSYLEIYNEKVYDLLSPEPPSKPLSLREDPKGGVYVKGLTEVEVGSAEDALSLL  184 (328)
T ss_pred             HHhhccccCceEEEEEEEEEEECCEeEECCCCCCCCCCcEEEEcCCCCEEEeCCEEEEeCCHHHHHHHH
Confidence            988665445689999999999999999999986446689999999999999999999999999998764


No 22 
>smart00129 KISc Kinesin motor, catalytic domain. ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division.
Probab=100.00  E-value=2.9e-35  Score=235.63  Aligned_cols=139  Identities=49%  Similarity=0.824  Sum_probs=129.5

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFD   81 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~   81 (151)
                      ++++|+||+||       +++++|+++|+.++.|+|+.+++|+|++|++||++||||||||+|+..++||+|+++++||+
T Consensus        44 ~~~~f~fD~vf-------~~~~~q~~v~~~~~~p~v~~~~~G~~~~i~~yG~tgSGKT~tl~G~~~~~Gli~~~~~~Lf~  116 (335)
T smart00129       44 EEKKFTFDKVF-------GATASQEDVFEETAAPLVDSVLEGYNATIFAYGQTGSGKTYTMSGTPDSPGIIPRALKDLFE  116 (335)
T ss_pred             CCeEEecCEEE-------CCCCChHHHHHHHHHHHHHHHhcCCceeEEEeCCCCCCCceEecCCCCCCCHHHHHHHHHHH
Confidence            46899999999       89999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         82 LIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        82 ~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      .+.... ....+.|.+||+|||+|+++|||++.  +..+++++++.++++++|++++.|.|++|+.+++
T Consensus       117 ~~~~~~-~~~~~~v~~S~~ei~~e~v~DLL~~~--~~~l~i~~~~~~~~~i~~l~~~~v~s~~e~~~~l  182 (335)
T smart00129      117 KIDKLE-EGWQFQVKVSYLEIYNEKIRDLLNPS--PKKLEIREDKKGGVYVKGLTEISVSSFEEVYNLL  182 (335)
T ss_pred             Hhhhcc-cCceEEEEEEEEEEECCEEEECcCCC--CCCcEEEECCCCCEEecCCEEEEeCCHHHHHHHH
Confidence            987554 35589999999999999999999976  4579999999999999999999999999998764


No 23 
>KOG0240|consensus
Probab=100.00  E-value=3.3e-36  Score=247.61  Aligned_cols=138  Identities=44%  Similarity=0.746  Sum_probs=127.3

Q ss_pred             CeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCC---CCCcHHHHHHHH
Q psy12524          3 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQD---NKGIIPRLCDSL   79 (151)
Q Consensus         3 ~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~---~~Gli~~~~~~l   79 (151)
                      .++|.||+||       .++++|++||+.++.|+|++|+.|||+||||||+|+|||||||.|...   ..||+||++++|
T Consensus        48 ~~~y~FDrVF-------~pnatQe~Vy~~~a~~Iv~dVL~GYNGTvfaYGqT~sGKTytm~G~~~d~~~~GIipRi~~di  120 (607)
T KOG0240|consen   48 TKTYVFDRVF-------SPNATQEDVYEFAAKPIVDDVLLGYNGTVFAYGQTGSGKTYTMEGIGHDPEEMGIIPRILNDI  120 (607)
T ss_pred             cccceeeeec-------CCCccHHHHHHHHHHHHHHHHhcccceeEEEecCCCCCcceeecccCCChhhcCcHHHHHHHH
Confidence            3789999999       899999999999999999999999999999999999999999999765   569999999999


Q ss_pred             HHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         80 FDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        80 f~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      |..+... ..+..|.|+|||+|||+|+|+|||++.  +.+|++.+|...+++|+|+++..|.+++++++.+
T Consensus       121 F~~Iys~-~~n~efhVkVsy~EIYmEKi~DLL~~~--k~nlsvheDK~~v~~vkG~t~~~v~s~d~v~~~i  188 (607)
T KOG0240|consen  121 FDHIYSM-EENLEFHVKVSYFEIYMEKIRDLLDPE--KTNLSVHEDKNRVPYVKGVTERFVSSPDEVLDVI  188 (607)
T ss_pred             HHHHhcC-cccceEEEEEEeehhhhhHHHHHhCcc--cCCceeecccCCCceecCceeEEecCHHHHHHHH
Confidence            9999855 455799999999999999999999975  5589999999999999999999999999998653


No 24 
>KOG0239|consensus
Probab=100.00  E-value=3.1e-35  Score=251.40  Aligned_cols=137  Identities=39%  Similarity=0.644  Sum_probs=129.1

Q ss_pred             EEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc-CCCCCCcHHHHHHHHHHHH
Q psy12524          5 TFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG-SQDNKGIIPRLCDSLFDLI   83 (151)
Q Consensus         5 ~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G-~~~~~Gli~~~~~~lf~~~   83 (151)
                      .|.||+||       ++.++|++||..+ .|+|.++++|||.|+||||+|||||||||.| .+.++||+||+++.||..+
T Consensus       361 ~f~fdkVf-------~p~~sQ~~VF~e~-~~lv~S~lDGYnVCIFAYGQTGSGKTyTM~G~~~~~~Giipral~~lF~~~  432 (670)
T KOG0239|consen  361 SFKFDKVF-------GPLASQDDVFEEV-SPLVQSALDGYNVCIFAYGQTGSGKTYTMSGPTPEDPGIIPRALEKLFRTI  432 (670)
T ss_pred             cceeeeec-------CCcccHHHHHHHH-HHHHHHHhcCcceeEEEecccCCCccccccCCCcccCCccHHHHHHHHHHH
Confidence            59999999       8999999999988 8999999999999999999999999999999 6889999999999999999


Q ss_pred             HhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         84 AKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        84 ~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      ..... +|.|.+.+||+|||||.|+|||++.....++.|++++.++.+|.|++.+.|.+.+++..||
T Consensus       433 ~~~~~-g~~y~~~~s~~EIYNe~i~DlL~~~~~~~k~~I~~~~~~~~~V~~~t~~~V~s~~~v~~ll  498 (670)
T KOG0239|consen  433 TSLKS-GWKYDKTVSMLEIYNEAIRDLLSDESYVGKLEIVDDAEGNLMVPLLTVIKVGSSEEVDILL  498 (670)
T ss_pred             Hhhcc-CceEEeeeehhHHHHHHHHHhccccccccceeEEEcCCCceecccceEEecCCHHHHHHHH
Confidence            98876 9999999999999999999999876445689999999999999999999999999998765


No 25 
>KOG0246|consensus
Probab=99.97  E-value=1.1e-31  Score=220.98  Aligned_cols=137  Identities=36%  Similarity=0.528  Sum_probs=127.4

Q ss_pred             eEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCC------CCCcHHHHHH
Q psy12524          4 KTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQD------NKGIIPRLCD   77 (151)
Q Consensus         4 k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~------~~Gli~~~~~   77 (151)
                      .+|.||++|       ++.++++.||+.++.|+|+.+|+|--+|+||||+|||||||||.|+.+      ..||..++.+
T Consensus       258 ~~F~FDyaF-------De~~sNe~VYrfTa~PlV~~IF~~G~ATCFAYGQTGSGKT~TMggdfsgk~q~~s~giya~aa~  330 (676)
T KOG0246|consen  258 QKFRFDYAF-------DESASNELVYRFTAKPLVKTIFEGGMATCFAYGQTGSGKTYTMGGDFSGKAQDCSKGIYALAAR  330 (676)
T ss_pred             ceEEEeeec-------ccccchHHHHHHhhhHHHHHHHhCCceeeeeeccCCCCceeecccccCcccccccccchhhhhh
Confidence            579999999       889999999999999999999999999999999999999999999753      4799999999


Q ss_pred             HHHHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         78 SLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        78 ~lf~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      ++|..+....-.+..+.|.+||+|||+.++||||+.   +.+|.++||.+..+.|-||+|..|.+.+++++|.
T Consensus       331 Dvf~~L~~p~Y~~~~l~v~~tFFEIYgGKvfDLL~~---k~KLrvLEDg~QQVqVVGLqE~~v~~~eeVl~lI  400 (676)
T KOG0246|consen  331 DVFRLLRQPTYRKLDLKVYVTFFEIYGGKVYDLLND---KKKLRVLEDGNQQVQVVGLQEEEVSGVEEVLELI  400 (676)
T ss_pred             HHHHHhcccchhhcceEEEEEEEEEeCcchhhhhcc---ccceEEeecCCceEEEeeceeeeccCHHHHHHHH
Confidence            999999877667778999999999999999999994   5689999999999999999999999999998864


No 26 
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]
Probab=99.97  E-value=1.5e-30  Score=220.56  Aligned_cols=138  Identities=41%  Similarity=0.697  Sum_probs=128.9

Q ss_pred             CeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHHH
Q psy12524          3 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDL   82 (151)
Q Consensus         3 ~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~~   82 (151)
                      +.+|.||+||       ++.++|++||+..+.|+++.++.|+|||+||||+|||||||||.|...++||+|+++++||+.
T Consensus        55 ~~~~~fdkvf-------~~~~~q~~v~e~~~~~l~~~~l~g~N~TvfayGqTgsgKtyt~~G~~~~~Gii~~~l~~lf~~  127 (568)
T COG5059          55 EGTYAFDKVF-------GPSATQEDVYEETIKPLIDSLLLGYNCTVFAYGQTGSGKTYTMSGTEEEPGIIPLSLKELFSK  127 (568)
T ss_pred             ceEEEEeecc-------CCCCcHHHHHHHhhhhHHHHHHhcccceEEEEcccCCCceeEeecCccccchHHHHHHHHHHH
Confidence            5679999999       899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         83 IAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        83 ~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      ++.... +..+.+.+||+|||||+++|||.+...  .+.++++...++++.|+++..+.+.++++.+|
T Consensus       128 l~~~~~-~~~~~v~is~lEiYnEk~~DLl~~~~~--~~~~~~~~~~~v~v~~l~~~~~~s~ee~l~~l  192 (568)
T COG5059         128 LEDLSM-TKDFAVSISYLEIYNEKIYDLLSPNEE--SLNIREDSLLGVKVAGLTEKHVSSKEEILDLL  192 (568)
T ss_pred             HHhccc-CcceeeEeehhHHHhhHHHhhccCccc--cccccccCCCceEeecceEEecCChHHHHHHH
Confidence            987654 568999999999999999999997644  38899999999999999999999999998765


No 27 
>KOG0247|consensus
Probab=99.97  E-value=7.2e-31  Score=221.01  Aligned_cols=141  Identities=36%  Similarity=0.599  Sum_probs=124.9

Q ss_pred             CeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHHH
Q psy12524          3 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDL   82 (151)
Q Consensus         3 ~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~~   82 (151)
                      .+.|.|.+||       +++++|.+||+.++.|+|.+++.|.|..+|+||.|||||||||.|++..+||+||++.-||..
T Consensus        80 e~~fsFt~VF-------~p~~tQ~dvF~~~~~plV~dlLkgqn~LlFTyGVTgSGKTYTm~G~~~~~GIlPR~Ld~iF~s  152 (809)
T KOG0247|consen   80 EKKFSFTKVF-------GPSVTQADVFDTTVAPLVKDLLKGQNSLLFTYGVTGSGKTYTMTGTPDRPGILPRALDVIFNS  152 (809)
T ss_pred             eeEeeeeeec-------CCCccHHHHHHHHhHHHHHHHHcccceeEEEeeccCCCceEEeecCCCCCCchHHHHHHHHHH
Confidence            5789999999       999999999999999999999999999999999999999999999999999999999999966


Q ss_pred             HHhh---------------------------------------------------------c------CCCceEEEEEEE
Q psy12524         83 IAKQ---------------------------------------------------------E------SSELTYKVEVSY   99 (151)
Q Consensus        83 ~~~~---------------------------------------------------------~------~~~~~~~v~~S~   99 (151)
                      +...                                                         .      ..+..|.|+|||
T Consensus       153 iq~~~~~k~~~kp~~s~~~e~~~~~~alL~lkr~~~~nd~~~ts~~~~~~~~e~~e~~~~~e~~~~~l~~d~~ysV~VSf  232 (809)
T KOG0247|consen  153 IQGRQAKKPVFKPLRSNLFEIKAEEDALLQLKREAMLNDRKSTSKAHRQSTPEYAEHIHVIEQPALELDEDIVYSVFVSF  232 (809)
T ss_pred             hhceeccCceeccccchHHHHHHHHHHHHhhhhhhccccccCcchhhccccHHHHhhcchhcccccccCcCcEEEEEeeH
Confidence            6320                                                         0      134468999999


Q ss_pred             EEEECCeeeecCCCCCC---Cce-eeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524        100 MEIYNEKVHDLLDPKAN---KQS-LKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus       100 ~eiy~e~v~DLL~~~~~---~~~-l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      +|||||-|||||.+...   ++. ..+++|.++..||+|++||.|.|.+|+.+|+
T Consensus       233 ~EIYN~~iYDLLe~~s~q~~~~~~~ll~~d~~~~~~Vkgl~~V~VssseEA~~l~  287 (809)
T KOG0247|consen  233 VEIYNNYIYDLLEDASFQGKLQKLKLLREDTNGNMYVKGLTEVEVSSSEEALELF  287 (809)
T ss_pred             HHHHHHHHHHhhccccccchhhhhhhhhhccCCCeeeccccEEEeccHHHHHHHH
Confidence            99999999999986421   223 6789999999999999999999999999875


No 28 
>KOG0244|consensus
Probab=99.93  E-value=2e-26  Score=198.43  Aligned_cols=138  Identities=39%  Similarity=0.656  Sum_probs=124.4

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccC----CCCCCcHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGS----QDNKGIIPRLCD   77 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~----~~~~Gli~~~~~   77 (151)
                      ..++|+||+||       .....|.++|+.++.|+++.++.|+|++++|||+|||||||||.++    ....|++||+++
T Consensus        30 ~~~s~t~d~v~-------~~~~~Q~~~~e~~V~~l~~~lf~gynatvlaygQtgsgkTytmgt~~~~~~~~~Gvipr~v~  102 (913)
T KOG0244|consen   30 KDASFTYDKVF-------LDLESQKEVYESCVRPLREKLFAGYNATVLAYGQTGSGKTYTMGTNDAPAQDTVGVIPRAVS  102 (913)
T ss_pred             CCcceeeeeec-------cCchHHHHHHHHHHHHHHHHHhhhhcceeeeecccCCCceeecccccccccccCCcCcchHH
Confidence            35789999999       6677899999999999999999999999999999999999999887    234699999999


Q ss_pred             HHHHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcC
Q psy12524         78 SLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANP  149 (151)
Q Consensus        78 ~lf~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~l  149 (151)
                      .+|..+.....  ..|.|.+||+|+|++.|+|||.|.+.+..+++++ +.+++.+.|+++..|.+..++.+-
T Consensus       103 ~~f~~i~~~~~--~~f~i~vs~vely~e~v~dl~~~~~~~~~i~~~e-~~g~it~~glte~tv~~~~q~~~~  171 (913)
T KOG0244|consen  103 TLFTRIGKTES--FVFRITVSFVELYNEEVLDLLKPSRLKANIKLRE-PKGEITIRGLTEKTVRMKLQLLSR  171 (913)
T ss_pred             HHHHHHHhhhc--cceeeeeeeeeccchhhhhhcChhhhhhceeccc-cCCceEEEeehHHHHHHHHHHHHH
Confidence            99999987664  4789999999999999999999877777899999 888899999999999999887653


No 29 
>cd01363 Motor_domain Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.
Probab=99.58  E-value=1.7e-14  Score=107.05  Aligned_cols=57  Identities=56%  Similarity=1.056  Sum_probs=53.8

Q ss_pred             HHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHHHHHh
Q psy12524         28 VFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLIAK   85 (151)
Q Consensus        28 vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~~~~~   85 (151)
                      ||+.+. |+|+.+++|+|+||++||++||||||||+|+..++||+|++++++.+.++.
T Consensus         8 vf~~~~-~~v~~~~~G~n~~i~~yG~tGsGKT~Tm~G~~~~~Giip~~~~~~~~ll~~   64 (186)
T cd01363           8 VFRDVG-PLLQSALDGYNVCIFAYGQTGSGKTYTMEGKREGAGIIPRTVTDVIDLMDK   64 (186)
T ss_pred             HHHHHH-HHHHHHhCCcceeEEEECCCCCcceEecCCCCCCCCcchHHHHHHHHHHhh
Confidence            999998 999999999999999999999999999999999999999999988777654


No 30 
>PF00308 Bac_DnaA:  Bacterial dnaA  protein;  InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; PDB: 2KJQ_A 2Z4S_A 2Z4R_C 2HCB_B 3R8F_C 1L8Q_A 3SC3_B 3BOS_A.
Probab=96.07  E-value=0.0021  Score=48.78  Aligned_cols=50  Identities=30%  Similarity=0.507  Sum_probs=29.2

Q ss_pred             EEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524          5 TFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus         5 ~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      +||||.-.        ...+++..+..+ ..+.+.--..++ .++.||.+|+||||.+.+
T Consensus         4 ~~tFdnfv--------~g~~N~~a~~~~-~~ia~~~~~~~~-~l~l~G~~G~GKTHLL~A   53 (219)
T PF00308_consen    4 KYTFDNFV--------VGESNELAYAAA-KAIAENPGERYN-PLFLYGPSGLGKTHLLQA   53 (219)
T ss_dssp             T-SCCCS----------TTTTHHHHHHH-HHHHHSTTTSSS-EEEEEESTTSSHHHHHHH
T ss_pred             CCccccCC--------cCCcHHHHHHHH-HHHHhcCCCCCC-ceEEECCCCCCHHHHHHH
Confidence            46666654        334566777554 334433111233 478999999999998843


No 31 
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]
Probab=95.60  E-value=0.03  Score=47.87  Aligned_cols=82  Identities=21%  Similarity=0.286  Sum_probs=50.9

Q ss_pred             CCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc---CCCCCCcHH----HHHHHHHHHHHhhcCCCce
Q psy12524         20 PNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG---SQDNKGIIP----RLCDSLFDLIAKQESSELT   92 (151)
Q Consensus        20 ~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G---~~~~~Gli~----~~~~~lf~~~~~~~~~~~~   92 (151)
                      .|.-+|..    .+..|++.+-.|...- ...|.|||||||||-.   .-.-|.|+-    -.+.+||+.....- .+..
T Consensus        12 ~PaGDQP~----AI~~Lv~gi~~g~~~Q-tLLGvTGSGKTfT~AnVI~~~~rPtLV~AhNKTLAaQLy~Efk~fF-P~Na   85 (663)
T COG0556          12 KPAGDQPE----AIAELVEGIENGLKHQ-TLLGVTGSGKTFTMANVIAKVQRPTLVLAHNKTLAAQLYSEFKEFF-PENA   85 (663)
T ss_pred             CCCCCcHH----HHHHHHHHHhcCceee-EEeeeccCCchhHHHHHHHHhCCCeEEEecchhHHHHHHHHHHHhC-cCcc
Confidence            56666653    3466777777666543 4579999999999943   111222221    13456676666543 3335


Q ss_pred             EEEEEEEEEEECCee
Q psy12524         93 YKVEVSYMEIYNEKV  107 (151)
Q Consensus        93 ~~v~~S~~eiy~e~v  107 (151)
                      +.-.+||+..|+-..
T Consensus        86 VEYFVSYYDYYQPEA  100 (663)
T COG0556          86 VEYFVSYYDYYQPEA  100 (663)
T ss_pred             eEEEeeeccccCccc
Confidence            667789999997654


No 32 
>PRK06620 hypothetical protein; Validated
Probab=94.92  E-value=0.017  Score=43.75  Aligned_cols=50  Identities=18%  Similarity=0.276  Sum_probs=31.4

Q ss_pred             eEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCC---eeEEeeccCCCCCceeecc
Q psy12524          4 KTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYN---ACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus         4 k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~---~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..|+||.-.        ...++...|.... .+.+.  -|.+   -.++-||++|+||||.+..
T Consensus        11 ~~~tfd~Fv--------vg~~N~~a~~~~~-~~~~~--~~~~~~~~~l~l~Gp~G~GKThLl~a   63 (214)
T PRK06620         11 SKYHPDEFI--------VSSSNDQAYNIIK-NWQCG--FGVNPYKFTLLIKGPSSSGKTYLTKI   63 (214)
T ss_pred             CCCCchhhE--------ecccHHHHHHHHH-HHHHc--cccCCCcceEEEECCCCCCHHHHHHH
Confidence            346666555        3344666776653 33331  1232   3589999999999999964


No 33 
>PRK06893 DNA replication initiation factor; Validated
Probab=94.62  E-value=0.03  Score=42.66  Aligned_cols=23  Identities=22%  Similarity=0.336  Sum_probs=19.4

Q ss_pred             cCCCeeEEeeccCCCCCceeecc
Q psy12524         42 QGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ...+..++.||.+|+||||.+..
T Consensus        36 ~~~~~~l~l~G~~G~GKThL~~a   58 (229)
T PRK06893         36 DLQQPFFYIWGGKSSGKSHLLKA   58 (229)
T ss_pred             ccCCCeEEEECCCCCCHHHHHHH
Confidence            45677789999999999999954


No 34 
>PRK09087 hypothetical protein; Validated
Probab=94.31  E-value=0.032  Score=42.62  Aligned_cols=20  Identities=25%  Similarity=0.292  Sum_probs=17.0

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      +..++-||.+||||||.+..
T Consensus        44 ~~~l~l~G~~GsGKThLl~~   63 (226)
T PRK09087         44 SPVVVLAGPVGSGKTHLASI   63 (226)
T ss_pred             CCeEEEECCCCCCHHHHHHH
Confidence            44589999999999999954


No 35 
>PRK14086 dnaA chromosomal replication initiation protein; Provisional
Probab=93.49  E-value=0.04  Score=47.98  Aligned_cols=39  Identities=26%  Similarity=0.477  Sum_probs=25.1

Q ss_pred             CHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         24 SQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        24 ~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ++...|... ..+++..-..+|. ++.||.+|+||||.+..
T Consensus       295 sN~~A~aaa-~avae~~~~~~Np-L~LyG~sGsGKTHLL~A  333 (617)
T PRK14086        295 SNRFAHAAA-VAVAEAPAKAYNP-LFIYGESGLGKTHLLHA  333 (617)
T ss_pred             ccHHHHHHH-HHHHhCccccCCc-EEEECCCCCCHHHHHHH
Confidence            345555444 3444432234554 89999999999999854


No 36 
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=93.48  E-value=0.24  Score=40.58  Aligned_cols=37  Identities=27%  Similarity=0.352  Sum_probs=24.3

Q ss_pred             HHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         26 EKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        26 ~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ++-++....-+...+..+...+++.||.+|||||.++
T Consensus        23 e~ei~~l~~~l~~~~~~~~p~n~~iyG~~GTGKT~~~   59 (366)
T COG1474          23 EEEINQLASFLAPALRGERPSNIIIYGPTGTGKTATV   59 (366)
T ss_pred             HHHHHHHHHHHHHHhcCCCCccEEEECCCCCCHhHHH
Confidence            3344455433333333455666999999999999887


No 37 
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=93.14  E-value=0.05  Score=43.60  Aligned_cols=30  Identities=33%  Similarity=0.362  Sum_probs=27.2

Q ss_pred             hHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         33 GRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        33 ~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +.|++..+..--++.|++-|+|||||+.|+
T Consensus       113 lP~i~~~~~~~~~GLILVTGpTGSGKSTTl  142 (353)
T COG2805         113 LPPIVRELAESPRGLILVTGPTGSGKSTTL  142 (353)
T ss_pred             CCHHHHHHHhCCCceEEEeCCCCCcHHHHH
Confidence            467888888889999999999999999999


No 38 
>PRK08084 DNA replication initiation factor; Provisional
Probab=93.06  E-value=0.081  Score=40.47  Aligned_cols=19  Identities=21%  Similarity=0.553  Sum_probs=16.6

Q ss_pred             eeEEeeccCCCCCceeecc
Q psy12524         46 ACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..++.||++|+||||.+..
T Consensus        46 ~~l~l~Gp~G~GKThLl~a   64 (235)
T PRK08084         46 GYIYLWSREGAGRSHLLHA   64 (235)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            4789999999999999943


No 39 
>PRK12377 putative replication protein; Provisional
Probab=92.87  E-value=0.14  Score=39.74  Aligned_cols=40  Identities=20%  Similarity=0.324  Sum_probs=27.9

Q ss_pred             CCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         23 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..|..++..+ ..+++.+..+. ..++.+|.+|+||||.+..
T Consensus        81 ~~~~~a~~~a-~~~a~~~~~~~-~~l~l~G~~GtGKThLa~A  120 (248)
T PRK12377         81 DGQRYALSQA-KSIADELMTGC-TNFVFSGKPGTGKNHLAAA  120 (248)
T ss_pred             hhHHHHHHHH-HHHHHHHHhcC-CeEEEECCCCCCHHHHHHH
Confidence            3455566544 55666665543 4688999999999999944


No 40 
>PRK08181 transposase; Validated
Probab=92.70  E-value=0.087  Score=41.39  Aligned_cols=18  Identities=28%  Similarity=0.519  Sum_probs=16.1

Q ss_pred             eEEeeccCCCCCceeecc
Q psy12524         47 CIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~~G   64 (151)
                      .++.+|++|+||||.+.+
T Consensus       108 nlll~Gp~GtGKTHLa~A  125 (269)
T PRK08181        108 NLLLFGPPGGGKSHLAAA  125 (269)
T ss_pred             eEEEEecCCCcHHHHHHH
Confidence            489999999999999965


No 41 
>TIGR02928 orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.
Probab=92.69  E-value=0.1  Score=42.06  Aligned_cols=39  Identities=23%  Similarity=0.520  Sum_probs=26.8

Q ss_pred             CCHHHHHHHHhHHHHHHhhc-CCCeeEEeeccCCCCCceee
Q psy12524         23 ASQEKVFDALGRDILDNAFQ-GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~-G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...++-.+.... .+..++. +...+++.||++|+|||.++
T Consensus        18 ~gRe~e~~~l~~-~l~~~~~~~~~~~i~I~G~~GtGKT~l~   57 (365)
T TIGR02928        18 VHRDEQIEELAK-ALRPILRGSRPSNVFIYGKTGTGKTAVT   57 (365)
T ss_pred             CCcHHHHHHHHH-HHHHHHcCCCCCcEEEECCCCCCHHHHH
Confidence            455555555543 3444444 45567899999999999988


No 42 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=92.68  E-value=0.12  Score=42.19  Aligned_cols=39  Identities=26%  Similarity=0.451  Sum_probs=25.5

Q ss_pred             CCHHHHHHHHhHHHHHHhhc-CCCeeEEeeccCCCCCceee
Q psy12524         23 ASQEKVFDALGRDILDNAFQ-GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~-G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...++-.+.... .+...+. +...+++.||++|+|||.++
T Consensus        33 ~~Re~e~~~l~~-~l~~~~~~~~~~~~lI~G~~GtGKT~l~   72 (394)
T PRK00411         33 PHREEQIEELAF-ALRPALRGSRPLNVLIYGPPGTGKTTTV   72 (394)
T ss_pred             CCHHHHHHHHHH-HHHHHhCCCCCCeEEEECCCCCCHHHHH
Confidence            344555555433 3344443 45567899999999999988


No 43 
>PRK06526 transposase; Provisional
Probab=92.67  E-value=0.057  Score=42.03  Aligned_cols=49  Identities=14%  Similarity=0.212  Sum_probs=28.4

Q ss_pred             EeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         11 CFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        11 vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      .|.+||....+..++..+..-.....++   .+  ..++.+|++|+||||.+.+
T Consensus        69 ~le~fd~~~~~~~~~~~~~~l~~~~fi~---~~--~nlll~Gp~GtGKThLa~a  117 (254)
T PRK06526         69 SLEEFDFDHQRSLKRDTIAHLGTLDFVT---GK--ENVVFLGPPGTGKTHLAIG  117 (254)
T ss_pred             ChhhccCccCCCcchHHHHHHhcCchhh---cC--ceEEEEeCCCCchHHHHHH
Confidence            3444444434444554444433233332   23  3579999999999999864


No 44 
>PRK05642 DNA replication initiation factor; Validated
Probab=92.42  E-value=0.089  Score=40.24  Aligned_cols=19  Identities=26%  Similarity=0.625  Sum_probs=16.3

Q ss_pred             eeEEeeccCCCCCceeecc
Q psy12524         46 ACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..++.||.+|+||||.+..
T Consensus        46 ~~l~l~G~~G~GKTHLl~a   64 (234)
T PRK05642         46 SLIYLWGKDGVGRSHLLQA   64 (234)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            4678999999999999854


No 45 
>TIGR00362 DnaA chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006).
Probab=92.41  E-value=0.1  Score=43.03  Aligned_cols=40  Identities=23%  Similarity=0.297  Sum_probs=23.7

Q ss_pred             CCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         23 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      .++...|... ..+.+.- .+....++.||.+|+||||.+..
T Consensus       116 ~~n~~a~~~~-~~~~~~~-~~~~n~l~l~G~~G~GKThL~~a  155 (405)
T TIGR00362       116 KSNRLAHAAA-LAVAENP-GKAYNPLFIYGGVGLGKTHLLHA  155 (405)
T ss_pred             CcHHHHHHHH-HHHHhCc-CccCCeEEEECCCCCcHHHHHHH
Confidence            3455555444 3333321 11122478999999999999843


No 46 
>PRK08116 hypothetical protein; Validated
Probab=92.33  E-value=0.12  Score=40.42  Aligned_cols=42  Identities=21%  Similarity=0.354  Sum_probs=28.1

Q ss_pred             CCCHHHHHHHHhHHHHHHhhc--CCCeeEEeeccCCCCCceeecc
Q psy12524         22 FASQEKVFDALGRDILDNAFQ--GYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        22 ~~~q~~vy~~~~~~lv~~~~~--G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      +..+...+..+ ...++.+..  ..+..++.||.+|+||||.+..
T Consensus        90 ~~~~~~a~~~a-~~y~~~~~~~~~~~~gl~l~G~~GtGKThLa~a  133 (268)
T PRK08116         90 DKGSEKAYKIA-RKYVKKFEEMKKENVGLLLWGSVGTGKTYLAAC  133 (268)
T ss_pred             ChHHHHHHHHH-HHHHHHHHhhccCCceEEEECCCCCCHHHHHHH
Confidence            34455566544 556666543  2344689999999999999843


No 47 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=92.33  E-value=0.12  Score=34.79  Aligned_cols=25  Identities=20%  Similarity=0.286  Sum_probs=18.2

Q ss_pred             HHhhcCCCeeEEeeccCCCCCceee
Q psy12524         38 DNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        38 ~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+.......++.+|.+|+|||+.+
T Consensus        12 ~~~~~~~~~~v~i~G~~G~GKT~l~   36 (151)
T cd00009          12 EALELPPPKNLLLYGPPGTGKTTLA   36 (151)
T ss_pred             HHHhCCCCCeEEEECCCCCCHHHHH
Confidence            3333334456889999999999877


No 48 
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]
Probab=92.12  E-value=0.11  Score=43.28  Aligned_cols=66  Identities=18%  Similarity=0.263  Sum_probs=36.8

Q ss_pred             EEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccC-------CCCCCcHHHHHH
Q psy12524          5 TFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGS-------QDNKGIIPRLCD   77 (151)
Q Consensus         5 ~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~-------~~~~Gli~~~~~   77 (151)
                      .|+||.-.        ...++...|....  -+...-.+..--++.||.+|+||||.|...       ..+..+++...+
T Consensus        83 ~ytFdnFv--------~g~~N~~A~aa~~--~va~~~g~~~nplfi~G~~GlGKTHLl~Aign~~~~~~~~a~v~y~~se  152 (408)
T COG0593          83 KYTFDNFV--------VGPSNRLAYAAAK--AVAENPGGAYNPLFIYGGVGLGKTHLLQAIGNEALANGPNARVVYLTSE  152 (408)
T ss_pred             CCchhhee--------eCCchHHHHHHHH--HHHhccCCcCCcEEEECCCCCCHHHHHHHHHHHHHhhCCCceEEeccHH
Confidence            45665544        4455555554442  222222222335899999999999999542       233455555555


Q ss_pred             HHH
Q psy12524         78 SLF   80 (151)
Q Consensus        78 ~lf   80 (151)
                      ..+
T Consensus       153 ~f~  155 (408)
T COG0593         153 DFT  155 (408)
T ss_pred             HHH
Confidence            443


No 49 
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=92.07  E-value=0.1  Score=43.66  Aligned_cols=39  Identities=28%  Similarity=0.431  Sum_probs=23.7

Q ss_pred             CHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         24 SQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        24 ~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ++...|..+ ..+.+.--..++ .++.||.+|+||||.+..
T Consensus       129 ~n~~a~~~~-~~~~~~~~~~~~-~l~l~G~~G~GKThL~~a  167 (450)
T PRK00149        129 SNRLAHAAA-LAVAENPGKAYN-PLFIYGGVGLGKTHLLHA  167 (450)
T ss_pred             CcHHHHHHH-HHHHhCcCccCC-eEEEECCCCCCHHHHHHH
Confidence            455555544 333332111233 488999999999999843


No 50 
>PRK14088 dnaA chromosomal replication initiation protein; Provisional
Probab=91.59  E-value=0.13  Score=43.16  Aligned_cols=38  Identities=29%  Similarity=0.539  Sum_probs=24.7

Q ss_pred             CCHHHHHHHHhHHHHHHhhcC-CCeeEEeeccCCCCCceeecc
Q psy12524         23 ASQEKVFDALGRDILDNAFQG-YNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~G-~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      .++...|..+. .+.+.  .| +| .++.||.+|+||||.+..
T Consensus       111 ~~n~~a~~~~~-~~~~~--~~~~n-~l~lyG~~G~GKTHLl~a  149 (440)
T PRK14088        111 PGNSFAYHAAL-EVAKN--PGRYN-PLFIYGGVGLGKTHLLQS  149 (440)
T ss_pred             CchHHHHHHHH-HHHhC--cCCCC-eEEEEcCCCCcHHHHHHH
Confidence            44555665543 23322  23 45 499999999999999953


No 51 
>PRK07952 DNA replication protein DnaC; Validated
Probab=91.34  E-value=0.21  Score=38.71  Aligned_cols=39  Identities=18%  Similarity=0.241  Sum_probs=25.6

Q ss_pred             CHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         24 SQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        24 ~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      .|..++..+ ...++....+. ..++.+|.+|+||||.+..
T Consensus        80 ~q~~al~~a-~~~~~~~~~~~-~~~~l~G~~GtGKThLa~a  118 (244)
T PRK07952         80 GQMNALSKA-RQYVEEFDGNI-ASFIFSGKPGTGKNHLAAA  118 (244)
T ss_pred             hHHHHHHHH-HHHHHhhccCC-ceEEEECCCCCCHHHHHHH
Confidence            445565554 34455543332 3688999999999999943


No 52 
>PF13245 AAA_19:  Part of AAA domain
Probab=91.16  E-value=0.11  Score=32.83  Aligned_cols=24  Identities=25%  Similarity=0.400  Sum_probs=17.0

Q ss_pred             HHhhcCCCeeEEeeccCCCCCceee
Q psy12524         38 DNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        38 ~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+. .+..++.-|..|||||+++
T Consensus         4 ~~al~-~~~~~vv~g~pGtGKT~~~   27 (76)
T PF13245_consen    4 RRALA-GSPLFVVQGPPGTGKTTTL   27 (76)
T ss_pred             HHHHh-hCCeEEEECCCCCCHHHHH
Confidence            33444 3344556899999999988


No 53 
>PRK06835 DNA replication protein DnaC; Validated
Probab=90.86  E-value=0.3  Score=39.46  Aligned_cols=30  Identities=23%  Similarity=0.499  Sum_probs=22.7

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ...++.+-... ..++.||.+|+||||.+.+
T Consensus       173 ~~f~~~f~~~~-~~Lll~G~~GtGKThLa~a  202 (329)
T PRK06835        173 KNFIENFDKNN-ENLLFYGNTGTGKTFLSNC  202 (329)
T ss_pred             HHHHHHHhccC-CcEEEECCCCCcHHHHHHH
Confidence            45666655433 5699999999999999844


No 54 
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=90.22  E-value=0.24  Score=37.27  Aligned_cols=20  Identities=25%  Similarity=0.585  Sum_probs=16.9

Q ss_pred             CCeeEEeeccCCCCCceeec
Q psy12524         44 YNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~~   63 (151)
                      ....++.+|.+|+||||.+.
T Consensus        41 ~~~~~~l~G~~G~GKT~La~   60 (227)
T PRK08903         41 ADRFFYLWGEAGSGRSHLLQ   60 (227)
T ss_pred             CCCeEEEECCCCCCHHHHHH
Confidence            34578999999999999883


No 55 
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=90.12  E-value=0.19  Score=42.71  Aligned_cols=30  Identities=30%  Similarity=0.352  Sum_probs=25.1

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..+..++..-.+.++.-|+||||||.||+.
T Consensus       248 ~~~~~~~~~p~GliLvTGPTGSGKTTTLY~  277 (500)
T COG2804         248 ARLLRLLNRPQGLILVTGPTGSGKTTTLYA  277 (500)
T ss_pred             HHHHHHHhCCCeEEEEeCCCCCCHHHHHHH
Confidence            445667778889999999999999999953


No 56 
>PF04851 ResIII:  Type III restriction enzyme, res subunit;  InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3.1.21.3 from EC), the Res subunit of type III endonucleases (3.1.21.5 from EC), and the B subunit of excinuclease ABC (uvrB) [, , ].; GO: 0003677 DNA binding, 0005524 ATP binding, 0016787 hydrolase activity; PDB: 2Y3T_B 2W74_B 2FWR_A 2FZ4_A 3UWX_B 3H1T_A 3B6E_A 2FDC_A 1D9Z_A 1T5L_B ....
Probab=90.02  E-value=0.24  Score=35.15  Aligned_cols=31  Identities=19%  Similarity=0.277  Sum_probs=20.9

Q ss_pred             HHHHHHhhcC-CCeeEEeeccCCCCCceeecc
Q psy12524         34 RDILDNAFQG-YNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        34 ~~lv~~~~~G-~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..+++.+-.. ....++..++||||||.++..
T Consensus        13 ~~i~~~~~~~~~~~~~ll~~~tGsGKT~~~~~   44 (184)
T PF04851_consen   13 ARIINSLENKKEERRVLLNAPTGSGKTIIALA   44 (184)
T ss_dssp             HHHHHHHHTTSGCSEEEEEESTTSSHHHHHHH
T ss_pred             HHHHHHHHhcCCCCCEEEEECCCCCcChhhhh
Confidence            3344443333 355677888999999999964


No 57 
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=89.90  E-value=0.44  Score=37.09  Aligned_cols=26  Identities=31%  Similarity=0.557  Sum_probs=20.9

Q ss_pred             HHhhcCCCe-eEEeeccCCCCCceeec
Q psy12524         38 DNAFQGYNA-CIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        38 ~~~~~G~~~-~v~~yG~~~sGKt~t~~   63 (151)
                      ..+++|..+ .++.||..|||||.++.
T Consensus        44 ~~Fl~G~pannvLL~G~rGtGKSSlVk   70 (249)
T PF05673_consen   44 EQFLQGLPANNVLLWGARGTGKSSLVK   70 (249)
T ss_pred             HHHHcCCCCcceEEecCCCCCHHHHHH
Confidence            457777765 47889999999998884


No 58 
>PF05970 PIF1:  PIF1-like helicase;  InterPro: IPR010285  This entry represents PIF1 helicase and related proteins. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated [, ]. 
Probab=89.35  E-value=0.28  Score=40.00  Aligned_cols=37  Identities=30%  Similarity=0.464  Sum_probs=28.3

Q ss_pred             CCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         22 FASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        22 ~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +..|+.+|+.++..+.    ......+|.-|..|||||+.+
T Consensus         3 n~eQ~~~~~~v~~~~~----~~~~~~~fv~G~~GtGKs~l~   39 (364)
T PF05970_consen    3 NEEQRRVFDTVIEAIE----NEEGLNFFVTGPAGTGKSFLI   39 (364)
T ss_pred             CHHHHHHHHHHHHHHH----ccCCcEEEEEcCCCCChhHHH
Confidence            3578999988865443    244556788999999999997


No 59 
>KOG0989|consensus
Probab=89.33  E-value=0.34  Score=39.02  Aligned_cols=37  Identities=27%  Similarity=0.319  Sum_probs=24.2

Q ss_pred             HHHHHHHhHHHHHHhh-cCCCeeEEeeccCCCCCceee
Q psy12524         26 EKVFDALGRDILDNAF-QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        26 ~~vy~~~~~~lv~~~~-~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +.+++..+-..+...+ .+.-...+-||+.|||||.|.
T Consensus        37 e~~gQe~vV~~L~~a~~~~~lp~~LFyGPpGTGKTSta   74 (346)
T KOG0989|consen   37 ELAGQEHVVQVLKNALLRRILPHYLFYGPPGTGKTSTA   74 (346)
T ss_pred             hhcchHHHHHHHHHHHhhcCCceEEeeCCCCCcHhHHH
Confidence            4444444444444444 445556788999999999998


No 60 
>PRK06921 hypothetical protein; Provisional
Probab=89.30  E-value=0.3  Score=38.20  Aligned_cols=31  Identities=23%  Similarity=0.305  Sum_probs=21.6

Q ss_pred             HHHHHHhhc---CCCeeEEeeccCCCCCceeecc
Q psy12524         34 RDILDNAFQ---GYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        34 ~~lv~~~~~---G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ...++.+-.   +....++.+|.+|+||||.+..
T Consensus       103 ~~~~~~f~~~~~~~~~~l~l~G~~G~GKThLa~a  136 (266)
T PRK06921        103 VEYVKDFEKIQESRKNSIALLGQPGSGKTHLLTA  136 (266)
T ss_pred             HHHHHHHHHhcccCCCeEEEECCCCCcHHHHHHH
Confidence            345554432   2345689999999999999954


No 61 
>PRK14087 dnaA chromosomal replication initiation protein; Provisional
Probab=89.19  E-value=0.27  Score=41.43  Aligned_cols=40  Identities=33%  Similarity=0.559  Sum_probs=24.1

Q ss_pred             CCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         23 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      .+++..|..+ ..+.+.--..+| .++.||.+|+||||.+..
T Consensus       121 ~~n~~A~~aa-~~~a~~~~~~~n-pl~i~G~~G~GKTHLl~A  160 (450)
T PRK14087        121 SSNEQAFIAV-QTVSKNPGISYN-PLFIYGESGMGKTHLLKA  160 (450)
T ss_pred             CcHHHHHHHH-HHHHhCcCcccC-ceEEECCCCCcHHHHHHH
Confidence            3455566443 334322111123 488999999999999954


No 62 
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=89.10  E-value=0.36  Score=40.58  Aligned_cols=39  Identities=26%  Similarity=0.462  Sum_probs=23.9

Q ss_pred             CCHHHHHHHHhHHHHHHh--hcC--CCeeEEeeccCCCCCceeec
Q psy12524         23 ASQEKVFDALGRDILDNA--FQG--YNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~--~~G--~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .+++..|..+ ..+.+..  ..|  +| -++.||.+|+||||.+.
T Consensus       117 ~~N~~a~~~a-~~~a~~~~~~~~~~~n-pl~L~G~~G~GKTHLl~  159 (445)
T PRK12422        117 PENDLPHRIL-QEFTKVSEQGKGFPFN-PIYLFGPEGSGKTHLMQ  159 (445)
T ss_pred             CcHHHHHHHH-HHHHhccccccCCCCc-eEEEEcCCCCCHHHHHH
Confidence            4555555443 3443322  123  23 47889999999999984


No 63 
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=89.08  E-value=0.41  Score=37.22  Aligned_cols=40  Identities=15%  Similarity=0.229  Sum_probs=27.2

Q ss_pred             CCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         22 FASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        22 ~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ...+...+... ..+++.+-  ....++.||++|+||||...+
T Consensus        85 ~~~~~~~l~~~-~~~~~~~~--~~~nl~l~G~~G~GKThLa~A  124 (254)
T COG1484          85 PGIDKKALEDL-ASLVEFFE--RGENLVLLGPPGVGKTHLAIA  124 (254)
T ss_pred             cchhHHHHHHH-HHHHHHhc--cCCcEEEECCCCCcHHHHHHH
Confidence            33566666655 34555544  444578999999999999843


No 64 
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=88.99  E-value=0.36  Score=36.05  Aligned_cols=22  Identities=27%  Similarity=0.522  Sum_probs=18.6

Q ss_pred             cCCCeeEEeeccCCCCCceeec
Q psy12524         42 QGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      ......++.||.+|+|||+.+.
T Consensus        35 ~~~~~~lll~G~~G~GKT~la~   56 (226)
T TIGR03420        35 GKGDRFLYLWGESGSGKSHLLQ   56 (226)
T ss_pred             cCCCCeEEEECCCCCCHHHHHH
Confidence            4556689999999999999883


No 65 
>PRK08939 primosomal protein DnaI; Reviewed
Probab=88.79  E-value=0.26  Score=39.44  Aligned_cols=40  Identities=28%  Similarity=0.419  Sum_probs=27.3

Q ss_pred             CHHHHHHHHhHHHHHHhhcC-CCeeEEeeccCCCCCceeecc
Q psy12524         24 SQEKVFDALGRDILDNAFQG-YNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        24 ~q~~vy~~~~~~lv~~~~~G-~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ++..++..+ ...++....| ....++.||.+|+||||.+.+
T Consensus       135 ~~~~~~~~~-~~fi~~~~~~~~~~gl~L~G~~G~GKThLa~A  175 (306)
T PRK08939        135 DRLDALMAA-LDFLEAYPPGEKVKGLYLYGDFGVGKSYLLAA  175 (306)
T ss_pred             HHHHHHHHH-HHHHHHhhccCCCCeEEEECCCCCCHHHHHHH
Confidence            455566543 5566655433 334689999999999999954


No 66 
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=88.62  E-value=0.35  Score=35.52  Aligned_cols=20  Identities=25%  Similarity=0.516  Sum_probs=15.9

Q ss_pred             CCeeEEeeccCCCCCceeec
Q psy12524         44 YNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~~   63 (151)
                      ..-.++.+|.+|+||||...
T Consensus        46 ~~~~l~l~G~~G~GKThLa~   65 (178)
T PF01695_consen   46 NGENLILYGPPGTGKTHLAV   65 (178)
T ss_dssp             C--EEEEEESTTSSHHHHHH
T ss_pred             cCeEEEEEhhHhHHHHHHHH
Confidence            34568999999999999984


No 67 
>PRK08727 hypothetical protein; Validated
Probab=88.12  E-value=0.4  Score=36.57  Aligned_cols=19  Identities=21%  Similarity=0.509  Sum_probs=16.4

Q ss_pred             eeEEeeccCCCCCceeecc
Q psy12524         46 ACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..++.||.+|+||||.+..
T Consensus        42 ~~l~l~G~~G~GKThL~~a   60 (233)
T PRK08727         42 DWLYLSGPAGTGKTHLALA   60 (233)
T ss_pred             CeEEEECCCCCCHHHHHHH
Confidence            4589999999999999854


No 68 
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=87.52  E-value=0.29  Score=36.11  Aligned_cols=29  Identities=28%  Similarity=0.415  Sum_probs=20.4

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceeec
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .+.+.+..|.+..++.||+.|+|||..+.
T Consensus        10 ~l~~~l~~~~~~~~~l~G~rg~GKTsLl~   38 (234)
T PF01637_consen   10 KLKELLESGPSQHILLYGPRGSGKTSLLK   38 (234)
T ss_dssp             HHHHCHHH--SSEEEEEESTTSSHHHHHH
T ss_pred             HHHHHHHhhcCcEEEEEcCCcCCHHHHHH
Confidence            33333344667889999999999999883


No 69 
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=87.41  E-value=0.6  Score=35.78  Aligned_cols=47  Identities=15%  Similarity=0.306  Sum_probs=27.3

Q ss_pred             CCCCCCCCHHHHHHHHhH----HHHHHhhcCCCeeEEeeccCCCCCceeec
Q psy12524         17 PNLPNFASQEKVFDALGR----DILDNAFQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        17 ~~~~~~~~q~~vy~~~~~----~lv~~~~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .+|........+|.....    ..++..+......++.+|.+|+|||..+.
T Consensus        11 ~pF~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~G~~G~GKTtl~~   61 (269)
T TIGR03015        11 KPFQLLPDPDFFYPSKGHKRAMAYLEYGLSQREGFILITGEVGAGKTTLIR   61 (269)
T ss_pred             CCCCCCCCHHHhCCCHHHHHHHHHHHHHHhcCCCEEEEEcCCCCCHHHHHH
Confidence            344555555555543331    12222333335568889999999998873


No 70 
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=87.13  E-value=0.19  Score=34.08  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=13.1

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+++.+|.+|+|||.++
T Consensus         4 ~~~~~i~G~~G~GKT~~~   21 (131)
T PF13401_consen    4 QRILVISGPPGSGKTTLI   21 (131)
T ss_dssp             ---EEEEE-TTSSHHHHH
T ss_pred             CcccEEEcCCCCCHHHHH
Confidence            346889999999999988


No 71 
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=86.63  E-value=0.26  Score=32.72  Aligned_cols=18  Identities=33%  Similarity=0.466  Sum_probs=15.4

Q ss_pred             eeEEeeccCCCCCceeec
Q psy12524         46 ACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~   63 (151)
                      ..++.+|.+|||||.++.
T Consensus         3 ~~~~l~G~~G~GKTtl~~   20 (148)
T smart00382        3 EVILIVGPPGSGKTTLAR   20 (148)
T ss_pred             CEEEEECCCCCcHHHHHH
Confidence            357889999999999883


No 72 
>PF00437 T2SE:  Type II/IV secretion system protein;  InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]. These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....
Probab=86.30  E-value=0.38  Score=37.23  Aligned_cols=18  Identities=39%  Similarity=0.573  Sum_probs=16.2

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.++..|.+|||||.+|
T Consensus       127 ~~~ili~G~tGSGKTT~l  144 (270)
T PF00437_consen  127 RGNILISGPTGSGKTTLL  144 (270)
T ss_dssp             TEEEEEEESTTSSHHHHH
T ss_pred             ceEEEEECCCccccchHH
Confidence            667889999999999988


No 73 
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=86.18  E-value=0.25  Score=33.25  Aligned_cols=39  Identities=21%  Similarity=0.242  Sum_probs=26.8

Q ss_pred             EEeeccCCCCCceeecc------C-----------CCCCCcHHHHHHHHHHHHHhh
Q psy12524         48 IFAYGQTGSGKSYTMMG------S-----------QDNKGIIPRLCDSLFDLIAKQ   86 (151)
Q Consensus        48 v~~yG~~~sGKt~t~~G------~-----------~~~~Gli~~~~~~lf~~~~~~   86 (151)
                      |+.+|+.|+|||..+.-      .           ....+-....+..+|......
T Consensus         1 ill~G~~G~GKT~l~~~la~~l~~~~~~i~~~~~~~~~~~~~~~~i~~~~~~~~~~   56 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLARALAQYLGFPFIEIDGSELISSYAGDSEQKIRDFFKKAKKS   56 (132)
T ss_dssp             EEEESSTTSSHHHHHHHHHHHTTSEEEEEETTHHHTSSTTHHHHHHHHHHHHHHHT
T ss_pred             CEEECcCCCCeeHHHHHHHhhccccccccccccccccccccccccccccccccccc
Confidence            57899999999988722      1           123456677777888776533


No 74 
>PF13604 AAA_30:  AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A.
Probab=85.95  E-value=0.46  Score=35.29  Aligned_cols=27  Identities=15%  Similarity=0.261  Sum_probs=19.3

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+..++...+...+..|..|||||+++
T Consensus         9 a~~~~l~~~~~~~~l~G~aGtGKT~~l   35 (196)
T PF13604_consen    9 AVRAILTSGDRVSVLQGPAGTGKTTLL   35 (196)
T ss_dssp             HHHHHHHCTCSEEEEEESTTSTHHHHH
T ss_pred             HHHHHHhcCCeEEEEEECCCCCHHHHH
Confidence            344555544445667899999999988


No 75 
>PRK10436 hypothetical protein; Provisional
Probab=85.80  E-value=0.43  Score=40.36  Aligned_cols=28  Identities=36%  Similarity=0.482  Sum_probs=22.5

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceeec
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .+..++..-++.++..|+||||||.|+.
T Consensus       209 ~l~~~~~~~~GliLvtGpTGSGKTTtL~  236 (462)
T PRK10436        209 QFRQALQQPQGLILVTGPTGSGKTVTLY  236 (462)
T ss_pred             HHHHHHHhcCCeEEEECCCCCChHHHHH
Confidence            3445556678889999999999999993


No 76 
>TIGR01420 pilT_fam pilus retraction protein PilT. This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation.
Probab=85.70  E-value=0.46  Score=38.43  Aligned_cols=28  Identities=36%  Similarity=0.450  Sum_probs=21.7

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +.+..++......++..|++|||||.+|
T Consensus       112 ~~l~~~~~~~~g~ili~G~tGSGKTT~l  139 (343)
T TIGR01420       112 PVLRELAERPRGLILVTGPTGSGKSTTL  139 (343)
T ss_pred             HHHHHHHhhcCcEEEEECCCCCCHHHHH
Confidence            4455555444678899999999999999


No 77 
>TIGR02533 type_II_gspE general secretory pathway protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis.
Probab=85.70  E-value=0.47  Score=40.40  Aligned_cols=28  Identities=29%  Similarity=0.439  Sum_probs=22.3

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceeec
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .+..++..-.+.++..|+||||||.|+.
T Consensus       233 ~l~~~~~~~~GlilitGptGSGKTTtL~  260 (486)
T TIGR02533       233 RFERLIRRPHGIILVTGPTGSGKTTTLY  260 (486)
T ss_pred             HHHHHHhcCCCEEEEEcCCCCCHHHHHH
Confidence            4455566667788999999999999993


No 78 
>PHA00729 NTP-binding motif containing protein
Probab=85.69  E-value=0.77  Score=35.22  Aligned_cols=30  Identities=20%  Similarity=0.315  Sum_probs=22.7

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceeec
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      ...++.+..+--..++.+|.+|+|||+...
T Consensus         6 k~~~~~l~~~~f~nIlItG~pGvGKT~LA~   35 (226)
T PHA00729          6 KKIVSAYNNNGFVSAVIFGKQGSGKTTYAL   35 (226)
T ss_pred             HHHHHHHhcCCeEEEEEECCCCCCHHHHHH
Confidence            445566655555689999999999999873


No 79 
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=85.67  E-value=0.69  Score=36.60  Aligned_cols=21  Identities=24%  Similarity=0.366  Sum_probs=16.6

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+....++.+|++|+|||+++
T Consensus        33 ~~~~~~lll~Gp~GtGKT~la   53 (337)
T PRK12402         33 SPNLPHLLVQGPPGSGKTAAV   53 (337)
T ss_pred             CCCCceEEEECCCCCCHHHHH
Confidence            344345889999999999887


No 80 
>PRK09183 transposase/IS protein; Provisional
Probab=85.65  E-value=0.37  Score=37.52  Aligned_cols=18  Identities=28%  Similarity=0.458  Sum_probs=15.3

Q ss_pred             eEEeeccCCCCCceeecc
Q psy12524         47 CIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~~G   64 (151)
                      .++.+|++|+||||.+..
T Consensus       104 ~v~l~Gp~GtGKThLa~a  121 (259)
T PRK09183        104 NIVLLGPSGVGKTHLAIA  121 (259)
T ss_pred             eEEEEeCCCCCHHHHHHH
Confidence            467899999999999843


No 81 
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB. This model describes a protein of type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly and is closely related to GspE (TIGR02533) of type II secretion, also called the main terminal branch of the general secretion pathway. Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.
Probab=85.61  E-value=0.44  Score=41.27  Aligned_cols=27  Identities=26%  Similarity=0.469  Sum_probs=22.3

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+..++..-++.++..|.||||||.||
T Consensus       307 ~l~~~~~~~~Glilv~G~tGSGKTTtl  333 (564)
T TIGR02538       307 LFLEAIHKPQGMVLVTGPTGSGKTVSL  333 (564)
T ss_pred             HHHHHHHhcCCeEEEECCCCCCHHHHH
Confidence            345566667788999999999999998


No 82 
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=85.45  E-value=0.2  Score=35.85  Aligned_cols=22  Identities=27%  Similarity=0.459  Sum_probs=13.2

Q ss_pred             hcCCCeeEEeeccCCCCCceee
Q psy12524         41 FQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        41 ~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...+++..|..|+|||..+
T Consensus        20 ~~~~~~~~ll~G~~G~GKT~ll   41 (185)
T PF13191_consen   20 QSGSPRNLLLTGESGSGKTSLL   41 (185)
T ss_dssp             SS-----EEE-B-TTSSHHHHH
T ss_pred             HcCCCcEEEEECCCCCCHHHHH
Confidence            3566778999999999999987


No 83 
>cd00046 DEXDc DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
Probab=85.44  E-value=0.32  Score=32.28  Aligned_cols=17  Identities=29%  Similarity=0.450  Sum_probs=14.5

Q ss_pred             EEeeccCCCCCceeecc
Q psy12524         48 IFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        48 v~~yG~~~sGKt~t~~G   64 (151)
                      ++.+|.+|+|||.++..
T Consensus         3 ~~i~~~~G~GKT~~~~~   19 (144)
T cd00046           3 VLLAAPTGSGKTLAALL   19 (144)
T ss_pred             EEEECCCCCchhHHHHH
Confidence            57889999999998854


No 84 
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=85.24  E-value=0.37  Score=35.51  Aligned_cols=25  Identities=24%  Similarity=0.477  Sum_probs=15.9

Q ss_pred             HHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         37 LDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        37 v~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      |..++.... ..+..|+.|||||+++
T Consensus        10 i~~~~~~~~-~~~i~GpPGTGKT~~l   34 (236)
T PF13086_consen   10 IQSALSSNG-ITLIQGPPGTGKTTTL   34 (236)
T ss_dssp             HHHHCTSSE--EEEE-STTSSHHHHH
T ss_pred             HHHHHcCCC-CEEEECCCCCChHHHH
Confidence            344443333 4667899999999887


No 85 
>PF07693 KAP_NTPase:  KAP family P-loop domain;  InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side [].
Probab=84.86  E-value=0.75  Score=36.25  Aligned_cols=32  Identities=31%  Similarity=0.283  Sum_probs=22.0

Q ss_pred             HHhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         31 ALGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        31 ~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+..++...-..-+.++..+|..|||||+.+
T Consensus         6 ~~la~~I~~~~~~~~~~IgL~G~WGsGKSs~l   37 (325)
T PF07693_consen    6 KALAEIIKNPDSDDPFVIGLYGEWGSGKSSFL   37 (325)
T ss_pred             HHHHHHHhccCCCCCeEEEEECCCCCCHHHHH
Confidence            33334443322256778899999999999988


No 86 
>PF01935 DUF87:  Domain of unknown function DUF87;  InterPro: IPR002789 The function of this domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=84.78  E-value=0.34  Score=36.49  Aligned_cols=15  Identities=60%  Similarity=0.857  Sum_probs=13.2

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      +..+|.||||||+++
T Consensus        26 ~~I~G~TGsGKS~~~   40 (229)
T PF01935_consen   26 IAIFGTTGSGKSNTV   40 (229)
T ss_pred             EEEECCCCCCHHHHH
Confidence            457899999999999


No 87 
>KOG1514|consensus
Probab=84.24  E-value=2.8  Score=37.36  Aligned_cols=29  Identities=34%  Similarity=0.753  Sum_probs=22.0

Q ss_pred             HHHHHhh--cCCCeeEEeeccCCCCCceeec
Q psy12524         35 DILDNAF--QGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        35 ~lv~~~~--~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      ..+..++  +|-.+|+..-|..|||||+|+.
T Consensus       410 ~f~~~~i~~~~~g~~mYIsGvPGtGKT~tV~  440 (767)
T KOG1514|consen  410 DFLRSFISDQGLGSCMYISGVPGTGKTATVL  440 (767)
T ss_pred             HHHHhhcCCCCCceeEEEecCCCCCceehHH
Confidence            3444544  3666688899999999999993


No 88 
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB. Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.
Probab=83.94  E-value=0.63  Score=38.04  Aligned_cols=24  Identities=38%  Similarity=0.544  Sum_probs=19.5

Q ss_pred             HhhcCCCeeEEeeccCCCCCceee
Q psy12524         39 NAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        39 ~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+......++..|+||||||.++
T Consensus       128 ~~~~~~~glilI~GpTGSGKTTtL  151 (358)
T TIGR02524       128 DAIAPQEGIVFITGATGSGKSTLL  151 (358)
T ss_pred             HHHhccCCEEEEECCCCCCHHHHH
Confidence            344445688999999999999998


No 89 
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=83.91  E-value=0.79  Score=36.51  Aligned_cols=29  Identities=34%  Similarity=0.472  Sum_probs=23.9

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.++.+.-...+.|+.-|.|||||+.||
T Consensus       116 Pevlk~la~~kRGLviiVGaTGSGKSTtm  144 (375)
T COG5008         116 PEVLKDLALAKRGLVIIVGATGSGKSTTM  144 (375)
T ss_pred             cHHHHHhhcccCceEEEECCCCCCchhhH
Confidence            46667766667778899999999999998


No 90 
>PF12846 AAA_10:  AAA-like domain
Probab=83.82  E-value=0.39  Score=36.94  Aligned_cols=18  Identities=39%  Similarity=0.624  Sum_probs=15.3

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      |..++..|.+|||||.++
T Consensus         1 n~h~~i~G~tGsGKT~~~   18 (304)
T PF12846_consen    1 NPHTLILGKTGSGKTTLL   18 (304)
T ss_pred             CCeEEEECCCCCcHHHHH
Confidence            345788999999999988


No 91 
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=83.72  E-value=0.64  Score=36.29  Aligned_cols=27  Identities=33%  Similarity=0.519  Sum_probs=21.0

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+..++..-...++..|.+|||||.++
T Consensus        71 ~l~~~~~~~~GlilisG~tGSGKTT~l   97 (264)
T cd01129          71 IFRKLLEKPHGIILVTGPTGSGKTTTL   97 (264)
T ss_pred             HHHHHHhcCCCEEEEECCCCCcHHHHH
Confidence            345555555667889999999999998


No 92 
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ. Members of this protein family are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase of a type-IV secretion-like system of obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii (TIGR02524).
Probab=83.68  E-value=0.69  Score=38.06  Aligned_cols=27  Identities=30%  Similarity=0.416  Sum_probs=19.8

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+++.+.. .++.++..|+||||||.++
T Consensus       140 ~~~~~l~~-~~GlilI~G~TGSGKTT~l  166 (372)
T TIGR02525       140 DLFNSLLP-AAGLGLICGETGSGKSTLA  166 (372)
T ss_pred             HHHHHHHh-cCCEEEEECCCCCCHHHHH
Confidence            34444433 4567889999999999998


No 93 
>PF13479 AAA_24:  AAA domain
Probab=83.21  E-value=0.55  Score=35.27  Aligned_cols=20  Identities=35%  Similarity=0.516  Sum_probs=16.7

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      +..++.||.+|+|||.++..
T Consensus         3 ~~~~lIyG~~G~GKTt~a~~   22 (213)
T PF13479_consen    3 PIKILIYGPPGSGKTTLAAS   22 (213)
T ss_pred             ceEEEEECCCCCCHHHHHHh
Confidence            45789999999999988744


No 94 
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=82.78  E-value=0.49  Score=35.15  Aligned_cols=17  Identities=47%  Similarity=0.694  Sum_probs=15.1

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      +.++..|++|||||.++
T Consensus         2 GlilI~GptGSGKTTll   18 (198)
T cd01131           2 GLVLVTGPTGSGKSTTL   18 (198)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            46788999999999998


No 95 
>PF06309 Torsin:  Torsin;  InterPro: IPR010448 This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor
Probab=82.65  E-value=3.4  Score=28.91  Aligned_cols=25  Identities=24%  Similarity=0.680  Sum_probs=19.0

Q ss_pred             eEEee-ccCCCCCceeeccCCCCCCcHHHHHHHHHH
Q psy12524         47 CIFAY-GQTGSGKSYTMMGSQDNKGIIPRLCDSLFD   81 (151)
Q Consensus        47 ~v~~y-G~~~sGKt~t~~G~~~~~Gli~~~~~~lf~   81 (151)
                      .|+.+ |.+|+||+|.-          ...++.||.
T Consensus        54 LVlSfHG~tGtGKn~v~----------~liA~~ly~   79 (127)
T PF06309_consen   54 LVLSFHGWTGTGKNFVS----------RLIAEHLYK   79 (127)
T ss_pred             EEEEeecCCCCcHHHHH----------HHHHHHHHh
Confidence            45554 99999999987          566777775


No 96 
>PF00270 DEAD:  DEAD/DEAH box helicase;  InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0008026 ATP-dependent helicase activity; PDB: 3RRM_A 3RRN_A 3PEW_A 2KBE_A 3PEY_A 3FHO_A 2ZJA_A 2ZJ8_A 2ZJ5_A 2ZJ2_A ....
Probab=82.43  E-value=1.2  Score=31.34  Aligned_cols=27  Identities=26%  Similarity=0.456  Sum_probs=19.6

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      .++.+.+|.+  ++..|+||+|||.....
T Consensus         7 ~~~~i~~~~~--~li~aptGsGKT~~~~~   33 (169)
T PF00270_consen    7 AIEAIISGKN--VLISAPTGSGKTLAYIL   33 (169)
T ss_dssp             HHHHHHTTSE--EEEECSTTSSHHHHHHH
T ss_pred             HHHHHHcCCC--EEEECCCCCccHHHHHH
Confidence            3444555655  67889999999998853


No 97 
>PF00580 UvrD-helicase:  UvrD/REP helicase N-terminal domain;  InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. THe family includes both Rep and UvrD helcases. The Rep family helicases are composed of four structural domains []. The Rep proteins function as dimers.; GO: 0003677 DNA binding, 0004003 ATP-dependent DNA helicase activity, 0005524 ATP binding; PDB: 1UAA_B 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A 1QHG_A 1PJR_A ....
Probab=81.69  E-value=0.62  Score=36.09  Aligned_cols=20  Identities=25%  Similarity=0.439  Sum_probs=15.4

Q ss_pred             CCeeEEeeccCCCCCceeec
Q psy12524         44 YNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .+..++.-|..|||||.+|.
T Consensus        12 ~~~~~lV~a~AGSGKT~~l~   31 (315)
T PF00580_consen   12 TEGPLLVNAGAGSGKTTTLL   31 (315)
T ss_dssp             -SSEEEEEE-TTSSHHHHHH
T ss_pred             CCCCEEEEeCCCCCchHHHH
Confidence            56677888899999999994


No 98 
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=81.48  E-value=3.3  Score=31.93  Aligned_cols=43  Identities=28%  Similarity=0.410  Sum_probs=28.8

Q ss_pred             CCCCCCHHHHHHHHhHHHHHHhhc-C-CCeeEEeeccCCCCCceee
Q psy12524         19 LPNFASQEKVFDALGRDILDNAFQ-G-YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        19 ~~~~~~q~~vy~~~~~~lv~~~~~-G-~~~~v~~yG~~~sGKt~t~   62 (151)
                      +++...|+.+-... ..+++.+.. + .-..++-||+.|.|||...
T Consensus        23 L~efiGQ~~l~~~l-~i~i~aa~~r~~~l~h~lf~GPPG~GKTTLA   67 (233)
T PF05496_consen   23 LDEFIGQEHLKGNL-KILIRAAKKRGEALDHMLFYGPPGLGKTTLA   67 (233)
T ss_dssp             CCCS-S-HHHHHHH-HHHHHHHHCTTS---EEEEESSTTSSHHHHH
T ss_pred             HHHccCcHHHHhhh-HHHHHHHHhcCCCcceEEEECCCccchhHHH
Confidence            45667899888764 667777654 2 3346899999999998665


No 99 
>TIGR00631 uvrb excinuclease ABC, B subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University)
Probab=81.44  E-value=3.2  Score=36.77  Aligned_cols=84  Identities=21%  Similarity=0.319  Sum_probs=51.0

Q ss_pred             CCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccC---CCCCCcH----HHHHHHHHHHHHhhcCCC
Q psy12524         18 NLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGS---QDNKGII----PRLCDSLFDLIAKQESSE   90 (151)
Q Consensus        18 ~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~---~~~~Gli----~~~~~~lf~~~~~~~~~~   90 (151)
                      .|.+.-.|..-++.    +++.+-+|.... +..|.+|||||++|..-   ...|-|+    ...+..|++.+...-. +
T Consensus         7 ~~~~~~~Q~~ai~~----l~~~~~~~~~~~-~l~Gvtgs~kt~~~a~~~~~~~~p~Lvi~~n~~~A~ql~~el~~f~p-~   80 (655)
T TIGR00631         7 PFQPAGDQPKAIAK----LVEGLTDGEKHQ-TLLGVTGSGKTFTMANVIAQVNRPTLVIAHNKTLAAQLYNEFKEFFP-E   80 (655)
T ss_pred             CCCCChHHHHHHHH----HHHhhhcCCCcE-EEECCCCcHHHHHHHHHHHHhCCCEEEEECCHHHHHHHHHHHHHhCC-C
Confidence            34677777776654    455555554332 37899999999998541   1122221    1244566666654432 3


Q ss_pred             ceEEEEEEEEEEECCee
Q psy12524         91 LTYKVEVSYMEIYNEKV  107 (151)
Q Consensus        91 ~~~~v~~S~~eiy~e~v  107 (151)
                      ..+...+||+..|+-..
T Consensus        81 ~~V~~f~sy~d~y~pe~   97 (655)
T TIGR00631        81 NAVEYFVSYYDYYQPEA   97 (655)
T ss_pred             CeEEEEeeecccCCccc
Confidence            34677899999996654


No 100
>PF00063 Myosin_head:  Myosin head (motor domain);  InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril. Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....
Probab=81.39  E-value=1.2  Score=39.36  Aligned_cols=21  Identities=38%  Similarity=0.502  Sum_probs=19.5

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.+.+|+..|.+|||||.+.
T Consensus        82 ~~~~Q~IiisGeSGsGKTe~~  102 (689)
T PF00063_consen   82 TRQNQSIIISGESGSGKTETS  102 (689)
T ss_dssp             HTSEEEEEEEESTTSSHHHHH
T ss_pred             cccccceeeccccccccccch
Confidence            589999999999999999885


No 101
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=80.97  E-value=1.1  Score=35.05  Aligned_cols=43  Identities=28%  Similarity=0.363  Sum_probs=27.5

Q ss_pred             CCCCCHHHHHHHHhHHHHHHhhc--CCCeeEEeeccCCCCCceeec
Q psy12524         20 PNFASQEKVFDALGRDILDNAFQ--GYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        20 ~~~~~q~~vy~~~~~~lv~~~~~--G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .+...|+++-+.. ...+.....  +....++.||++|+|||+.+.
T Consensus         4 ~~~iG~~~~~~~l-~~~l~~~~~~~~~~~~~ll~Gp~G~GKT~la~   48 (305)
T TIGR00635         4 AEFIGQEKVKEQL-QLFIEAAKMRQEALDHLLLYGPPGLGKTTLAH   48 (305)
T ss_pred             HHHcCHHHHHHHH-HHHHHHHHhcCCCCCeEEEECCCCCCHHHHHH
Confidence            3445777777654 344443322  333457889999999999883


No 102
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional
Probab=80.79  E-value=1.6  Score=36.20  Aligned_cols=62  Identities=23%  Similarity=0.308  Sum_probs=43.0

Q ss_pred             CHHHHHHHHhHHHHHHhhc----CCCeeEEeeccCCCCCceee------ccC-----------CCCCCcHHHHHHHHHHH
Q psy12524         24 SQEKVFDALGRDILDNAFQ----GYNACIFAYGQTGSGKSYTM------MGS-----------QDNKGIIPRLCDSLFDL   82 (151)
Q Consensus        24 ~q~~vy~~~~~~lv~~~~~----G~~~~v~~yG~~~sGKt~t~------~G~-----------~~~~Gli~~~~~~lf~~   82 (151)
                      -...+.+.++..+.+..+.    ...--++.||+.|+|||+..      .|-           ....|=-.+.++++|..
T Consensus       123 ~~p~f~dk~~~hi~kn~l~~~~ik~PlgllL~GPPGcGKTllAraiA~elg~~~i~vsa~eL~sk~vGEsEk~IR~~F~~  202 (413)
T PLN00020        123 IAPAFMDKVAVHIAKNFLALPNIKVPLILGIWGGKGQGKSFQCELVFKKMGIEPIVMSAGELESENAGEPGKLIRQRYRE  202 (413)
T ss_pred             cCHHHHHHHHHHHHhhhhhccCCCCCeEEEeeCCCCCCHHHHHHHHHHHcCCCeEEEEHHHhhcCcCCcHHHHHHHHHHH
Confidence            3355666676677777663    34456788999999999885      221           12357778899999987


Q ss_pred             HHh
Q psy12524         83 IAK   85 (151)
Q Consensus        83 ~~~   85 (151)
                      ...
T Consensus       203 A~~  205 (413)
T PLN00020        203 AAD  205 (413)
T ss_pred             HHH
Confidence            654


No 103
>PLN03025 replication factor C subunit; Provisional
Probab=80.65  E-value=1.5  Score=34.99  Aligned_cols=22  Identities=23%  Similarity=0.515  Sum_probs=16.9

Q ss_pred             cCCCeeEEeeccCCCCCceeec
Q psy12524         42 QGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .|....++.||++|+|||+++.
T Consensus        31 ~~~~~~lll~Gp~G~GKTtla~   52 (319)
T PLN03025         31 DGNMPNLILSGPPGTGKTTSIL   52 (319)
T ss_pred             cCCCceEEEECCCCCCHHHHHH
Confidence            3444457889999999998873


No 104
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=80.51  E-value=0.76  Score=31.54  Aligned_cols=15  Identities=47%  Similarity=0.594  Sum_probs=13.5

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..|.+|||||+..
T Consensus         2 ii~~G~pgsGKSt~a   16 (143)
T PF13671_consen    2 IILCGPPGSGKSTLA   16 (143)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            688999999999876


No 105
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=80.41  E-value=0.49  Score=31.56  Aligned_cols=26  Identities=38%  Similarity=0.615  Sum_probs=19.1

Q ss_pred             EEeeccCCCCCceeeccCCCCCCcHHHHHHHHHHHH
Q psy12524         48 IFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLI   83 (151)
Q Consensus        48 v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~~~   83 (151)
                      |+.||.+|+|||..+          ...++++.+.+
T Consensus         1 I~i~G~~G~GKS~l~----------~~l~~~l~~~~   26 (107)
T PF00910_consen    1 IWIYGPPGIGKSTLA----------KELAKDLLKHI   26 (107)
T ss_pred             CEEECCCCCCHHHHH----------HHHHHHHHHHh
Confidence            468999999999988          44555555544


No 106
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]
Probab=80.34  E-value=1.1  Score=36.61  Aligned_cols=17  Identities=41%  Similarity=0.585  Sum_probs=15.8

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      +.++..|.||||||.++
T Consensus       174 ~NILisGGTGSGKTTlL  190 (355)
T COG4962         174 CNILISGGTGSGKTTLL  190 (355)
T ss_pred             eeEEEeCCCCCCHHHHH
Confidence            78999999999999887


No 107
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=80.20  E-value=0.63  Score=31.09  Aligned_cols=16  Identities=44%  Similarity=0.536  Sum_probs=13.6

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|.+|||||...
T Consensus         1 vI~I~G~~gsGKST~a   16 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLA   16 (121)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             CEEEECCCCCCHHHHH
Confidence            3678899999999876


No 108
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=80.01  E-value=2.3  Score=38.45  Aligned_cols=37  Identities=22%  Similarity=0.507  Sum_probs=28.8

Q ss_pred             HHHHHHHh-HHHHHHhhcCCCeeEEeeccCCCCCceeec
Q psy12524         26 EKVFDALG-RDILDNAFQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        26 ~~vy~~~~-~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      ..-|+..+ ..+++.+-+|.+-.++++ .||||||+|.+
T Consensus       166 ~RyyQ~~AI~rv~Eaf~~g~~raLlvM-ATGTGKTrTAi  203 (875)
T COG4096         166 PRYYQIIAIRRVIEAFSKGQNRALLVM-ATGTGKTRTAI  203 (875)
T ss_pred             chHHHHHHHHHHHHHHhcCCceEEEEE-ecCCCcceeHH
Confidence            44565444 778888889999977666 79999999984


No 109
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB. The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.
Probab=79.36  E-value=1  Score=35.78  Aligned_cols=28  Identities=39%  Similarity=0.547  Sum_probs=20.5

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..++..++.+ ...++..|.+|||||.++
T Consensus       122 ~~~L~~~v~~-~~~ilI~G~tGSGKTTll  149 (299)
T TIGR02782       122 RDVLREAVLA-RKNILVVGGTGSGKTTLA  149 (299)
T ss_pred             HHHHHHHHHc-CCeEEEECCCCCCHHHHH
Confidence            3445555553 356789999999999988


No 110
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=79.31  E-value=2.2  Score=37.83  Aligned_cols=21  Identities=29%  Similarity=0.463  Sum_probs=19.8

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.+.+|+.-|.+|||||.+.
T Consensus        89 ~~~~QsIiisGESGaGKTe~~  109 (677)
T smart00242       89 DKENQSIIISGESGAGKTENT  109 (677)
T ss_pred             cCCCceEEEecCCCCcchHHH
Confidence            589999999999999999987


No 111
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=79.26  E-value=0.66  Score=31.96  Aligned_cols=15  Identities=27%  Similarity=0.552  Sum_probs=13.6

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+.+|++|+|||..+
T Consensus         2 vlL~G~~G~GKt~l~   16 (139)
T PF07728_consen    2 VLLVGPPGTGKTTLA   16 (139)
T ss_dssp             EEEEESSSSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            688999999999877


No 112
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=79.22  E-value=2  Score=39.64  Aligned_cols=36  Identities=28%  Similarity=0.537  Sum_probs=22.9

Q ss_pred             HHHHHHHhHHHHHHhhc--CCCeeEEeeccCCCCCceee
Q psy12524         26 EKVFDALGRDILDNAFQ--GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        26 ~~vy~~~~~~lv~~~~~--G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ++-++.+. ..+..++.  +-+.+++.||.+|+|||.++
T Consensus       761 EeEIeeLa-sfL~paIkgsgpnnvLYIyG~PGTGKTATV  798 (1164)
T PTZ00112        761 EKEIKEVH-GFLESGIKQSGSNQILYISGMPGTGKTATV  798 (1164)
T ss_pred             HHHHHHHH-HHHHHHHhcCCCCceEEEECCCCCCHHHHH
Confidence            33344443 33344443  34456789999999999988


No 113
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=79.16  E-value=0.8  Score=36.39  Aligned_cols=41  Identities=22%  Similarity=0.390  Sum_probs=27.8

Q ss_pred             CeeEEeeccCCCCCceeecc--CC---------------CCCCcHHHHHHHHHHHHHh
Q psy12524         45 NACIFAYGQTGSGKSYTMMG--SQ---------------DNKGIIPRLCDSLFDLIAK   85 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G--~~---------------~~~Gli~~~~~~lf~~~~~   85 (151)
                      .-+|+-||++|+|||.+...  +.               ..-|=-.+-++++|.+..+
T Consensus       151 PknVLFyGppGTGKTm~Akalane~kvp~l~vkat~liGehVGdgar~Ihely~rA~~  208 (368)
T COG1223         151 PKNVLFYGPPGTGKTMMAKALANEAKVPLLLVKATELIGEHVGDGARRIHELYERARK  208 (368)
T ss_pred             cceeEEECCCCccHHHHHHHHhcccCCceEEechHHHHHHHhhhHHHHHHHHHHHHHh
Confidence            44789999999999988743  11               1235556677777876553


No 114
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=78.56  E-value=1.8  Score=33.85  Aligned_cols=21  Identities=19%  Similarity=0.322  Sum_probs=16.8

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .|....++.||+.|+|||.++
T Consensus        35 ~~~~~~~ll~G~~G~GKt~~~   55 (319)
T PRK00440         35 EKNMPHLLFAGPPGTGKTTAA   55 (319)
T ss_pred             CCCCCeEEEECCCCCCHHHHH
Confidence            455455789999999999777


No 115
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=78.51  E-value=0.86  Score=33.23  Aligned_cols=17  Identities=24%  Similarity=0.374  Sum_probs=14.8

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ++++..|++|+|||++.
T Consensus         4 ~~~ll~GpsGvGKT~la   20 (171)
T PF07724_consen    4 SNFLLAGPSGVGKTELA   20 (171)
T ss_dssp             EEEEEESSTTSSHHHHH
T ss_pred             EEEEEECCCCCCHHHHH
Confidence            46788999999999876


No 116
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=78.19  E-value=2.6  Score=37.40  Aligned_cols=21  Identities=33%  Similarity=0.623  Sum_probs=19.6

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .|.+.+|+.-|.+|||||.+.
T Consensus        85 ~~~~QsIiisGESGaGKTe~~  105 (674)
T cd01384          85 EGKSQSILVSGESGAGKTETT  105 (674)
T ss_pred             cCCCceEEEECCCCCCchhHH
Confidence            589999999999999999887


No 117
>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
Probab=78.07  E-value=2.5  Score=37.67  Aligned_cols=21  Identities=29%  Similarity=0.480  Sum_probs=19.6

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.+.+|+.-|.+|||||.+.
T Consensus        88 ~~~~QsIiiSGESGAGKTes~  108 (693)
T cd01377          88 DRENQSILITGESGAGKTENT  108 (693)
T ss_pred             cCCCceEEEEcCCCCCchHHH
Confidence            589999999999999999887


No 118
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=78.06  E-value=2.8  Score=37.21  Aligned_cols=21  Identities=33%  Similarity=0.523  Sum_probs=19.6

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.|.+|+.-|.+|||||.+.
T Consensus        89 ~~~~QsIiisGESGaGKTe~~  109 (677)
T cd01383          89 DEVNQSIIISGESGAGKTETA  109 (677)
T ss_pred             cCCCceEEEecCCCCCcchHH
Confidence            589999999999999999887


No 119
>cd00124 MYSc Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
Probab=77.78  E-value=2.6  Score=37.40  Aligned_cols=25  Identities=28%  Similarity=0.466  Sum_probs=21.3

Q ss_pred             HHhh-cCCCeeEEeeccCCCCCceee
Q psy12524         38 DNAF-QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        38 ~~~~-~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..++ .+.+.+|+.-|.+|||||.+.
T Consensus        78 ~~m~~~~~~QsIiisGESGaGKTe~~  103 (679)
T cd00124          78 RNMLRDRRNQSIIISGESGAGKTENT  103 (679)
T ss_pred             HHHHhcCCCceEEEecCCCCCchHHH
Confidence            3443 489999999999999999987


No 120
>PRK13894 conjugal transfer ATPase TrbB; Provisional
Probab=77.48  E-value=1.6  Score=35.11  Aligned_cols=27  Identities=30%  Similarity=0.444  Sum_probs=19.1

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .++..++.+ ..+++..|.+|||||.++
T Consensus       139 ~~L~~~v~~-~~~ilI~G~tGSGKTTll  165 (319)
T PRK13894        139 EAIIAAVRA-HRNILVIGGTGSGKTTLV  165 (319)
T ss_pred             HHHHHHHHc-CCeEEEECCCCCCHHHHH
Confidence            445555554 345677799999999777


No 121
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=77.24  E-value=3  Score=37.01  Aligned_cols=21  Identities=33%  Similarity=0.681  Sum_probs=19.7

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.|.+|+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiisGESGaGKTes~  103 (671)
T cd01381          83 EKKNQCIIISGESGAGKTEST  103 (671)
T ss_pred             cCCCceEEEEcCCCCCeehHH
Confidence            489999999999999999987


No 122
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=77.19  E-value=1.7  Score=31.79  Aligned_cols=28  Identities=32%  Similarity=0.336  Sum_probs=19.2

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+++...+.. ...++..|.+|||||.++
T Consensus        15 ~~~l~~~v~~-g~~i~I~G~tGSGKTTll   42 (186)
T cd01130          15 AAYLWLAVEA-RKNILISGGTGSGKTTLL   42 (186)
T ss_pred             HHHHHHHHhC-CCEEEEECCCCCCHHHHH
Confidence            3444444443 345778899999999877


No 123
>PRK06547 hypothetical protein; Provisional
Probab=77.02  E-value=2.8  Score=30.51  Aligned_cols=26  Identities=23%  Similarity=0.286  Sum_probs=17.9

Q ss_pred             HHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         37 LDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        37 v~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +..+..+..-.|...|.+|||||...
T Consensus         7 ~~~~~~~~~~~i~i~G~~GsGKTt~a   32 (172)
T PRK06547          7 AARLCGGGMITVLIDGRSGSGKTTLA   32 (172)
T ss_pred             HHHhhcCCCEEEEEECCCCCCHHHHH
Confidence            34444445555666799999999866


No 124
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=77.01  E-value=3  Score=37.00  Aligned_cols=21  Identities=29%  Similarity=0.665  Sum_probs=19.7

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.|.||+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiisGESGaGKTe~~  103 (674)
T cd01378          83 ENENQCVIISGESGAGKTEAA  103 (674)
T ss_pred             cCCCceEEEEcCCCCCcchHH
Confidence            589999999999999999987


No 125
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=76.94  E-value=2.7  Score=37.57  Aligned_cols=21  Identities=24%  Similarity=0.431  Sum_probs=19.7

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.+.+|+.-|.+|||||.+.
T Consensus        88 ~~~~QsIiisGESGaGKTes~  108 (717)
T cd01382          88 LKMSQSIIVSGESGAGKTENT  108 (717)
T ss_pred             cCCCCeEEEecCCCCChhHHH
Confidence            589999999999999999987


No 126
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=76.54  E-value=1.2  Score=34.38  Aligned_cols=18  Identities=22%  Similarity=0.346  Sum_probs=15.6

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...++.||++|+|||++.
T Consensus        42 ~~~vll~GppGtGKTtlA   59 (261)
T TIGR02881        42 VLHMIFKGNPGTGKTTVA   59 (261)
T ss_pred             cceEEEEcCCCCCHHHHH
Confidence            456789999999999887


No 127
>PHA02544 44 clamp loader, small subunit; Provisional
Probab=76.29  E-value=2.2  Score=33.66  Aligned_cols=21  Identities=19%  Similarity=0.347  Sum_probs=15.9

Q ss_pred             cCC-CeeEEeeccCCCCCceee
Q psy12524         42 QGY-NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~-~~~v~~yG~~~sGKt~t~   62 (151)
                      .|. ...++.+|++|+|||+.+
T Consensus        39 ~~~~~~~lll~G~~G~GKT~la   60 (316)
T PHA02544         39 KGRIPNMLLHSPSPGTGKTTVA   60 (316)
T ss_pred             cCCCCeEEEeeCcCCCCHHHHH
Confidence            454 345566999999999887


No 128
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=76.22  E-value=3.1  Score=37.07  Aligned_cols=21  Identities=38%  Similarity=0.697  Sum_probs=19.5

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.|.||+.-|.+|||||.+.
T Consensus        91 ~~~~QsIiisGESGAGKTet~  111 (692)
T cd01385          91 KKVNQCIVISGESGSGKTEST  111 (692)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            588999999999999999887


No 129
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=76.22  E-value=3  Score=37.10  Aligned_cols=21  Identities=29%  Similarity=0.531  Sum_probs=19.7

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.|.+|+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiiSGESGaGKTes~  103 (691)
T cd01380          83 DEKNQSIIVSGESGAGKTVSA  103 (691)
T ss_pred             cCCCceEEEEcCCCCCchHHH
Confidence            599999999999999999887


No 130
>PRK13342 recombination factor protein RarA; Reviewed
Probab=76.00  E-value=1.5  Score=36.36  Aligned_cols=39  Identities=18%  Similarity=0.275  Sum_probs=24.4

Q ss_pred             CHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeec
Q psy12524         24 SQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        24 ~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .|+.+.... .++...+-.+....++.+|++|+|||....
T Consensus        16 Gq~~~v~~~-~~L~~~i~~~~~~~ilL~GppGtGKTtLA~   54 (413)
T PRK13342         16 GQEHLLGPG-KPLRRMIEAGRLSSMILWGPPGTGKTTLAR   54 (413)
T ss_pred             CcHHHhCcc-hHHHHHHHcCCCceEEEECCCCCCHHHHHH
Confidence            445444321 223333345566678889999999998873


No 131
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=75.57  E-value=3.6  Score=36.59  Aligned_cols=21  Identities=33%  Similarity=0.646  Sum_probs=19.7

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.|.+|+.-|.+|||||.+.
T Consensus        84 ~~~~QsIiisGESGaGKTe~~  104 (677)
T cd01387          84 AKQNQCVIISGESGSGKTEAT  104 (677)
T ss_pred             cCCCceEEEEcCCCCCeehHH
Confidence            589999999999999999987


No 132
>PF06414 Zeta_toxin:  Zeta toxin;  InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [, ].; GO: 0005524 ATP binding, 0016301 kinase activity; PDB: 2P5T_H 1GVN_B 3Q8X_D.
Probab=75.06  E-value=1.6  Score=32.29  Aligned_cols=20  Identities=40%  Similarity=0.395  Sum_probs=15.0

Q ss_pred             CCCeeEEeeccCCCCCceee
Q psy12524         43 GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .....++..|++|||||.++
T Consensus        13 ~~P~~~i~aG~~GsGKSt~~   32 (199)
T PF06414_consen   13 EKPTLIIIAGQPGSGKSTLA   32 (199)
T ss_dssp             SS-EEEEEES-TTSTTHHHH
T ss_pred             cCCEEEEEeCCCCCCHHHHH
Confidence            34567888999999999877


No 133
>COG1201 Lhr Lhr-like helicases [General function prediction only]
Probab=75.02  E-value=5.6  Score=36.14  Aligned_cols=25  Identities=36%  Similarity=0.465  Sum_probs=20.3

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+..+.+|.|+.|+|  +||||||-+.
T Consensus        30 a~~~i~~G~nvLiiA--PTGsGKTeAA   54 (814)
T COG1201          30 AIPEIHSGENVLIIA--PTGSGKTEAA   54 (814)
T ss_pred             HHHHHhCCCceEEEc--CCCCChHHHH
Confidence            445677999997777  8999999876


No 134
>PF02562 PhoH:  PhoH-like protein;  InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [].; GO: 0005524 ATP binding; PDB: 3B85_A.
Probab=74.96  E-value=2.3  Score=32.11  Aligned_cols=19  Identities=26%  Similarity=0.578  Sum_probs=13.5

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+-.+++.|+.|||||+..
T Consensus        18 ~~~~v~~~G~AGTGKT~LA   36 (205)
T PF02562_consen   18 NNDLVIVNGPAGTGKTFLA   36 (205)
T ss_dssp             H-SEEEEE--TTSSTTHHH
T ss_pred             hCCeEEEECCCCCcHHHHH
Confidence            3447899999999999876


No 135
>PF01580 FtsK_SpoIIIE:  FtsK/SpoIIIE family;  InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies.The domain contains a putative ATP binding P-loop motif. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification []. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer []. ; GO: 0000166 nucleotide binding, 0003677 DNA binding, 0005524 ATP binding, 0007049 cell cycle, 0007059 chromosome segregation, 0051301 cell division, 0016021 integral to membrane; PDB: 2IUS_E 2IUU_A 2IUT_A.
Probab=74.81  E-value=0.99  Score=33.36  Aligned_cols=17  Identities=41%  Similarity=0.591  Sum_probs=12.9

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++..|.+|||||.++
T Consensus        39 ~h~li~G~tgsGKS~~l   55 (205)
T PF01580_consen   39 PHLLIAGATGSGKSTLL   55 (205)
T ss_dssp             -SEEEE--TTSSHHHHH
T ss_pred             ceEEEEcCCCCCccHHH
Confidence            36799999999999988


No 136
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=74.81  E-value=1.1  Score=33.41  Aligned_cols=16  Identities=44%  Similarity=0.590  Sum_probs=14.0

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|++|+|||.|+
T Consensus         3 vi~lvGptGvGKTTt~   18 (196)
T PF00448_consen    3 VIALVGPTGVGKTTTI   18 (196)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             EEEEECCCCCchHhHH
Confidence            4667899999999998


No 137
>PF02456 Adeno_IVa2:  Adenovirus IVa2 protein;  InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging []. During the course of lytic infection, the adenovirus major late promoter (MLP) is induced to high levels after replication of viral DNA has started. IVa2 is a transcriptional activator of the major late promoter [].; GO: 0019083 viral transcription
Probab=74.73  E-value=1.1  Score=36.22  Aligned_cols=17  Identities=47%  Similarity=0.593  Sum_probs=14.7

Q ss_pred             eEEeeccCCCCCceeec
Q psy12524         47 CIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~~   63 (151)
                      -.+.||+|||||++.+.
T Consensus        89 I~~VYGPTG~GKSqLlR  105 (369)
T PF02456_consen   89 IGVVYGPTGSGKSQLLR  105 (369)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            34789999999999885


No 138
>PF03668 ATP_bind_2:  P-loop ATPase protein family;  InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins. This is a family of putative P-loop ATPases [], as they contain an ATP-binding site and display ATPase and GTPase activities.; GO: 0005524 ATP binding
Probab=74.68  E-value=5  Score=31.91  Aligned_cols=16  Identities=31%  Similarity=0.576  Sum_probs=14.1

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .|+.-|.+|||||..|
T Consensus         3 ~vIiTGlSGaGKs~Al   18 (284)
T PF03668_consen    3 LVIITGLSGAGKSTAL   18 (284)
T ss_pred             EEEEeCCCcCCHHHHH
Confidence            4678899999999988


No 139
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=74.14  E-value=2.3  Score=29.86  Aligned_cols=19  Identities=26%  Similarity=0.319  Sum_probs=14.9

Q ss_pred             eeEEeeccCCCCCceeecc
Q psy12524         46 ACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..++..|.+|||||.++..
T Consensus        25 ~~~~i~~~~GsGKT~~~~~   43 (201)
T smart00487       25 RDVILAAPTGSGKTLAALL   43 (201)
T ss_pred             CcEEEECCCCCchhHHHHH
Confidence            3557789999999997743


No 140
>PRK13833 conjugal transfer protein TrbB; Provisional
Probab=74.13  E-value=2.2  Score=34.46  Aligned_cols=27  Identities=30%  Similarity=0.404  Sum_probs=19.4

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .++..++... .+++..|.+|||||.+|
T Consensus       135 ~~L~~~v~~~-~nilI~G~tGSGKTTll  161 (323)
T PRK13833        135 SVIRSAIDSR-LNIVISGGTGSGKTTLA  161 (323)
T ss_pred             HHHHHHHHcC-CeEEEECCCCCCHHHHH
Confidence            3444555432 35789999999999988


No 141
>PRK13900 type IV secretion system ATPase VirB11; Provisional
Probab=74.11  E-value=2.4  Score=34.34  Aligned_cols=27  Identities=26%  Similarity=0.373  Sum_probs=19.1

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .++..++.+ ..+++..|.+|||||.++
T Consensus       151 ~~L~~~v~~-~~nili~G~tgSGKTTll  177 (332)
T PRK13900        151 EFLEHAVIS-KKNIIISGGTSTGKTTFT  177 (332)
T ss_pred             HHHHHHHHc-CCcEEEECCCCCCHHHHH
Confidence            444444443 345788999999999988


No 142
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=74.04  E-value=1.2  Score=30.74  Aligned_cols=15  Identities=47%  Similarity=0.806  Sum_probs=13.2

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++.+|.+|+|||..+
T Consensus         2 ~~i~G~~G~GKT~l~   16 (165)
T cd01120           2 ILVFGPTGSGKTTLA   16 (165)
T ss_pred             eeEeCCCCCCHHHHH
Confidence            467899999999987


No 143
>PF03215 Rad17:  Rad17 cell cycle checkpoint protein
Probab=73.80  E-value=2.5  Score=36.34  Aligned_cols=29  Identities=31%  Similarity=0.589  Sum_probs=22.1

Q ss_pred             HHHHHHhhcCCC--eeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYN--ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~--~~v~~yG~~~sGKt~t~   62 (151)
                      +.+++..+.|..  ..++..|++|+|||.|+
T Consensus        32 ~~wl~~~~~~~~~~~iLlLtGP~G~GKtttv   62 (519)
T PF03215_consen   32 RSWLEEMFSGSSPKRILLLTGPSGCGKTTTV   62 (519)
T ss_pred             HHHHHHHhccCCCcceEEEECCCCCCHHHHH
Confidence            566666665543  46788999999999998


No 144
>PRK04195 replication factor C large subunit; Provisional
Probab=73.72  E-value=2.6  Score=35.72  Aligned_cols=29  Identities=24%  Similarity=0.555  Sum_probs=21.4

Q ss_pred             HHHHHHhhcCC-CeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGY-NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~-~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+++....|. ...++.||++|+|||+++
T Consensus        27 ~~~l~~~~~g~~~~~lLL~GppG~GKTtla   56 (482)
T PRK04195         27 REWIESWLKGKPKKALLLYGPPGVGKTSLA   56 (482)
T ss_pred             HHHHHHHhcCCCCCeEEEECCCCCCHHHHH
Confidence            44555555554 457889999999999887


No 145
>PRK13851 type IV secretion system protein VirB11; Provisional
Probab=73.69  E-value=1.3  Score=36.15  Aligned_cols=27  Identities=26%  Similarity=0.327  Sum_probs=19.1

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .++..+.. ...+++..|.+|||||.++
T Consensus       153 ~~l~~~v~-~~~nilI~G~tGSGKTTll  179 (344)
T PRK13851        153 AFLHACVV-GRLTMLLCGPTGSGKTTMS  179 (344)
T ss_pred             HHHHHHHH-cCCeEEEECCCCccHHHHH
Confidence            34444443 2345788999999999988


No 146
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=73.21  E-value=4.6  Score=31.73  Aligned_cols=16  Identities=44%  Similarity=0.596  Sum_probs=13.9

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|+|||.|+
T Consensus       196 vi~~vGptGvGKTTt~  211 (282)
T TIGR03499       196 VIALVGPTGVGKTTTL  211 (282)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            5666799999999998


No 147
>KOG0736|consensus
Probab=73.13  E-value=4.6  Score=36.55  Aligned_cols=21  Identities=14%  Similarity=0.349  Sum_probs=17.6

Q ss_pred             CCCcHHHHHHHHHHHHHhhcC
Q psy12524         68 NKGIIPRLCDSLFDLIAKQES   88 (151)
Q Consensus        68 ~~Gli~~~~~~lf~~~~~~~~   88 (151)
                      +-|+|-|++.+|.+.+.....
T Consensus       786 SGGVMDRVVSQLLAELDgls~  806 (953)
T KOG0736|consen  786 SGGVMDRVVSQLLAELDGLSD  806 (953)
T ss_pred             ccccHHHHHHHHHHHhhcccC
Confidence            469999999999999887653


No 148
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=72.96  E-value=1.7  Score=28.92  Aligned_cols=15  Identities=40%  Similarity=0.397  Sum_probs=12.8

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|.+|||||...
T Consensus         1 I~i~G~~GsGKtTia   15 (129)
T PF13238_consen    1 IGISGIPGSGKTTIA   15 (129)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             CEEECCCCCCHHHHH
Confidence            567899999999876


No 149
>TIGR01242 26Sp45 26S proteasome subunit P45 family. Many proteins may score above the trusted cutoff because an internal
Probab=72.65  E-value=1.4  Score=35.74  Aligned_cols=19  Identities=26%  Similarity=0.543  Sum_probs=15.8

Q ss_pred             CeeEEeeccCCCCCceeec
Q psy12524         45 NACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~   63 (151)
                      ...++.||++|+|||+++.
T Consensus       156 p~gvLL~GppGtGKT~lak  174 (364)
T TIGR01242       156 PKGVLLYGPPGTGKTLLAK  174 (364)
T ss_pred             CceEEEECCCCCCHHHHHH
Confidence            3458999999999998873


No 150
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=72.59  E-value=2.2  Score=31.95  Aligned_cols=28  Identities=29%  Similarity=0.433  Sum_probs=21.0

Q ss_pred             HHHHHhhcC---CCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQG---YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G---~~~~v~~yG~~~sGKt~t~   62 (151)
                      +-++.++.|   ....+..+|.+|||||..+
T Consensus         6 ~~lD~~l~GGi~~g~i~~i~G~~GsGKT~l~   36 (235)
T cd01123           6 KALDELLGGGIETGSITEIFGEFGSGKTQLC   36 (235)
T ss_pred             hhhHhhccCCCCCCeEEEEECCCCCCHHHHH
Confidence            345666664   3556788999999999877


No 151
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=72.39  E-value=4.2  Score=36.73  Aligned_cols=21  Identities=24%  Similarity=0.466  Sum_probs=19.6

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.+.+|+.-|.+|||||.+.
T Consensus        83 ~~~~QsIiiSGESGAGKTe~t  103 (767)
T cd01386          83 TRRDQSIIFLGRSGAGKTTSC  103 (767)
T ss_pred             cCCCceEEEecCCCCCcHHHH
Confidence            589999999999999999887


No 152
>PRK04328 hypothetical protein; Provisional
Probab=72.33  E-value=3.2  Score=31.96  Aligned_cols=28  Identities=25%  Similarity=0.360  Sum_probs=21.3

Q ss_pred             HHHHHhhcC---CCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQG---YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G---~~~~v~~yG~~~sGKt~t~   62 (151)
                      +-++.++.|   ...+++.+|.+|+|||...
T Consensus        10 ~~LD~lL~GGip~gs~ili~G~pGsGKT~l~   40 (249)
T PRK04328         10 PGMDEILYGGIPERNVVLLSGGPGTGKSIFS   40 (249)
T ss_pred             hhHHHHhcCCCcCCcEEEEEcCCCCCHHHHH
Confidence            345677765   4778899999999997653


No 153
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=72.17  E-value=4.7  Score=33.43  Aligned_cols=18  Identities=33%  Similarity=0.534  Sum_probs=15.9

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...++.+|.+|+|||.|+
T Consensus       174 ~~vi~lvGptGvGKTTT~  191 (388)
T PRK12723        174 KRVFILVGPTGVGKTTTI  191 (388)
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            457888999999999998


No 154
>PF12775 AAA_7:  P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=71.43  E-value=2.5  Score=33.19  Aligned_cols=27  Identities=22%  Similarity=0.411  Sum_probs=19.1

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceeec
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      +++..+. .+.-++..|++|+|||.++.
T Consensus        25 ll~~l~~-~~~pvLl~G~~GtGKT~li~   51 (272)
T PF12775_consen   25 LLDLLLS-NGRPVLLVGPSGTGKTSLIQ   51 (272)
T ss_dssp             HHHHHHH-CTEEEEEESSTTSSHHHHHH
T ss_pred             HHHHHHH-cCCcEEEECCCCCchhHHHH
Confidence            3444443 25567899999999998873


No 155
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family. Members of this protein family resemble the widely distributed ATP-dependent protease La, also called Lon and LonA. It resembles even more closely LonB, which is a LonA paralog found in genomes if and only if the species is capable of endospore formation (as in Bacillus subtilis, Clostridium tetani, and select other members of the Firmicutes) and expressed specifically in the forespore compartment. Members of this family are restricted to a subset of spore-forming species, and are very likely to participate in the program of endospore formation. We propose the designation LonC.
Probab=71.05  E-value=2.9  Score=36.68  Aligned_cols=27  Identities=26%  Similarity=0.487  Sum_probs=20.8

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ++..+..+....++.+|++|+|||...
T Consensus       166 l~~~ia~~~~~~vlL~Gp~GtGKTTLA  192 (615)
T TIGR02903       166 LLAKVASPFPQHIILYGPPGVGKTTAA  192 (615)
T ss_pred             HHHHHhcCCCCeEEEECCCCCCHHHHH
Confidence            344455567777899999999999866


No 156
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=71.03  E-value=2  Score=35.47  Aligned_cols=61  Identities=23%  Similarity=0.448  Sum_probs=39.2

Q ss_pred             HHHHHHHhHHHHHH-hhc--CCC--eeEEeeccCCCCCceeecc--------------CC---CCCCcHHHHHHHHHHHH
Q psy12524         26 EKVFDALGRDILDN-AFQ--GYN--ACIFAYGQTGSGKSYTMMG--------------SQ---DNKGIIPRLCDSLFDLI   83 (151)
Q Consensus        26 ~~vy~~~~~~lv~~-~~~--G~~--~~v~~yG~~~sGKt~t~~G--------------~~---~~~Gli~~~~~~lf~~~   83 (151)
                      +++.+.+..||.+. .+.  |..  --|+.||+.|||||-...-              +.   .-.|==+|.++++|...
T Consensus       161 ~EirE~VELPL~~PElF~~~GI~PPKGVLLYGPPGTGKTLLAkAVA~~T~AtFIrvvgSElVqKYiGEGaRlVRelF~lA  240 (406)
T COG1222         161 QEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKTLLAKAVANQTDATFIRVVGSELVQKYIGEGARLVRELFELA  240 (406)
T ss_pred             HHHHHHhcccccCHHHHHHcCCCCCCceEeeCCCCCcHHHHHHHHHhccCceEEEeccHHHHHHHhccchHHHHHHHHHH
Confidence            45555555677654 333  553  3689999999999866522              11   11355578889999876


Q ss_pred             Hhh
Q psy12524         84 AKQ   86 (151)
Q Consensus        84 ~~~   86 (151)
                      ..+
T Consensus       241 rek  243 (406)
T COG1222         241 REK  243 (406)
T ss_pred             hhc
Confidence            644


No 157
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=70.59  E-value=1.7  Score=26.43  Aligned_cols=16  Identities=38%  Similarity=0.542  Sum_probs=13.4

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      ..+..|.+|||||..|
T Consensus        25 ~tli~G~nGsGKSTll   40 (62)
T PF13555_consen   25 VTLITGPNGSGKSTLL   40 (62)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3567899999999877


No 158
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=70.52  E-value=6.7  Score=32.26  Aligned_cols=39  Identities=23%  Similarity=0.363  Sum_probs=24.4

Q ss_pred             CCHHHHHHHHhHHHHHHhhcC---CCeeEEeeccCCCCCceee
Q psy12524         23 ASQEKVFDALGRDILDNAFQG---YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~G---~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+++.-+..+.- +.....|   ....++..|++|+|||...
T Consensus        54 ~G~~~~i~~lv~~-l~~~a~g~~~~r~il~L~GPPGsGKStla   95 (361)
T smart00763       54 FGMEEAIERFVNY-FKSAAQGLEERKQILYLLGPVGGGKSSLV   95 (361)
T ss_pred             cCcHHHHHHHHHH-HHHHHhcCCCCCcEEEEECCCCCCHHHHH
Confidence            3556666666543 3333333   4566788899999997544


No 159
>PF05729 NACHT:  NACHT domain
Probab=70.32  E-value=2  Score=29.86  Aligned_cols=16  Identities=38%  Similarity=0.677  Sum_probs=14.0

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|..|+|||..+
T Consensus         2 ~l~I~G~~G~GKStll   17 (166)
T PF05729_consen    2 VLWISGEPGSGKSTLL   17 (166)
T ss_pred             EEEEECCCCCChHHHH
Confidence            3678999999999887


No 160
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=70.28  E-value=3.1  Score=37.29  Aligned_cols=22  Identities=23%  Similarity=0.376  Sum_probs=18.1

Q ss_pred             cCCCeeEEeeccCCCCCceeec
Q psy12524         42 QGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .+....++.||++|+|||++..
T Consensus        49 ~~~~~slLL~GPpGtGKTTLA~   70 (725)
T PRK13341         49 ADRVGSLILYGPPGVGKTTLAR   70 (725)
T ss_pred             cCCCceEEEECCCCCCHHHHHH
Confidence            4555678999999999998874


No 161
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=69.63  E-value=2  Score=30.93  Aligned_cols=17  Identities=41%  Similarity=0.614  Sum_probs=14.6

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ...+.+|.+|+|||..+
T Consensus        20 g~~vi~G~Ng~GKStil   36 (202)
T PF13476_consen   20 GLNVIYGPNGSGKSTIL   36 (202)
T ss_dssp             EEEEEEESTTSSHHHHH
T ss_pred             CcEEEECCCCCCHHHHH
Confidence            45678999999999888


No 162
>KOG3859|consensus
Probab=69.40  E-value=2.6  Score=33.81  Aligned_cols=29  Identities=34%  Similarity=0.550  Sum_probs=23.7

Q ss_pred             HHHHHH-hhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDN-AFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~-~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..||+. +-+|+.-.|++.|.||.||+..|
T Consensus        30 dQLV~ksv~~GF~FNilCvGETg~GKsTLm   59 (406)
T KOG3859|consen   30 DQLVNKSVSQGFCFNILCVGETGLGKSTLM   59 (406)
T ss_pred             HHHHHHHHhcCceEEEEEeccCCccHHHHH
Confidence            456654 45699999999999999999776


No 163
>PF00158 Sigma54_activat:  Sigma-54 interaction domain;  InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor. These have a conserved domain of about 230 residues involved in the ATP-dependent [, ] interaction with sigma-54. About half of the proteins in which this domain is found (algB, dcdT, flbD, hoxA, hupR1, hydG, ntrC, pgtA and pilR) belong to signal transduction two-component systems [] and possess a domain that can be phosphorylated by a sensor-kinase protein in their N-terminal section. Almost all of these proteins possess a helix-turn-helix DNA-binding domain in their C-terminal section. The domain which interacts with the sigma-54 factor has an ATPase activity. This may be required to promote a conformational change necessary for the interaction []. The domain contains an atypical ATP-binding motif A (P-loop) as well as a form of motif B. The two ATP-binding motifs are located in the N-terminal section of the domain.; GO: 0005524 ATP binding, 0008134 transcription factor binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1NY6_K 3M0E_G 1NY5_A 1OJL_A 3DZD_B 2C9C_A 2C98_A 2C96_A 2BJV_A 2C99_A ....
Probab=69.30  E-value=4.1  Score=29.57  Aligned_cols=21  Identities=24%  Similarity=0.406  Sum_probs=16.8

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+..|+.+|.+||||+...
T Consensus        19 a~~~~pVlI~GE~GtGK~~lA   39 (168)
T PF00158_consen   19 ASSDLPVLITGETGTGKELLA   39 (168)
T ss_dssp             TTSTS-EEEECSTTSSHHHHH
T ss_pred             hCCCCCEEEEcCCCCcHHHHH
Confidence            366788999999999998665


No 164
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=69.11  E-value=1.7  Score=34.81  Aligned_cols=39  Identities=28%  Similarity=0.376  Sum_probs=23.7

Q ss_pred             CCHHHHHHHHhHHHHHHhhc--CCCeeEEeeccCCCCCceee
Q psy12524         23 ASQEKVFDALGRDILDNAFQ--GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~--G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..|+++-+.. ..++.....  +....++.||++|+|||+.+
T Consensus        28 vG~~~~~~~l-~~~l~~~~~~~~~~~~~ll~GppG~GKT~la   68 (328)
T PRK00080         28 IGQEKVKENL-KIFIEAAKKRGEALDHVLLYGPPGLGKTTLA   68 (328)
T ss_pred             cCcHHHHHHH-HHHHHHHHhcCCCCCcEEEECCCCccHHHHH
Confidence            4555555443 333333322  22346788999999999887


No 165
>PF00931 NB-ARC:  NB-ARC domain;  InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []. This domain has been structurally characterised in the human protein apoptotic protease-activating factor 1 (Apaf-1) []. It contains the three-layered alpha-beta fold and subsequent short alpha-helical region characteristic of the AAA+ ATPase domain superfamily. While this domain is thought to bind and hyrolyse ATP, only ADP binding has been experimentally verified. It is proposed that binding and hydrolysis of ATP by this domain induces conformational changes the the overall protein, leading to formation of the apoptosome.; GO: 0043531 ADP binding; PDB: 3IZA_E 1Z6T_D 3SFZ_A 3SHF_A 1VT4_M 3IZ8_G 3LQR_A 2A5Y_C 3LQQ_A.
Probab=69.09  E-value=6.6  Score=30.17  Aligned_cols=30  Identities=17%  Similarity=0.118  Sum_probs=22.2

Q ss_pred             hHHHHHHhhc--CCCeeEEeeccCCCCCceee
Q psy12524         33 GRDILDNAFQ--GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        33 ~~~lv~~~~~--G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +..+.+.+.+  .....|..+|..|+|||...
T Consensus         5 ~~~l~~~L~~~~~~~~~v~I~G~~G~GKT~LA   36 (287)
T PF00931_consen    5 IEKLKDWLLDNSNEVRVVAIVGMGGIGKTTLA   36 (287)
T ss_dssp             HHHHHHHHHTTTTSSEEEEEEESTTSSHHHHH
T ss_pred             HHHHHHHhhCCCCCeEEEEEEcCCcCCcceee
Confidence            3455555555  56677889999999998776


No 166
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=68.99  E-value=1.9  Score=35.59  Aligned_cols=40  Identities=28%  Similarity=0.438  Sum_probs=26.4

Q ss_pred             CeeEEeeccCCCCCceeecc------CC-----------CCCCcHHHHHHHHHHHHH
Q psy12524         45 NACIFAYGQTGSGKSYTMMG------SQ-----------DNKGIIPRLCDSLFDLIA   84 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G------~~-----------~~~Gli~~~~~~lf~~~~   84 (151)
                      ...++.||++|+|||.....      ..           ...|-..+.++.+|+...
T Consensus       165 p~gvLL~GppGtGKT~lAkaia~~~~~~~i~v~~~~l~~~~~g~~~~~i~~~f~~a~  221 (389)
T PRK03992        165 PKGVLLYGPPGTGKTLLAKAVAHETNATFIRVVGSELVQKFIGEGARLVRELFELAR  221 (389)
T ss_pred             CCceEEECCCCCChHHHHHHHHHHhCCCEEEeehHHHhHhhccchHHHHHHHHHHHH
Confidence            44689999999999987622      10           112444567778887654


No 167
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=68.98  E-value=3.4  Score=36.89  Aligned_cols=23  Identities=22%  Similarity=0.300  Sum_probs=18.3

Q ss_pred             cCCCeeEEeeccCCCCCceeecc
Q psy12524         42 QGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      .+...+++.||.+|+|||....+
T Consensus       200 ~~~~~n~lL~G~pG~GKT~l~~~  222 (731)
T TIGR02639       200 RRKKNNPLLVGEPGVGKTAIAEG  222 (731)
T ss_pred             cCCCCceEEECCCCCCHHHHHHH
Confidence            44455678999999999999854


No 168
>PHA02244 ATPase-like protein
Probab=68.86  E-value=5.1  Score=33.18  Aligned_cols=19  Identities=32%  Similarity=0.485  Sum_probs=14.9

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.+  |+..|++|+|||+..
T Consensus       118 ~~~P--VLL~GppGtGKTtLA  136 (383)
T PHA02244        118 ANIP--VFLKGGAGSGKNHIA  136 (383)
T ss_pred             cCCC--EEEECCCCCCHHHHH
Confidence            3544  566999999999877


No 169
>TIGR01618 phage_P_loop phage nucleotide-binding protein. This model represents an uncharacterized family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of this protein is unknown.
Probab=68.76  E-value=2  Score=32.81  Aligned_cols=20  Identities=30%  Similarity=0.526  Sum_probs=16.6

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ...++.||.+|+|||.+...
T Consensus        12 ~~~~liyG~~G~GKtt~a~~   31 (220)
T TIGR01618        12 PNMYLIYGKPGTGKTSTIKY   31 (220)
T ss_pred             CcEEEEECCCCCCHHHHHHh
Confidence            45689999999999988743


No 170
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=68.74  E-value=5.8  Score=29.95  Aligned_cols=37  Identities=24%  Similarity=0.209  Sum_probs=22.8

Q ss_pred             HHHHHHHhHHHHHHhhc-CCCeeEEeeccCCCCCceee
Q psy12524         26 EKVFDALGRDILDNAFQ-GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        26 ~~vy~~~~~~lv~~~~~-G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +.++...+.-+....-. +....+...|.+|||||..+
T Consensus        13 ~~~~~~l~~~~~~~~~~~~~~~iigi~G~~GsGKTTl~   50 (229)
T PRK09270         13 EAVHKPLLRRLAALQAEPQRRTIVGIAGPPGAGKSTLA   50 (229)
T ss_pred             HHHHHHHHHHHHHHHhcCCCCEEEEEECCCCCCHHHHH
Confidence            45555555444433333 44445556699999999866


No 171
>KOG2543|consensus
Probab=68.68  E-value=2.2  Score=35.43  Aligned_cols=19  Identities=32%  Similarity=0.775  Sum_probs=15.7

Q ss_pred             CeeEEeeccCCCCCceeec
Q psy12524         45 NACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~   63 (151)
                      ...++.||.+|||||+++.
T Consensus        30 PS~~~iyG~sgTGKT~~~r   48 (438)
T KOG2543|consen   30 PSIVHIYGHSGTGKTYLVR   48 (438)
T ss_pred             ceeEEEeccCCCchhHHHH
Confidence            3456899999999999883


No 172
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=68.26  E-value=6.3  Score=30.95  Aligned_cols=25  Identities=28%  Similarity=0.527  Sum_probs=20.9

Q ss_pred             HHhhcCCCee-EEeeccCCCCCceee
Q psy12524         38 DNAFQGYNAC-IFAYGQTGSGKSYTM   62 (151)
Q Consensus        38 ~~~~~G~~~~-v~~yG~~~sGKt~t~   62 (151)
                      ..++.|..+. |+.+|.-|+||+..+
T Consensus        77 ~~F~~G~pANnVLLwGaRGtGKSSLV  102 (287)
T COG2607          77 EQFAEGLPANNVLLWGARGTGKSSLV  102 (287)
T ss_pred             HHHHcCCcccceEEecCCCCChHHHH
Confidence            4577888764 899999999999877


No 173
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).
Probab=68.14  E-value=4.9  Score=31.12  Aligned_cols=27  Identities=26%  Similarity=0.378  Sum_probs=18.1

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...+..|.  .++..|.+|+|||...
T Consensus        12 ~~~l~~l~~g~--~vLL~G~~GtGKT~lA   38 (262)
T TIGR02640        12 SRALRYLKSGY--PVHLRGPAGTGKTTLA   38 (262)
T ss_pred             HHHHHHHhcCC--eEEEEcCCCCCHHHHH
Confidence            33334444454  4567899999999876


No 174
>KOG1803|consensus
Probab=68.04  E-value=2.8  Score=36.64  Aligned_cols=17  Identities=29%  Similarity=0.557  Sum_probs=14.7

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ...+..|++|||||+|+
T Consensus       202 ~l~~I~GPPGTGKT~Tl  218 (649)
T KOG1803|consen  202 DLLIIHGPPGTGKTRTL  218 (649)
T ss_pred             CceEeeCCCCCCceeeH
Confidence            34667899999999999


No 175
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional
Probab=67.86  E-value=4.5  Score=33.80  Aligned_cols=24  Identities=33%  Similarity=0.511  Sum_probs=18.0

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCcee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYT   61 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t   61 (151)
                      .+..+++|.+  +++.++||||||..
T Consensus        34 ai~~~l~g~d--vi~~a~TGsGKT~a   57 (460)
T PRK11776         34 SLPAILAGKD--VIAQAKTGSGKTAA   57 (460)
T ss_pred             HHHHHhcCCC--EEEECCCCCcHHHH
Confidence            3445667876  67788999999965


No 176
>PF10923 DUF2791:  P-loop Domain of unknown function (DUF2791);  InterPro: IPR021228  This is a family of proteins found in archaea and bacteria. Some of the proteins in this family are annotated as being methyl-accepting chemotaxis proteins and ATP/GTP binding proteins. 
Probab=67.42  E-value=5.5  Score=33.37  Aligned_cols=29  Identities=31%  Similarity=0.479  Sum_probs=24.9

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..-++.+-+|.+..-+..|.-||||||.+
T Consensus        38 ~~~l~~v~~G~s~~kfi~G~YGsGKTf~l   66 (416)
T PF10923_consen   38 DRDLDRVADGGSSFKFIRGEYGSGKTFFL   66 (416)
T ss_pred             HHHHHHHhCCCCeEEEEEeCCCCcHHHHH
Confidence            34457788899999999999999999988


No 177
>PRK13764 ATPase; Provisional
Probab=67.40  E-value=3  Score=36.52  Aligned_cols=19  Identities=32%  Similarity=0.357  Sum_probs=16.3

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      ....++..|.||||||.++
T Consensus       256 ~~~~ILIsG~TGSGKTTll  274 (602)
T PRK13764        256 RAEGILIAGAPGAGKSTFA  274 (602)
T ss_pred             cCCEEEEECCCCCCHHHHH
Confidence            3455899999999999998


No 178
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=67.12  E-value=2.4  Score=35.01  Aligned_cols=18  Identities=33%  Similarity=0.446  Sum_probs=15.6

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...++..|++|+|||.|+
T Consensus       137 g~ii~lvGptGvGKTTti  154 (374)
T PRK14722        137 GGVFALMGPTGVGKTTTT  154 (374)
T ss_pred             CcEEEEECCCCCCHHHHH
Confidence            456778899999999998


No 179
>PTZ00014 myosin-A; Provisional
Probab=67.12  E-value=6.6  Score=35.76  Aligned_cols=21  Identities=24%  Similarity=0.395  Sum_probs=19.1

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.|.+|+.-|.+|+|||.+.
T Consensus       180 ~~~~QsIiiSGESGAGKTe~t  200 (821)
T PTZ00014        180 VKKSQTIIVSGESGAGKTEAT  200 (821)
T ss_pred             cCCCceEEEEcCCCCCchHHH
Confidence            589999999999999999765


No 180
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=67.07  E-value=5.2  Score=33.93  Aligned_cols=27  Identities=26%  Similarity=0.357  Sum_probs=18.3

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..++..+..+.  .++.+|.+|+|||+..
T Consensus       185 e~l~~~L~~~~--~iil~GppGtGKT~lA  211 (459)
T PRK11331        185 ETILKRLTIKK--NIILQGPPGVGKTFVA  211 (459)
T ss_pred             HHHHHHHhcCC--CEEEECCCCCCHHHHH
Confidence            34444444444  4566999999999776


No 181
>KOG0651|consensus
Probab=66.94  E-value=2.7  Score=34.18  Aligned_cols=78  Identities=19%  Similarity=0.347  Sum_probs=47.6

Q ss_pred             CCeEEEeceEeccCCCCCCCCCCHHHHHH-HHhHHHHHHhhc---CC--CeeEEeeccCCCCCceee------ccC----
Q psy12524          2 PPKTFAFDHCFYSLDPNLPNFASQEKVFD-ALGRDILDNAFQ---GY--NACIFAYGQTGSGKSYTM------MGS----   65 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~~~~~q~~vy~-~~~~~lv~~~~~---G~--~~~v~~yG~~~sGKt~t~------~G~----   65 (151)
                      .|+.++|+++-        ....|-.-|. .+..|+++..+-   |.  .--++.||+.|+|||+..      +|-    
T Consensus       125 ~~~~~s~~~~g--------gl~~qirelre~ielpl~np~lf~rvgIk~Pkg~ll~GppGtGKTlla~~Vaa~mg~nfl~  196 (388)
T KOG0651|consen  125 DPRNISFENVG--------GLFYQIRELREVIELPLTNPELFLRVGIKPPKGLLLYGPPGTGKTLLARAVAATMGVNFLK  196 (388)
T ss_pred             CccccCHHHhC--------ChHHHHHHHHhheEeeccCchhccccCCCCCceeEEeCCCCCchhHHHHHHHHhcCCceEE
Confidence            34556666665        1223333333 334677766432   33  335789999999999865      231    


Q ss_pred             -------CCCCCcHHHHHHHHHHHHHhhc
Q psy12524         66 -------QDNKGIIPRLCDSLFDLIAKQE   87 (151)
Q Consensus        66 -------~~~~Gli~~~~~~lf~~~~~~~   87 (151)
                             +...|=-.|.+++.|+......
T Consensus       197 v~ss~lv~kyiGEsaRlIRemf~yA~~~~  225 (388)
T KOG0651|consen  197 VVSSALVDKYIGESARLIRDMFRYAREVI  225 (388)
T ss_pred             eeHhhhhhhhcccHHHHHHHHHHHHhhhC
Confidence                   1246778899999998876543


No 182
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=66.74  E-value=2.7  Score=34.30  Aligned_cols=17  Identities=41%  Similarity=0.597  Sum_probs=14.5

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      +.++..|+||||||...
T Consensus        98 SNILLiGPTGsGKTlLA  114 (408)
T COG1219          98 SNILLIGPTGSGKTLLA  114 (408)
T ss_pred             ccEEEECCCCCcHHHHH
Confidence            46899999999999765


No 183
>PF10236 DAP3:  Mitochondrial ribosomal death-associated protein 3;  InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry represents a family of conserved proteins which were originally described as death-associated-protein-3 (DAP-3). The proteins carry a P-loop DNA-binding motif, and induce apoptosis []. DAP3 has been shown to be a pro-apoptotic factor in the mitochondrial matrix [] and to be crucial for mitochondrial biogenesis and so has also been designated as MRP-S29 (mitochondrial ribosomal protein subunit 29). 
Probab=66.49  E-value=4.6  Score=32.26  Aligned_cols=23  Identities=30%  Similarity=0.312  Sum_probs=19.2

Q ss_pred             hcCCCeeEEeeccCCCCCceeec
Q psy12524         41 FQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        41 ~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      ....+..++.+|..|||||.+|.
T Consensus        19 ~~~~~~r~vL~G~~GsGKS~~L~   41 (309)
T PF10236_consen   19 KSSKNNRYVLTGERGSGKSVLLA   41 (309)
T ss_pred             ccCCceEEEEECCCCCCHHHHHH
Confidence            34667789999999999999983


No 184
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]
Probab=66.38  E-value=2  Score=36.56  Aligned_cols=24  Identities=25%  Similarity=0.576  Sum_probs=17.8

Q ss_pred             EEeeccCCCCCceeeccCCCCCCcHHH
Q psy12524         48 IFAYGQTGSGKSYTMMGSQDNKGIIPR   74 (151)
Q Consensus        48 v~~yG~~~sGKt~t~~G~~~~~Gli~~   74 (151)
                      ++.+|+.|||||.+.   ..-+||+|.
T Consensus       201 Ll~~GpPGtGKTmla---~Rl~~lLPp  224 (490)
T COG0606         201 LLLVGPPGTGKTMLA---SRLPGLLPP  224 (490)
T ss_pred             EEEecCCCCchHHhh---hhhcccCCC
Confidence            689999999999877   233566543


No 185
>PRK15455 PrkA family serine protein kinase; Provisional
Probab=66.27  E-value=9.6  Score=33.59  Aligned_cols=39  Identities=18%  Similarity=0.241  Sum_probs=27.0

Q ss_pred             CCHHHHHHHHhHHHHHHhh--cCCCeeEEeeccCCCCCcee
Q psy12524         23 ASQEKVFDALGRDILDNAF--QGYNACIFAYGQTGSGKSYT   61 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~--~G~~~~v~~yG~~~sGKt~t   61 (151)
                      -.++++-+.++..+...+.  ......++..|++|+|||..
T Consensus        79 yGlee~ieriv~~l~~Aa~gl~~~~~IL~LvGPpG~GKSsL  119 (644)
T PRK15455         79 YGMEEAIEQIVSYFRHAAQGLEEKKQILYLLGPVGGGKSSL  119 (644)
T ss_pred             cCcHHHHHHHHHHHHHHHHhcCCCCceEEEecCCCCCchHH
Confidence            3667777777766644433  34455677789999999843


No 186
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.
Probab=66.00  E-value=2.2  Score=36.17  Aligned_cols=18  Identities=22%  Similarity=0.425  Sum_probs=15.5

Q ss_pred             eeEEeeccCCCCCceeec
Q psy12524         46 ACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~   63 (151)
                      -.++.||++|||||+.+.
T Consensus        89 ~giLL~GppGtGKT~la~  106 (495)
T TIGR01241        89 KGVLLVGPPGTGKTLLAK  106 (495)
T ss_pred             CcEEEECCCCCCHHHHHH
Confidence            358999999999999873


No 187
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=65.59  E-value=4.1  Score=30.02  Aligned_cols=18  Identities=33%  Similarity=0.508  Sum_probs=15.4

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+..+|.+|||||..+
T Consensus        12 g~i~~i~G~~GsGKT~l~   29 (209)
T TIGR02237        12 GTITQIYGPPGSGKTNIC   29 (209)
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            457788999999999876


No 188
>PF06048 DUF927:  Domain of unknown function (DUF927);  InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=65.34  E-value=6.7  Score=30.88  Aligned_cols=30  Identities=23%  Similarity=0.362  Sum_probs=22.4

Q ss_pred             HhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         32 LGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        32 ~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.||+ ..+.-.+..+-.||.+++|||.++
T Consensus       181 fa~pLL-~~l~~~~~~~hl~G~Ss~GKTt~~  210 (286)
T PF06048_consen  181 FAAPLL-SLLGVEGFGFHLYGQSSSGKTTAL  210 (286)
T ss_pred             HHHHHH-HHhCCCceEEEEEeCCCCCHHHHH
Confidence            335666 445566677888999999999877


No 189
>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif (motif II). This domain contains the ATP- binding region.
Probab=65.31  E-value=6.1  Score=28.71  Aligned_cols=25  Identities=28%  Similarity=0.495  Sum_probs=17.6

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .++.++.|.+  ++..++||+|||.+.
T Consensus        29 ~~~~~~~~~~--~li~~~TG~GKT~~~   53 (203)
T cd00268          29 AIPPLLSGRD--VIGQAQTGSGKTAAF   53 (203)
T ss_pred             HHHHHhcCCc--EEEECCCCCcHHHHH
Confidence            3344555766  577789999999763


No 190
>PF00735 Septin:  Septin;  InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []. Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.
Probab=65.31  E-value=2.7  Score=33.21  Aligned_cols=20  Identities=35%  Similarity=0.667  Sum_probs=17.7

Q ss_pred             CCCeeEEeeccCCCCCceee
Q psy12524         43 GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~   62 (151)
                      |.+-+|+..|.+|+|||.-+
T Consensus         2 g~~fnImVvG~sG~GKTTFI   21 (281)
T PF00735_consen    2 GFNFNIMVVGESGLGKTTFI   21 (281)
T ss_dssp             EEEEEEEEEECTTSSHHHHH
T ss_pred             CceEEEEEECCCCCCHHHHH
Confidence            67789999999999999766


No 191
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional
Probab=65.14  E-value=2.5  Score=35.06  Aligned_cols=40  Identities=25%  Similarity=0.458  Sum_probs=26.5

Q ss_pred             CeeEEeeccCCCCCceeecc------CC-----------CCCCcHHHHHHHHHHHHH
Q psy12524         45 NACIFAYGQTGSGKSYTMMG------SQ-----------DNKGIIPRLCDSLFDLIA   84 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G------~~-----------~~~Gli~~~~~~lf~~~~   84 (151)
                      ...++.||++|+|||.....      ..           ...|--.+.++++|....
T Consensus       179 pkgvLL~GppGTGKT~LAkalA~~l~~~fi~i~~s~l~~k~~ge~~~~lr~lf~~A~  235 (398)
T PTZ00454        179 PRGVLLYGPPGTGKTMLAKAVAHHTTATFIRVVGSEFVQKYLGEGPRMVRDVFRLAR  235 (398)
T ss_pred             CceEEEECCCCCCHHHHHHHHHHhcCCCEEEEehHHHHHHhcchhHHHHHHHHHHHH
Confidence            45689999999999988732      00           013444566777887654


No 192
>PTZ00424 helicase 45; Provisional
Probab=64.81  E-value=5.3  Score=32.43  Aligned_cols=26  Identities=27%  Similarity=0.548  Sum_probs=19.2

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+..+++|.+.  +..++||||||...
T Consensus        57 ~ai~~i~~~~d~--ii~apTGsGKT~~~   82 (401)
T PTZ00424         57 RGIKPILDGYDT--IGQAQSGTGKTATF   82 (401)
T ss_pred             HHHHHHhCCCCE--EEECCCCChHHHHH
Confidence            445567788875  46789999999654


No 193
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=64.66  E-value=2.4  Score=27.92  Aligned_cols=15  Identities=33%  Similarity=0.654  Sum_probs=13.3

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|..|+|||..+
T Consensus         2 I~V~G~~g~GKTsLi   16 (119)
T PF08477_consen    2 IVVLGDSGVGKTSLI   16 (119)
T ss_dssp             EEEECSTTSSHHHHH
T ss_pred             EEEECcCCCCHHHHH
Confidence            578899999999887


No 194
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=64.43  E-value=3.9  Score=34.19  Aligned_cols=39  Identities=18%  Similarity=0.292  Sum_probs=26.3

Q ss_pred             CCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         23 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..|+.+.-.- .++-.-+-.|.-.+.+.||+.|+|||...
T Consensus        27 vGQ~HLlg~~-~~lrr~v~~~~l~SmIl~GPPG~GKTTlA   65 (436)
T COG2256          27 VGQEHLLGEG-KPLRRAVEAGHLHSMILWGPPGTGKTTLA   65 (436)
T ss_pred             cChHhhhCCC-chHHHHHhcCCCceeEEECCCCCCHHHHH
Confidence            4565555332 34433344577788899999999999765


No 195
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional
Probab=64.31  E-value=5.6  Score=32.90  Aligned_cols=24  Identities=25%  Similarity=0.515  Sum_probs=18.5

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCcee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYT   61 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t   61 (151)
                      .+..+++|.+  +++.++||||||..
T Consensus        31 ai~~~~~g~d--~l~~apTGsGKT~~   54 (434)
T PRK11192         31 AIPPALDGRD--VLGSAPTGTGKTAA   54 (434)
T ss_pred             HHHHHhCCCC--EEEECCCCChHHHH
Confidence            3455667776  67888999999975


No 196
>PF14532 Sigma54_activ_2:  Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H.
Probab=64.16  E-value=7  Score=26.93  Aligned_cols=20  Identities=25%  Similarity=0.414  Sum_probs=16.2

Q ss_pred             CCCeeEEeeccCCCCCceee
Q psy12524         43 GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+..|+.+|..||||++..
T Consensus        19 ~~~~pvli~GE~GtGK~~~A   38 (138)
T PF14532_consen   19 KSSSPVLITGEPGTGKSLLA   38 (138)
T ss_dssp             CSSS-EEEECCTTSSHHHHH
T ss_pred             CCCCcEEEEcCCCCCHHHHH
Confidence            56677899999999998875


No 197
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs. A related protein is found in archaea.
Probab=64.10  E-value=3.4  Score=29.61  Aligned_cols=15  Identities=27%  Similarity=0.414  Sum_probs=13.0

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++.+|.+|+|||...
T Consensus         2 ~li~G~~G~GKT~l~   16 (187)
T cd01124           2 TLLSGGPGTGKTTFA   16 (187)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            578999999999866


No 198
>PRK06696 uridine kinase; Validated
Probab=64.07  E-value=9.8  Score=28.58  Aligned_cols=21  Identities=24%  Similarity=0.078  Sum_probs=15.8

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+....|..-|.+|||||...
T Consensus        19 ~~~~~iI~I~G~sgsGKSTlA   39 (223)
T PRK06696         19 LTRPLRVAIDGITASGKTTFA   39 (223)
T ss_pred             CCCceEEEEECCCCCCHHHHH
Confidence            355556677799999999854


No 199
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=63.98  E-value=2.8  Score=29.16  Aligned_cols=15  Identities=47%  Similarity=0.578  Sum_probs=12.7

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..|.+|||||...
T Consensus         2 i~l~G~~GsGKST~a   16 (150)
T cd02021           2 IVVMGVSGSGKSTVG   16 (150)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            567899999998775


No 200
>PRK07261 topology modulation protein; Provisional
Probab=63.86  E-value=3.6  Score=29.74  Aligned_cols=15  Identities=47%  Similarity=0.523  Sum_probs=12.9

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..|.+|||||...
T Consensus         3 i~i~G~~GsGKSTla   17 (171)
T PRK07261          3 IAIIGYSGSGKSTLA   17 (171)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            677899999998766


No 201
>PRK10536 hypothetical protein; Provisional
Probab=63.84  E-value=3.2  Score=32.58  Aligned_cols=17  Identities=41%  Similarity=0.761  Sum_probs=15.2

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++..|..|||||+..
T Consensus        75 ~lV~i~G~aGTGKT~La   91 (262)
T PRK10536         75 QLIFATGEAGCGKTWIS   91 (262)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            47899999999999876


No 202
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional
Probab=63.64  E-value=4.9  Score=34.18  Aligned_cols=23  Identities=17%  Similarity=0.164  Sum_probs=17.3

Q ss_pred             hhcCCC-eeEEeeccCCCCCceee
Q psy12524         40 AFQGYN-ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        40 ~~~G~~-~~v~~yG~~~sGKt~t~   62 (151)
                      +..|.- ..++.||+.|+|||.+.
T Consensus        30 i~~~~l~~~~Lf~GPpGtGKTTlA   53 (472)
T PRK14962         30 LKKNSISHAYIFAGPRGTGKTTVA   53 (472)
T ss_pred             HHcCCCCeEEEEECCCCCCHHHHH
Confidence            334443 45789999999999877


No 203
>KOG0953|consensus
Probab=63.54  E-value=6.5  Score=34.35  Aligned_cols=40  Identities=25%  Similarity=0.372  Sum_probs=30.2

Q ss_pred             eEEeeccCCCCCceeeccC------CCCCCcHHHHHHHHHHHHHhh
Q psy12524         47 CIFAYGQTGSGKSYTMMGS------QDNKGIIPRLCDSLFDLIAKQ   86 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~~G~------~~~~Gli~~~~~~lf~~~~~~   86 (151)
                      -++..|+|+|||||...-.      .---|-+-..+.++|+..+..
T Consensus       193 Ii~H~GPTNSGKTy~ALqrl~~aksGvycGPLrLLA~EV~~r~na~  238 (700)
T KOG0953|consen  193 IIMHVGPTNSGKTYRALQRLKSAKSGVYCGPLRLLAHEVYDRLNAL  238 (700)
T ss_pred             EEEEeCCCCCchhHHHHHHHhhhccceecchHHHHHHHHHHHhhhc
Confidence            4788899999999998542      123577888888999887643


No 204
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=63.47  E-value=7.8  Score=34.36  Aligned_cols=21  Identities=33%  Similarity=0.634  Sum_probs=19.4

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.+.+++.-|.+|||||.+.
T Consensus        83 ~~~~QsIiisGESGsGKTet~  103 (653)
T cd01379          83 YNQDQCIVISGESGSGKTESA  103 (653)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            488999999999999999887


No 205
>cd01127 TrwB Bacterial conjugation protein TrwB,  ATP binding domain. TrwB is a homohexamer encoded by conjugative plasmids in Gram-negative bacteria. TrwB also has an all alpha domain which has been hypothesized to be responsible for DNA binding. TrwB is a component of Type IV secretion and is responsible for the horizontal transfer of DNA between bacteria.
Probab=63.16  E-value=2.8  Score=34.72  Aligned_cols=18  Identities=33%  Similarity=0.567  Sum_probs=15.0

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      +.-++.+|.+|||||..+
T Consensus        42 ~~h~~i~g~tGsGKt~~i   59 (410)
T cd01127          42 EAHTMIIGTTGTGKTTQI   59 (410)
T ss_pred             hccEEEEcCCCCCHHHHH
Confidence            346789999999999766


No 206
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional
Probab=63.00  E-value=2.7  Score=35.42  Aligned_cols=17  Identities=29%  Similarity=0.632  Sum_probs=14.6

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.||++|||||.+.
T Consensus       218 ~gVLL~GPPGTGKT~LA  234 (438)
T PTZ00361        218 KGVILYGPPGTGKTLLA  234 (438)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            35788999999999886


No 207
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional
Probab=62.87  E-value=6.6  Score=32.88  Aligned_cols=25  Identities=28%  Similarity=0.535  Sum_probs=18.8

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+..+++|.+  +++..+||||||...
T Consensus        31 ai~~il~g~d--vlv~apTGsGKTla~   55 (456)
T PRK10590         31 AIPAVLEGRD--LMASAQTGTGKTAGF   55 (456)
T ss_pred             HHHHHhCCCC--EEEECCCCCcHHHHH
Confidence            4456677877  577789999999763


No 208
>PRK00131 aroK shikimate kinase; Reviewed
Probab=62.68  E-value=3.8  Score=28.84  Aligned_cols=17  Identities=35%  Similarity=0.350  Sum_probs=14.7

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++..|.+|||||...
T Consensus         5 ~~i~l~G~~GsGKstla   21 (175)
T PRK00131          5 PNIVLIGFMGAGKSTIG   21 (175)
T ss_pred             CeEEEEcCCCCCHHHHH
Confidence            46889999999999875


No 209
>KOG0926|consensus
Probab=62.67  E-value=5.6  Score=36.31  Aligned_cols=19  Identities=37%  Similarity=0.611  Sum_probs=16.4

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      .|-.++.+|+||||||.-+
T Consensus       270 ~n~vvIIcGeTGsGKTTQv  288 (1172)
T KOG0926|consen  270 ENPVVIICGETGSGKTTQV  288 (1172)
T ss_pred             cCCeEEEecCCCCCccccc
Confidence            4667889999999999877


No 210
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=62.44  E-value=4.9  Score=28.96  Aligned_cols=28  Identities=25%  Similarity=0.342  Sum_probs=21.8

Q ss_pred             HHHHHhhc-CCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQ-GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~-G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .++..+.. .....|+..|..+||||..+
T Consensus         3 ~~~~~~~~~~~~~~ililGl~~sGKTtll   31 (175)
T PF00025_consen    3 SVLSKLKSKKKEIKILILGLDGSGKTTLL   31 (175)
T ss_dssp             HHHHHCTTTTSEEEEEEEESTTSSHHHHH
T ss_pred             HHHHHhcccCcEEEEEEECCCccchHHHH
Confidence            45556654 67788999999999999755


No 211
>PRK10917 ATP-dependent DNA helicase RecG; Provisional
Probab=62.11  E-value=9.8  Score=33.78  Aligned_cols=27  Identities=26%  Similarity=0.273  Sum_probs=19.4

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +..+.-++....++..|.||||||...
T Consensus       273 I~~d~~~~~~~~~Ll~~~TGSGKT~va  299 (681)
T PRK10917        273 ILADLASPKPMNRLLQGDVGSGKTVVA  299 (681)
T ss_pred             HHHhhhccCCceEEEECCCCCcHHHHH
Confidence            334444455567899999999999765


No 212
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=62.07  E-value=3.6  Score=28.48  Aligned_cols=16  Identities=31%  Similarity=0.397  Sum_probs=13.7

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      +|+..|.+|||||...
T Consensus         1 ~i~l~G~~GsGKstla   16 (154)
T cd00464           1 NIVLIGMMGAGKTTVG   16 (154)
T ss_pred             CEEEEcCCCCCHHHHH
Confidence            4788999999999776


No 213
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=62.01  E-value=3.1  Score=32.78  Aligned_cols=16  Identities=25%  Similarity=0.385  Sum_probs=14.2

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      -++.+|.+|||||+..
T Consensus        60 ~vll~G~pGTGKT~lA   75 (284)
T TIGR02880        60 HMSFTGNPGTGKTTVA   75 (284)
T ss_pred             eEEEEcCCCCCHHHHH
Confidence            5889999999999876


No 214
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=61.91  E-value=7.6  Score=32.44  Aligned_cols=37  Identities=27%  Similarity=0.341  Sum_probs=24.0

Q ss_pred             HHHHHHHhHHHHHHhhcC----CCeeEEeeccCCCCCceee
Q psy12524         26 EKVFDALGRDILDNAFQG----YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        26 ~~vy~~~~~~lv~~~~~G----~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...|......+..++.+-    ....+...|+||.|||.|+
T Consensus       180 ~~~~~~~l~~~~~~~~~~~~~~~~~vi~LVGPTGVGKTTTl  220 (407)
T COG1419         180 LRYFSEKLRKLLLSLIENLIVEQKRVIALVGPTGVGKTTTL  220 (407)
T ss_pred             hhhHHHHHHHHHHhhccccccccCcEEEEECCCCCcHHHHH
Confidence            444555544444444433    2556677799999999998


No 215
>TIGR00376 DNA helicase, putative. The gene product may represent a DNA helicase. Eukaryotic members of this family have been characterized as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterized as helicases.
Probab=61.90  E-value=2.9  Score=36.82  Aligned_cols=17  Identities=29%  Similarity=0.579  Sum_probs=14.8

Q ss_pred             eEEeeccCCCCCceeec
Q psy12524         47 CIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~~   63 (151)
                      .++..|++|||||+|+.
T Consensus       175 ~~lI~GpPGTGKT~t~~  191 (637)
T TIGR00376       175 LFLIHGPPGTGKTRTLV  191 (637)
T ss_pred             eEEEEcCCCCCHHHHHH
Confidence            46789999999999984


No 216
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=61.88  E-value=4.1  Score=29.23  Aligned_cols=15  Identities=40%  Similarity=0.713  Sum_probs=13.0

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++.+|.+|||||...
T Consensus         2 i~i~G~pGsGKst~a   16 (183)
T TIGR01359         2 VFVLGGPGSGKGTQC   16 (183)
T ss_pred             EEEECCCCCCHHHHH
Confidence            678999999998864


No 217
>TIGR00643 recG ATP-dependent DNA helicase RecG.
Probab=61.78  E-value=8  Score=33.94  Aligned_cols=27  Identities=26%  Similarity=0.322  Sum_probs=18.6

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +..+.-.......+..|.||||||...
T Consensus       247 I~~~~~~~~~~~~Ll~g~TGSGKT~va  273 (630)
T TIGR00643       247 ILQDLKSDVPMNRLLQGDVGSGKTLVA  273 (630)
T ss_pred             HHHHhccCCCccEEEECCCCCcHHHHH
Confidence            333333344556799999999999864


No 218
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=61.72  E-value=8.1  Score=28.84  Aligned_cols=28  Identities=32%  Similarity=0.614  Sum_probs=20.8

Q ss_pred             HHHHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      +-++.++. |.  ...+..+|.+|+|||..+
T Consensus        10 ~~lD~~l~GGi~~g~i~~i~G~~GsGKT~l~   40 (225)
T PRK09361         10 KMLDELLGGGFERGTITQIYGPPGSGKTNIC   40 (225)
T ss_pred             HHHHHHhcCCCCCCeEEEEECCCCCCHHHHH
Confidence            44567775 43  456788999999998876


No 219
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=61.63  E-value=3.2  Score=31.93  Aligned_cols=15  Identities=40%  Similarity=0.667  Sum_probs=12.7

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      +...|++|||||..+
T Consensus        31 v~iiGpSGSGKSTlL   45 (240)
T COG1126          31 VVIIGPSGSGKSTLL   45 (240)
T ss_pred             EEEECCCCCCHHHHH
Confidence            366799999999877


No 220
>PRK08118 topology modulation protein; Reviewed
Probab=61.63  E-value=4.2  Score=29.32  Aligned_cols=15  Identities=47%  Similarity=0.572  Sum_probs=12.7

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|.+|||||...
T Consensus         4 I~I~G~~GsGKSTla   18 (167)
T PRK08118          4 IILIGSGGSGKSTLA   18 (167)
T ss_pred             EEEECCCCCCHHHHH
Confidence            678999999999654


No 221
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional
Probab=61.56  E-value=6.5  Score=32.48  Aligned_cols=25  Identities=28%  Similarity=0.436  Sum_probs=18.1

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+..++.|.+.  ++-++||||||...
T Consensus        38 aip~il~g~dv--i~~ApTGsGKTla~   62 (423)
T PRK04837         38 ALPLTLAGRDV--AGQAQTGTGKTMAF   62 (423)
T ss_pred             HHHHHhCCCcE--EEECCCCchHHHHH
Confidence            34456788774  66779999999753


No 222
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]
Probab=61.50  E-value=6.1  Score=34.20  Aligned_cols=19  Identities=21%  Similarity=0.576  Sum_probs=17.1

Q ss_pred             hcCCCeeEEeeccCCCCCc
Q psy12524         41 FQGYNACIFAYGQTGSGKS   59 (151)
Q Consensus        41 ~~G~~~~v~~yG~~~sGKt   59 (151)
                      ..+.+++|+..|.|||||-
T Consensus       264 ~A~tdstVLi~GESGTGKE  282 (560)
T COG3829         264 IAKTDSTVLILGESGTGKE  282 (560)
T ss_pred             hcCCCCcEEEecCCCccHH
Confidence            5688999999999999994


No 223
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=61.20  E-value=12  Score=30.13  Aligned_cols=18  Identities=33%  Similarity=0.508  Sum_probs=14.8

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+...|.+|+|||.|+
T Consensus       114 ~~vi~lvGpnGsGKTTt~  131 (318)
T PRK10416        114 PFVILVVGVNGVGKTTTI  131 (318)
T ss_pred             CeEEEEECCCCCcHHHHH
Confidence            345667799999999988


No 224
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.
Probab=61.13  E-value=7.4  Score=30.96  Aligned_cols=28  Identities=32%  Similarity=0.428  Sum_probs=19.8

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+++..+.+. .+++..|.+|||||..+
T Consensus       134 ~~~l~~~v~~~-~~ili~G~tGsGKTTll  161 (308)
T TIGR02788       134 KEFLRLAIASR-KNIIISGGTGSGKTTFL  161 (308)
T ss_pred             HHHHHHHhhCC-CEEEEECCCCCCHHHHH
Confidence            44555555433 46778899999999877


No 225
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=61.12  E-value=3.6  Score=30.80  Aligned_cols=16  Identities=50%  Similarity=0.569  Sum_probs=14.0

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .|+..|.+||||+.+.
T Consensus         2 ~IlllG~tGsGKSs~~   17 (212)
T PF04548_consen    2 RILLLGKTGSGKSSLG   17 (212)
T ss_dssp             EEEEECSTTSSHHHHH
T ss_pred             EEEEECCCCCCHHHHH
Confidence            6889999999999765


No 226
>KOG0726|consensus
Probab=61.10  E-value=4.5  Score=32.82  Aligned_cols=41  Identities=27%  Similarity=0.498  Sum_probs=29.8

Q ss_pred             eEEeeccCCCCCceeecc--------------CC---CCCCcHHHHHHHHHHHHHhhc
Q psy12524         47 CIFAYGQTGSGKSYTMMG--------------SQ---DNKGIIPRLCDSLFDLIAKQE   87 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~~G--------------~~---~~~Gli~~~~~~lf~~~~~~~   87 (151)
                      -|+.||..|+|||-....              +.   ...|==|+.+++||+..+.+.
T Consensus       221 GVIlyG~PGTGKTLLAKAVANqTSATFlRvvGseLiQkylGdGpklvRqlF~vA~e~a  278 (440)
T KOG0726|consen  221 GVILYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHA  278 (440)
T ss_pred             eeEEeCCCCCchhHHHHHHhcccchhhhhhhhHHHHHHHhccchHHHHHHHHHHHhcC
Confidence            589999999999866532              11   124566899999999877554


No 227
>PRK14974 cell division protein FtsY; Provisional
Probab=60.98  E-value=14  Score=30.05  Aligned_cols=18  Identities=33%  Similarity=0.519  Sum_probs=15.4

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+...|.+|+|||.|+
T Consensus       140 ~~vi~~~G~~GvGKTTti  157 (336)
T PRK14974        140 PVVIVFVGVNGTGKTTTI  157 (336)
T ss_pred             CeEEEEEcCCCCCHHHHH
Confidence            457788899999999977


No 228
>PHA02653 RNA helicase NPH-II; Provisional
Probab=60.89  E-value=10  Score=33.72  Aligned_cols=33  Identities=21%  Similarity=0.225  Sum_probs=21.4

Q ss_pred             CCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCcee
Q psy12524         23 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYT   61 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t   61 (151)
                      .-|.++-+.+    +..+.+|.+  +++.|+||||||..
T Consensus       163 ~~~~~iQ~qi----l~~i~~gkd--vIv~A~TGSGKTtq  195 (675)
T PHA02653        163 SLQPDVQLKI----FEAWISRKP--VVLTGGTGVGKTSQ  195 (675)
T ss_pred             chhHHHHHHH----HHHHHhCCC--EEEECCCCCCchhH
Confidence            3444444433    344555654  58899999999975


No 229
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=60.76  E-value=6.7  Score=32.09  Aligned_cols=35  Identities=31%  Similarity=0.324  Sum_probs=22.7

Q ss_pred             CHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         24 SQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        24 ~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .|+++=...+.    .+.+..-+.++..|.+|||||+.+
T Consensus        21 Gq~~~k~al~~----~~~~p~~~~vli~G~~GtGKs~~a   55 (350)
T CHL00081         21 GQEEMKLALIL----NVIDPKIGGVMIMGDRGTGKSTTI   55 (350)
T ss_pred             ChHHHHHHHHH----hccCCCCCeEEEEcCCCCCHHHHH
Confidence            55554444333    333323345889999999999988


No 230
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional
Probab=60.75  E-value=7.9  Score=31.30  Aligned_cols=27  Identities=19%  Similarity=0.309  Sum_probs=19.0

Q ss_pred             HHHHhhcCC-CeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGY-NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~-~~~v~~yG~~~sGKt~t~   62 (151)
                      +.+.+-.|. ...++-||+.|+|||.+.
T Consensus        29 l~~~i~~~~~~~~~L~~G~~G~GKt~~a   56 (367)
T PRK14970         29 LLNAIENNHLAQALLFCGPRGVGKTTCA   56 (367)
T ss_pred             HHHHHHcCCCCeEEEEECCCCCCHHHHH
Confidence            333444454 447889999999999766


No 231
>PHA01747 putative ATP-dependent protease
Probab=60.74  E-value=6.4  Score=32.74  Aligned_cols=31  Identities=16%  Similarity=0.209  Sum_probs=25.5

Q ss_pred             HhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         32 LGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        32 ~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      -+-|+++.-..+.|..++=.|+.||||||+.
T Consensus       177 RLiPlVE~~~~~~NyNliELgPRGTGKS~~f  207 (425)
T PHA01747        177 RLLPLFTSPVSKRPVHIIELSNRGTGKTTTF  207 (425)
T ss_pred             hhhhheeccCCCCCeeEEEecCCCCChhhHH
Confidence            3357777555788999999999999999987


No 232
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=60.73  E-value=3.4  Score=29.65  Aligned_cols=16  Identities=31%  Similarity=0.669  Sum_probs=13.9

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|.+|||||..+
T Consensus         3 ~~~i~G~sGsGKttl~   18 (179)
T TIGR02322         3 LIYVVGPSGAGKDTLL   18 (179)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4678899999999887


No 233
>TIGR02902 spore_lonB ATP-dependent protease LonB. Members of this protein are LonB, a paralog of the ATP-dependent protease La (LonA, TIGR00763). LonB proteins are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore, during sporulation, under control of sigma(F). The lonB gene, despite location immediately upstream of lonA, was shown to be monocistronic. LonB appears able to act on sigma(H) for post-translation control, but lonB mutation did not produce an obvious sporulation defect under the conditions tested. Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and this model selects only one per species as the protein that corresponds to LonB in B. subtilis.
Probab=60.72  E-value=9.8  Score=32.79  Aligned_cols=25  Identities=20%  Similarity=0.311  Sum_probs=19.1

Q ss_pred             HHhhcCCCeeEEeeccCCCCCceee
Q psy12524         38 DNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        38 ~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+.......++.||++|+|||...
T Consensus        79 ~al~~~~~~~vLi~Ge~GtGKt~lA  103 (531)
T TIGR02902        79 AALCGPNPQHVIIYGPPGVGKTAAA  103 (531)
T ss_pred             HHHhCCCCceEEEECCCCCCHHHHH
Confidence            3345556677889999999998765


No 234
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional
Probab=60.54  E-value=5.5  Score=37.51  Aligned_cols=30  Identities=23%  Similarity=0.354  Sum_probs=19.7

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..+.+.+..|... .+....||||||+|+..
T Consensus       423 ~ai~~a~~~g~r~-~Ll~maTGSGKT~tai~  452 (1123)
T PRK11448        423 QAVEKAIVEGQRE-ILLAMATGTGKTRTAIA  452 (1123)
T ss_pred             HHHHHHHHhccCC-eEEEeCCCCCHHHHHHH
Confidence            3444555556554 34457999999999854


No 235
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=60.49  E-value=6.9  Score=29.09  Aligned_cols=28  Identities=29%  Similarity=0.427  Sum_probs=20.4

Q ss_pred             HHHHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      +-++.++. |.  ...+..+|.+|+|||..+
T Consensus         6 ~~lD~~l~GG~~~g~v~~I~G~~GsGKT~l~   36 (226)
T cd01393           6 KALDELLGGGIPTGRITEIFGEFGSGKTQLC   36 (226)
T ss_pred             HHHHHHhCCCCcCCcEEEEeCCCCCChhHHH
Confidence            44566665 43  446778899999999876


No 236
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional
Probab=60.46  E-value=8.2  Score=31.41  Aligned_cols=35  Identities=23%  Similarity=0.320  Sum_probs=22.3

Q ss_pred             CHHHHHHHHhHHHHHHhhcC-CCeeEEeeccCCCCCceee
Q psy12524         24 SQEKVFDALGRDILDNAFQG-YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        24 ~q~~vy~~~~~~lv~~~~~G-~~~~v~~yG~~~sGKt~t~   62 (151)
                      .|+.+-+.    +.+.+..| ..-+++.+|+.|+|||.++
T Consensus        20 Gq~~~~~~----l~~~~~~~~~~h~~L~~Gp~G~GKTtla   55 (363)
T PRK14961         20 GQKHIVTA----ISNGLSLGRIHHAWLLSGTRGVGKTTIA   55 (363)
T ss_pred             ChHHHHHH----HHHHHHcCCCCeEEEEecCCCCCHHHHH
Confidence            45554433    33333344 3456789999999999866


No 237
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=60.41  E-value=3.5  Score=32.68  Aligned_cols=14  Identities=43%  Similarity=0.705  Sum_probs=12.1

Q ss_pred             EeeccCCCCCceee
Q psy12524         49 FAYGQTGSGKSYTM   62 (151)
Q Consensus        49 ~~yG~~~sGKt~t~   62 (151)
                      ...|++|||||.||
T Consensus        31 vliGpSGsGKTTtL   44 (309)
T COG1125          31 VLIGPSGSGKTTTL   44 (309)
T ss_pred             EEECCCCCcHHHHH
Confidence            44599999999998


No 238
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=60.01  E-value=14  Score=31.22  Aligned_cols=19  Identities=37%  Similarity=0.457  Sum_probs=16.2

Q ss_pred             CeeEEeeccCCCCCceeec
Q psy12524         45 NACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~   63 (151)
                      ...++.+|.+|+|||.|+.
T Consensus        95 p~vI~lvG~~GsGKTTtaa  113 (437)
T PRK00771         95 PQTIMLVGLQGSGKTTTAA  113 (437)
T ss_pred             CeEEEEECCCCCcHHHHHH
Confidence            4578888999999999983


No 239
>PHA02624 large T antigen; Provisional
Probab=60.01  E-value=9.5  Score=33.68  Aligned_cols=28  Identities=25%  Similarity=0.251  Sum_probs=21.5

Q ss_pred             HHHHHhhcCCCe--eEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNA--CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~--~v~~yG~~~sGKt~t~   62 (151)
                      ..++.++.|..-  +++-||+.+||||...
T Consensus       419 ~~lk~~l~giPKk~~il~~GPpnTGKTtf~  448 (647)
T PHA02624        419 DILKLIVENVPKRRYWLFKGPVNSGKTTLA  448 (647)
T ss_pred             HHHHHHHhcCCCCeEEEEECCCCCCHHHHH
Confidence            345566666654  8999999999999876


No 240
>CHL00181 cbbX CbbX; Provisional
Probab=59.78  E-value=4  Score=32.24  Aligned_cols=16  Identities=25%  Similarity=0.374  Sum_probs=14.0

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++.+|.+|+|||+..
T Consensus        61 ~ill~G~pGtGKT~lA   76 (287)
T CHL00181         61 HMSFTGSPGTGKTTVA   76 (287)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            3788999999999877


No 241
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.
Probab=59.74  E-value=6.5  Score=31.91  Aligned_cols=28  Identities=25%  Similarity=0.389  Sum_probs=21.2

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..++..++.+ ..+++..|.+|||||.++
T Consensus       168 ~~~L~~~v~~-~~~ili~G~tGsGKTTll  195 (340)
T TIGR03819       168 ARLLRAIVAA-RLAFLISGGTGSGKTTLL  195 (340)
T ss_pred             HHHHHHHHhC-CCeEEEECCCCCCHHHHH
Confidence            4556666654 367899999999999877


No 242
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family. Members of this family are assumed to differ from each other in DNA site specificity.
Probab=59.66  E-value=8.3  Score=34.17  Aligned_cols=31  Identities=23%  Similarity=0.393  Sum_probs=20.7

Q ss_pred             HhHHHHHHhhc-----CCCeeEEeeccCCCCCceeec
Q psy12524         32 LGRDILDNAFQ-----GYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        32 ~~~~lv~~~~~-----G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .+..+++++..     |.... +.+-.||||||.||.
T Consensus       246 av~~~~~~~~~~~~~~~~~~g-li~~~TGsGKT~t~~  281 (667)
T TIGR00348       246 AVKKIVESITRKTWGKDERGG-LIWHTQGSGKTLTML  281 (667)
T ss_pred             HHHHHHHHHHhcccCCCCcee-EEEEecCCCccHHHH
Confidence            34566677665     33333 455599999999994


No 243
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=59.60  E-value=8  Score=29.15  Aligned_cols=28  Identities=32%  Similarity=0.479  Sum_probs=20.2

Q ss_pred             HHHHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      +-++.++. |.  ...++.+|.+|+|||...
T Consensus        12 ~~LD~~l~gG~~~g~~~~i~G~~GsGKt~l~   42 (234)
T PRK06067         12 EELDRKLGGGIPFPSLILIEGDHGTGKSVLS   42 (234)
T ss_pred             HHHHHhhCCCCcCCcEEEEECCCCCChHHHH
Confidence            44566665 43  567788899999997665


No 244
>KOG2228|consensus
Probab=59.44  E-value=17  Score=29.96  Aligned_cols=54  Identities=17%  Similarity=0.297  Sum_probs=37.0

Q ss_pred             HHHHH-HhhcCCCeeEEeeccCCCCCceeecc---C----CC------CCCcHHH---HHHHHHHHHHhhc
Q psy12524         34 RDILD-NAFQGYNACIFAYGQTGSGKSYTMMG---S----QD------NKGIIPR---LCDSLFDLIAKQE   87 (151)
Q Consensus        34 ~~lv~-~~~~G~~~~v~~yG~~~sGKt~t~~G---~----~~------~~Gli~~---~~~~lf~~~~~~~   87 (151)
                      ..+++ .++.|.+-+++..|+.|||||..+--   .    .+      =.|.+.-   +++.|-.+++...
T Consensus        37 ~~~lkqt~~~gEsnsviiigprgsgkT~li~~~Ls~~q~~~E~~l~v~Lng~~~~dk~al~~I~rql~~e~  107 (408)
T KOG2228|consen   37 SELLKQTILHGESNSVIIIGPRGSGKTILIDTRLSDIQENGENFLLVRLNGELQTDKIALKGITRQLALEL  107 (408)
T ss_pred             HHHHHHHHHhcCCCceEEEccCCCCceEeeHHHHhhHHhcCCeEEEEEECccchhhHHHHHHHHHHHHHHH
Confidence            34444 47789999999999999999998722   1    01      1466666   7777776665443


No 245
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=59.36  E-value=4.3  Score=31.83  Aligned_cols=21  Identities=33%  Similarity=0.621  Sum_probs=18.4

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .|..-.|+..|.+|+|||..+
T Consensus         1 ~g~~f~I~vvG~sg~GKSTli   21 (276)
T cd01850           1 KGFQFNIMVVGESGLGKSTFI   21 (276)
T ss_pred             CCcEEEEEEEcCCCCCHHHHH
Confidence            377889999999999999776


No 246
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=59.28  E-value=4.1  Score=27.55  Aligned_cols=17  Identities=24%  Similarity=0.411  Sum_probs=14.0

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...|++|||||.++
T Consensus        16 e~v~I~GpSGsGKSTLl   32 (107)
T cd00820          16 VGVLITGDSGIGKTELA   32 (107)
T ss_pred             EEEEEEcCCCCCHHHHH
Confidence            45677899999999877


No 247
>PRK10865 protein disaggregation chaperone; Provisional
Probab=59.05  E-value=10  Score=34.61  Aligned_cols=17  Identities=29%  Similarity=0.436  Sum_probs=14.9

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++..|++|+|||++.
T Consensus       599 ~~~Lf~Gp~G~GKT~lA  615 (857)
T PRK10865        599 GSFLFLGPTGVGKTELC  615 (857)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            46788899999999977


No 248
>TIGR03689 pup_AAA proteasome ATPase. In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity.
Probab=58.84  E-value=3.5  Score=35.44  Aligned_cols=17  Identities=29%  Similarity=0.638  Sum_probs=14.3

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      -.++.||++|+|||.+.
T Consensus       217 ~GILLyGPPGTGKT~LA  233 (512)
T TIGR03689       217 KGVLLYGPPGCGKTLIA  233 (512)
T ss_pred             cceEEECCCCCcHHHHH
Confidence            35889999999999755


No 249
>CHL00195 ycf46 Ycf46; Provisional
Probab=58.83  E-value=3.8  Score=35.02  Aligned_cols=40  Identities=18%  Similarity=0.176  Sum_probs=26.7

Q ss_pred             CeeEEeeccCCCCCceeecc------C-----------CCCCCcHHHHHHHHHHHHH
Q psy12524         45 NACIFAYGQTGSGKSYTMMG------S-----------QDNKGIIPRLCDSLFDLIA   84 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G------~-----------~~~~Gli~~~~~~lf~~~~   84 (151)
                      .-.++.||+.|||||.+...      -           ....|--...++.+|+..+
T Consensus       259 pkGILL~GPpGTGKTllAkaiA~e~~~~~~~l~~~~l~~~~vGese~~l~~~f~~A~  315 (489)
T CHL00195        259 PRGLLLVGIQGTGKSLTAKAIANDWQLPLLRLDVGKLFGGIVGESESRMRQMIRIAE  315 (489)
T ss_pred             CceEEEECCCCCcHHHHHHHHHHHhCCCEEEEEhHHhcccccChHHHHHHHHHHHHH
Confidence            34689999999999977622      0           0123555667778887654


No 250
>PRK06217 hypothetical protein; Validated
Probab=58.32  E-value=5  Score=29.13  Aligned_cols=15  Identities=33%  Similarity=0.432  Sum_probs=12.9

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|.+|||||...
T Consensus         4 I~i~G~~GsGKSTla   18 (183)
T PRK06217          4 IHITGASGSGTTTLG   18 (183)
T ss_pred             EEEECCCCCCHHHHH
Confidence            778899999998655


No 251
>TIGR02688 conserved hypothetical protein TIGR02688. Members of this family are uncharacterized proteins sporadically distributed in bacteria and archaea, about 470 amino acids in length. Several members of this family appear in public databases with annotation as ATP-dependent protease La, despite the lack of similarity to families TIGR00763 (ATP-dependent protease La) or pfam02190 (ATP-dependent protease La (LON) domain). This protein is repeatedly found downstream of another uncharacterized protein of about 880 amino acids in length, described by model TIGR02687.
Probab=58.26  E-value=4.1  Score=34.36  Aligned_cols=20  Identities=35%  Similarity=0.591  Sum_probs=16.4

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      +..++-.|++|+||||...+
T Consensus       209 ~~Nli~lGp~GTGKThla~~  228 (449)
T TIGR02688       209 NYNLIELGPKGTGKSYIYNN  228 (449)
T ss_pred             CCcEEEECCCCCCHHHHHHH
Confidence            44568899999999998854


No 252
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion. These proteins aid the transfer of DNA from the plasmid into the host bacterial chromosome. They contain an ATP binding domain. VirD4 is involved in DNA transfer to plant cells and is required for virulence.
Probab=58.00  E-value=6.3  Score=32.14  Aligned_cols=16  Identities=25%  Similarity=0.532  Sum_probs=13.7

Q ss_pred             EEeeccCCCCCceeec
Q psy12524         48 IFAYGQTGSGKSYTMM   63 (151)
Q Consensus        48 v~~yG~~~sGKt~t~~   63 (151)
                      ++..|.+|||||..+.
T Consensus         2 ~lv~g~tGsGKt~~~v   17 (384)
T cd01126           2 VLVFAPTRSGKGVGFV   17 (384)
T ss_pred             eeEecCCCCCCccEEE
Confidence            5788999999998874


No 253
>KOG0652|consensus
Probab=57.97  E-value=5.1  Score=32.01  Aligned_cols=16  Identities=31%  Similarity=0.725  Sum_probs=13.8

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      -++.||+.|+|||-..
T Consensus       207 GvLmYGPPGTGKTlmA  222 (424)
T KOG0652|consen  207 GVLMYGPPGTGKTLMA  222 (424)
T ss_pred             ceEeeCCCCCcHHHHH
Confidence            5899999999998654


No 254
>PF12774 AAA_6:  Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=57.95  E-value=7.3  Score=29.86  Aligned_cols=36  Identities=17%  Similarity=0.186  Sum_probs=22.0

Q ss_pred             EEeeccCCCCCceeec------cC-----CCCCCcHHHHHHHHHHHH
Q psy12524         48 IFAYGQTGSGKSYTMM------GS-----QDNKGIIPRLCDSLFDLI   83 (151)
Q Consensus        48 v~~yG~~~sGKt~t~~------G~-----~~~~Gli~~~~~~lf~~~   83 (151)
                      -..+|++|||||.|+.      |.     ..++++=...+..||..+
T Consensus        35 ~~~~GpagtGKtetik~La~~lG~~~~vfnc~~~~~~~~l~ril~G~   81 (231)
T PF12774_consen   35 GALSGPAGTGKTETIKDLARALGRFVVVFNCSEQMDYQSLSRILKGL   81 (231)
T ss_dssp             EEEESSTTSSHHHHHHHHHHCTT--EEEEETTSSS-HHHHHHHHHHH
T ss_pred             CCCcCCCCCCchhHHHHHHHHhCCeEEEecccccccHHHHHHHHHHH
Confidence            3579999999999983      32     124455555555555444


No 255
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]
Probab=57.72  E-value=7  Score=32.19  Aligned_cols=21  Identities=29%  Similarity=0.563  Sum_probs=18.8

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .|+.-+|++.|++|+|||.-+
T Consensus        20 ~Gi~f~im~~G~sG~GKttfi   40 (373)
T COG5019          20 KGIDFTIMVVGESGLGKTTFI   40 (373)
T ss_pred             cCCceEEEEecCCCCchhHHH
Confidence            499999999999999998654


No 256
>PF13173 AAA_14:  AAA domain
Probab=57.33  E-value=4.4  Score=27.59  Aligned_cols=16  Identities=31%  Similarity=0.491  Sum_probs=14.4

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++.+|+.++|||..+
T Consensus         4 ~~~l~G~R~vGKTtll   19 (128)
T PF13173_consen    4 IIILTGPRGVGKTTLL   19 (128)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            5788999999999988


No 257
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3. cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.
Probab=57.07  E-value=8.1  Score=33.12  Aligned_cols=19  Identities=32%  Similarity=0.581  Sum_probs=15.6

Q ss_pred             eeEEeeccCCCCCceeecc
Q psy12524         46 ACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..+..+|++|||||..+.+
T Consensus        33 Eiv~L~G~SGsGKSTLLr~   51 (504)
T TIGR03238        33 SLLFLCGSSGDGKSEILAE   51 (504)
T ss_pred             CEEEEECCCCCCHHHHHhc
Confidence            4567889999999998863


No 258
>TIGR01074 rep ATP-dependent DNA helicase Rep. Designed to identify rep members of the uvrD/rep subfamily.
Probab=56.89  E-value=5.1  Score=35.18  Aligned_cols=20  Identities=20%  Similarity=0.328  Sum_probs=16.2

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ...++..|..|||||.+|..
T Consensus        14 ~~~~~V~Ag~GSGKT~~L~~   33 (664)
T TIGR01074        14 TGPCLVLAGAGSGKTRVITN   33 (664)
T ss_pred             CCCEEEEecCCCCHHHHHHH
Confidence            44577889999999999943


No 259
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=56.74  E-value=5.7  Score=28.64  Aligned_cols=15  Identities=40%  Similarity=0.616  Sum_probs=12.9

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|..|||||...
T Consensus         2 I~i~G~pGsGKst~a   16 (194)
T cd01428           2 ILLLGPPGSGKGTQA   16 (194)
T ss_pred             EEEECCCCCCHHHHH
Confidence            678999999998665


No 260
>PF06745 KaiC:  KaiC;  InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria [].  The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....
Probab=56.73  E-value=6  Score=29.59  Aligned_cols=26  Identities=31%  Similarity=0.538  Sum_probs=19.2

Q ss_pred             HHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         37 LDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        37 v~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      ++.++. |.  +.+++..|.+|||||...
T Consensus         8 LD~~l~GGip~gs~~li~G~~GsGKT~l~   36 (226)
T PF06745_consen    8 LDELLGGGIPKGSVVLISGPPGSGKTTLA   36 (226)
T ss_dssp             HHHHTTTSEETTSEEEEEESTTSSHHHHH
T ss_pred             HHHhhcCCCCCCcEEEEEeCCCCCcHHHH
Confidence            455553 33  667899999999998665


No 261
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=56.66  E-value=4.1  Score=27.31  Aligned_cols=16  Identities=31%  Similarity=0.376  Sum_probs=13.8

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      -|...|.+|+|||..+
T Consensus         3 ki~~~G~~~~GKstl~   18 (161)
T TIGR00231         3 KIVIVGDPNVGKSTLL   18 (161)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4678899999999876


No 262
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis.
Probab=56.59  E-value=9.9  Score=30.28  Aligned_cols=24  Identities=21%  Similarity=0.279  Sum_probs=17.6

Q ss_pred             HhhcCC-CeeEEeeccCCCCCceee
Q psy12524         39 NAFQGY-NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        39 ~~~~G~-~~~v~~yG~~~sGKt~t~   62 (151)
                      .+-.|. ...++.||+.|+|||.+.
T Consensus        29 ~~~~~~~~~~~Ll~G~~G~GKt~~a   53 (355)
T TIGR02397        29 AIKNGRIAHAYLFSGPRGTGKTSIA   53 (355)
T ss_pred             HHHcCCCCeEEEEECCCCCCHHHHH
Confidence            333454 446789999999999766


No 263
>TIGR02236 recomb_radA DNA repair and recombination protein RadA. This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
Probab=56.57  E-value=7.5  Score=30.73  Aligned_cols=28  Identities=32%  Similarity=0.463  Sum_probs=20.5

Q ss_pred             HHHHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      +-++.++. |.  ...+..+|.+|+|||..+
T Consensus        82 ~~lD~~l~GGi~~g~i~ei~G~~g~GKT~l~  112 (310)
T TIGR02236        82 KELDELLGGGIETQAITEVFGEFGSGKTQIC  112 (310)
T ss_pred             HHHHHHhcCCCCCCeEEEEECCCCCCHHHHH
Confidence            45666766 32  445679999999999875


No 264
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=56.52  E-value=4  Score=28.78  Aligned_cols=14  Identities=43%  Similarity=0.525  Sum_probs=11.3

Q ss_pred             EeeccCCCCCceee
Q psy12524         49 FAYGQTGSGKSYTM   62 (151)
Q Consensus        49 ~~yG~~~sGKt~t~   62 (151)
                      +..|.+|||||...
T Consensus         2 ~l~G~~GsGKSTla   15 (163)
T TIGR01313         2 VLMGVAGSGKSTIA   15 (163)
T ss_pred             EEECCCCCCHHHHH
Confidence            46799999998664


No 265
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=56.22  E-value=12  Score=27.75  Aligned_cols=27  Identities=30%  Similarity=0.486  Sum_probs=20.0

Q ss_pred             HHHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      -++.++. |.  ...+..+|.+|||||..+
T Consensus         7 ~LD~~l~GGi~~g~i~~i~G~~GsGKT~l~   36 (218)
T cd01394           7 GLDELLGGGVERGTVTQVYGPPGTGKTNIA   36 (218)
T ss_pred             HHHHHhcCCccCCeEEEEECCCCCCHHHHH
Confidence            3566665 44  345789999999999876


No 266
>KOG0729|consensus
Probab=55.81  E-value=6.5  Score=31.52  Aligned_cols=51  Identities=25%  Similarity=0.464  Sum_probs=31.4

Q ss_pred             HHHHHH--hh-cCCCe--eEEeeccCCCCCceeec--------------cCC---CCCCcHHHHHHHHHHHHH
Q psy12524         34 RDILDN--AF-QGYNA--CIFAYGQTGSGKSYTMM--------------GSQ---DNKGIIPRLCDSLFDLIA   84 (151)
Q Consensus        34 ~~lv~~--~~-~G~~~--~v~~yG~~~sGKt~t~~--------------G~~---~~~Gli~~~~~~lf~~~~   84 (151)
                      .|++..  +. -|..-  -|+.||+.|+|||-...              |+.   ...|-=.|.+++||++..
T Consensus       195 ~pll~perfv~lgidppkgvllygppgtgktl~aravanrtdacfirvigselvqkyvgegarmvrelf~mar  267 (435)
T KOG0729|consen  195 LPLLHPERFVNLGIDPPKGVLLYGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMAR  267 (435)
T ss_pred             ccccCHHHHhhcCCCCCCceEEeCCCCCchhHHHHHHhcccCceEEeehhHHHHHHHhhhhHHHHHHHHHHhc
Confidence            455532  33 36543  58999999999987552              221   112444577888887654


No 267
>KOG0354|consensus
Probab=55.63  E-value=9.8  Score=34.20  Aligned_cols=25  Identities=36%  Similarity=0.616  Sum_probs=20.1

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+++.++ |.|+.|.+  +||+|||+..
T Consensus        69 eivq~AL-gkNtii~l--PTG~GKTfIA   93 (746)
T KOG0354|consen   69 ELVQPAL-GKNTIIAL--PTGSGKTFIA   93 (746)
T ss_pred             HHhHHhh-cCCeEEEe--ecCCCccchH
Confidence            5778888 99985544  8999999876


No 268
>PF03969 AFG1_ATPase:  AFG1-like ATPase;  InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP. AFG1 also has substantial homology to these proteins outside the ATPase domain []. This family of proteins contains a P-loop motif.; GO: 0005524 ATP binding
Probab=55.63  E-value=4.8  Score=32.99  Aligned_cols=18  Identities=28%  Similarity=0.637  Sum_probs=15.9

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      .--+..||..|.|||+.|
T Consensus        62 ~~GlYl~G~vG~GKT~Lm   79 (362)
T PF03969_consen   62 PKGLYLWGPVGRGKTMLM   79 (362)
T ss_pred             CceEEEECCCCCchhHHH
Confidence            346899999999999998


No 269
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=55.51  E-value=6.3  Score=28.20  Aligned_cols=16  Identities=44%  Similarity=0.623  Sum_probs=13.5

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|.+|||||..+
T Consensus         5 ii~i~G~~GsGKsTl~   20 (188)
T TIGR01360         5 IIFIVGGPGSGKGTQC   20 (188)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4667899999999876


No 270
>KOG1532|consensus
Probab=55.49  E-value=11  Score=30.29  Aligned_cols=19  Identities=37%  Similarity=0.489  Sum_probs=16.6

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+++++.|..|||||.-+
T Consensus        18 ~p~~ilVvGMAGSGKTTF~   36 (366)
T KOG1532|consen   18 RPVIILVVGMAGSGKTTFM   36 (366)
T ss_pred             CCcEEEEEecCCCCchhHH
Confidence            4678999999999999766


No 271
>PRK14531 adenylate kinase; Provisional
Probab=55.32  E-value=6.3  Score=28.63  Aligned_cols=16  Identities=25%  Similarity=0.461  Sum_probs=13.5

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      -++..|.+|||||...
T Consensus         4 ~i~i~G~pGsGKsT~~   19 (183)
T PRK14531          4 RLLFLGPPGAGKGTQA   19 (183)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4788999999998765


No 272
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family. Members of this protein family are predicted ATP-binding proteins apparently associated with DNA conjugal transfer. Members are found both in plasmids and in bacterial chromosomal regions that appear to derive from integrative elements such as conjugative transposons. More distant homologs, outside the scope of this family, include type IV secretion/conjugal transfer proteins such as TraC, VirB4 and TrsE. The granularity of this protein family definition is chosen so as to represent one distinctive clade and act as a marker through which to define and recognize the class of mobile element it serves.
Probab=55.24  E-value=4.4  Score=37.13  Aligned_cols=19  Identities=47%  Similarity=0.676  Sum_probs=17.0

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      .|...+..|.||||||.++
T Consensus       474 ~n~n~~I~G~TGSGKS~l~  492 (893)
T TIGR03744       474 KNAHLLILGPTGAGKSATL  492 (893)
T ss_pred             CcccEEEECCCCCCHHHHH
Confidence            4778899999999999988


No 273
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type. subtype of CRISPR/Cas locus, found in several species of Cyanobacteria and several archaeal species. It contains helicase motifs and appears to represent the Cas3 protein of the Cyano subtype of CRISPR/Cas system.
Probab=54.78  E-value=11  Score=30.49  Aligned_cols=26  Identities=23%  Similarity=0.327  Sum_probs=20.1

Q ss_pred             HHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         37 LDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        37 v~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.+.+|.+..++...+||||||...
T Consensus         6 ~~~~~~~~~~~~~i~apTGsGKT~~~   31 (357)
T TIGR03158         6 FEALQSKDADIIFNTAPTGAGKTLAW   31 (357)
T ss_pred             HHHHHcCCCCEEEEECCCCCCHHHHH
Confidence            34556677767888899999999864


No 274
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=54.58  E-value=12  Score=31.59  Aligned_cols=25  Identities=28%  Similarity=0.519  Sum_probs=18.2

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+..++.|.++  ++..+||||||.+.
T Consensus        19 ai~~~l~g~dv--lv~apTGsGKTl~y   43 (470)
T TIGR00614        19 VINAVLLGRDC--FVVMPTGGGKSLCY   43 (470)
T ss_pred             HHHHHHcCCCE--EEEcCCCCcHhHHH
Confidence            44567788864  55679999999753


No 275
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=54.38  E-value=6.9  Score=35.30  Aligned_cols=20  Identities=25%  Similarity=0.395  Sum_probs=16.3

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ...++.+|.+|+|||+...+
T Consensus       207 ~~n~LLvGppGvGKT~lae~  226 (758)
T PRK11034        207 KNNPLLVGESGVGKTAIAEG  226 (758)
T ss_pred             CCCeEEECCCCCCHHHHHHH
Confidence            34567799999999999855


No 276
>PRK14532 adenylate kinase; Provisional
Probab=54.25  E-value=7.4  Score=28.15  Aligned_cols=16  Identities=19%  Similarity=0.451  Sum_probs=13.4

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|..|||||...
T Consensus         2 ~i~~~G~pGsGKsT~a   17 (188)
T PRK14532          2 NLILFGPPAAGKGTQA   17 (188)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4788999999998665


No 277
>TIGR02746 TraC-F-type type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.
Probab=54.19  E-value=4.8  Score=36.08  Aligned_cols=18  Identities=44%  Similarity=0.639  Sum_probs=15.8

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      |..++..|.+|||||.++
T Consensus       430 n~n~~I~G~tGsGKS~~~  447 (797)
T TIGR02746       430 NYNIAVVGGSGAGKSFFM  447 (797)
T ss_pred             ccceEEEcCCCCCHHHHH
Confidence            456789999999999998


No 278
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=54.00  E-value=7  Score=23.70  Aligned_cols=15  Identities=47%  Similarity=0.541  Sum_probs=11.9

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      +...|..|||||...
T Consensus         2 i~i~G~~gsGKst~~   16 (69)
T cd02019           2 IAITGGSGSGKSTVA   16 (69)
T ss_pred             EEEECCCCCCHHHHH
Confidence            345699999998776


No 279
>KOG0739|consensus
Probab=53.86  E-value=6.1  Score=32.14  Aligned_cols=60  Identities=28%  Similarity=0.449  Sum_probs=38.9

Q ss_pred             HHHHHhHHHH-HHhhcCCC---eeEEeeccCCCCCceeecc----------CCCC-------CCcHHHHHHHHHHHHHhh
Q psy12524         28 VFDALGRDIL-DNAFQGYN---ACIFAYGQTGSGKSYTMMG----------SQDN-------KGIIPRLCDSLFDLIAKQ   86 (151)
Q Consensus        28 vy~~~~~~lv-~~~~~G~~---~~v~~yG~~~sGKt~t~~G----------~~~~-------~Gli~~~~~~lf~~~~~~   86 (151)
                      +=+.++.|+- .++|.|..   ..++.||+.|+||+|....          +-++       -|=-...++.||++..+.
T Consensus       145 LKEAVILPIKFPqlFtGkR~PwrgiLLyGPPGTGKSYLAKAVATEAnSTFFSvSSSDLvSKWmGESEkLVknLFemARe~  224 (439)
T KOG0739|consen  145 LKEAVILPIKFPQLFTGKRKPWRGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESEKLVKNLFEMAREN  224 (439)
T ss_pred             HHhheeecccchhhhcCCCCcceeEEEeCCCCCcHHHHHHHHHhhcCCceEEeehHHHHHHHhccHHHHHHHHHHHHHhc
Confidence            3334444432 45676653   5799999999999997632          0111       366677889999887655


Q ss_pred             c
Q psy12524         87 E   87 (151)
Q Consensus        87 ~   87 (151)
                      .
T Consensus       225 k  225 (439)
T KOG0739|consen  225 K  225 (439)
T ss_pred             C
Confidence            4


No 280
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=53.84  E-value=7.4  Score=27.80  Aligned_cols=16  Identities=38%  Similarity=0.497  Sum_probs=13.2

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|++|||||..+
T Consensus         3 ii~l~G~~GsGKsTl~   18 (180)
T TIGR03263         3 LIVISGPSGVGKSTLV   18 (180)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4677899999999854


No 281
>PF02534 T4SS-DNA_transf:  Type IV secretory system Conjugative DNA transfer;  InterPro: IPR003688 This entry represents TraG proteins and their homologues. These proteins contain a P-loop and walker-B site for nucleotide binding. TraG is essential for DNA transfer in bacterial conjugation. These proteins are thought to mediate interactions between the DNA-processing (Dtr) and the mating pair formation (Mpf) systems [, ].; GO: 0009291 unidirectional conjugation, 0016020 membrane
Probab=53.82  E-value=10  Score=31.64  Aligned_cols=18  Identities=33%  Similarity=0.660  Sum_probs=15.7

Q ss_pred             eeEEeeccCCCCCceeec
Q psy12524         46 ACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~   63 (151)
                      .-+++.|.+|||||.++.
T Consensus        45 ~h~lvig~tgSGKt~~~v   62 (469)
T PF02534_consen   45 THVLVIGPTGSGKTTSFV   62 (469)
T ss_pred             eEEEEEeCCCCCccceee
Confidence            568999999999999883


No 282
>PF10412 TrwB_AAD_bind:  Type IV secretion-system coupling protein DNA-binding domain;  InterPro: IPR019476  The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein. It is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells []. This protein forms hexamers from six structurally very similar protomers []. This hexamer contains a central channel running from the cytosolic pole (formed by the all-alpha domains) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB all-alpha domain appears to be the DNA-binding domain of the structure. ; PDB: 1E9S_D 1E9R_F 1GKI_B 1GL7_G 1GL6_A.
Probab=53.67  E-value=4.3  Score=33.38  Aligned_cols=17  Identities=41%  Similarity=0.647  Sum_probs=12.8

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++..|.+|||||..|
T Consensus        16 ~~~li~G~~GsGKT~~i   32 (386)
T PF10412_consen   16 RHILIIGATGSGKTQAI   32 (386)
T ss_dssp             G-EEEEE-TTSSHHHHH
T ss_pred             CcEEEECCCCCCHHHHH
Confidence            35688999999999866


No 283
>TIGR00618 sbcc exonuclease SbcC. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=53.66  E-value=18  Score=33.68  Aligned_cols=17  Identities=29%  Similarity=0.591  Sum_probs=14.1

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.+|+||+|||..+
T Consensus        27 gl~~I~G~nGaGKSTil   43 (1042)
T TIGR00618        27 PIFLICGKTGAGKTTLL   43 (1042)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            56668899999998766


No 284
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=53.64  E-value=7  Score=26.63  Aligned_cols=15  Identities=47%  Similarity=0.519  Sum_probs=12.6

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..|.+|||||...
T Consensus         2 I~i~G~~GsGKst~a   16 (147)
T cd02020           2 IAIDGPAGSGKSTVA   16 (147)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999999865


No 285
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=53.61  E-value=5.4  Score=33.38  Aligned_cols=16  Identities=38%  Similarity=0.578  Sum_probs=13.8

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|++|+|||.|+
T Consensus       223 ~i~~vGptGvGKTTt~  238 (424)
T PRK05703        223 VVALVGPTGVGKTTTL  238 (424)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            5666799999999987


No 286
>PRK06762 hypothetical protein; Provisional
Probab=53.58  E-value=7.3  Score=27.52  Aligned_cols=15  Identities=40%  Similarity=0.607  Sum_probs=12.2

Q ss_pred             eEEeeccCCCCCcee
Q psy12524         47 CIFAYGQTGSGKSYT   61 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t   61 (151)
                      .+...|.+|||||..
T Consensus         4 li~i~G~~GsGKST~   18 (166)
T PRK06762          4 LIIIRGNSGSGKTTI   18 (166)
T ss_pred             EEEEECCCCCCHHHH
Confidence            466789999999873


No 287
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=53.23  E-value=5  Score=30.83  Aligned_cols=15  Identities=40%  Similarity=0.605  Sum_probs=12.7

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      +...|++|||||..|
T Consensus        34 vaI~GpSGSGKSTLL   48 (226)
T COG1136          34 VAIVGPSGSGKSTLL   48 (226)
T ss_pred             EEEECCCCCCHHHHH
Confidence            466799999999877


No 288
>TIGR01817 nifA Nif-specific regulatory protein. This model represents NifA, a DNA-binding regulatory protein for nitrogen fixation. The model produces scores between the trusted and noise cutoffs for a well-described NifA homolog in Aquifex aeolicus (which lacks nitrogenase), for transcriptional activators of alternative nitrogenases (VFe or FeFe instead of MoFe), and truncated forms.
Probab=53.23  E-value=9.1  Score=32.77  Aligned_cols=20  Identities=25%  Similarity=0.504  Sum_probs=17.2

Q ss_pred             CCCeeEEeeccCCCCCceee
Q psy12524         43 GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+..|+..|.+||||+...
T Consensus       217 ~~~~pvli~Ge~GtGK~~lA  236 (534)
T TIGR01817       217 RSNSTVLLRGESGTGKELIA  236 (534)
T ss_pred             CcCCCEEEECCCCccHHHHH
Confidence            56778999999999998776


No 289
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=53.17  E-value=5.7  Score=35.46  Aligned_cols=17  Identities=29%  Similarity=0.651  Sum_probs=14.9

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.||++|+|||+.+
T Consensus       213 ~giLL~GppGtGKT~la  229 (733)
T TIGR01243       213 KGVLLYGPPGTGKTLLA  229 (733)
T ss_pred             ceEEEECCCCCChHHHH
Confidence            46899999999999876


No 290
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=53.16  E-value=4.7  Score=26.62  Aligned_cols=15  Identities=27%  Similarity=0.406  Sum_probs=12.7

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |...|.+|+|||..+
T Consensus         2 V~iiG~~~~GKSTli   16 (116)
T PF01926_consen    2 VAIIGRPNVGKSTLI   16 (116)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999999876


No 291
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional
Probab=53.16  E-value=13  Score=31.71  Aligned_cols=24  Identities=29%  Similarity=0.468  Sum_probs=17.6

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCcee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYT   61 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t   61 (151)
                      .+..++.|.+.  ++..+||||||..
T Consensus       151 aip~il~g~dv--iv~ApTGSGKTla  174 (518)
T PLN00206        151 AIPAALSGRSL--LVSADTGSGKTAS  174 (518)
T ss_pred             HHHHHhcCCCE--EEEecCCCCccHH
Confidence            34556778764  6677999999964


No 292
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional
Probab=52.89  E-value=11  Score=33.14  Aligned_cols=25  Identities=28%  Similarity=0.559  Sum_probs=18.7

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+..++.|.+  +++.++||||||...
T Consensus        36 ai~~ll~g~d--vl~~ApTGsGKT~af   60 (629)
T PRK11634         36 CIPHLLNGRD--VLGMAQTGSGKTAAF   60 (629)
T ss_pred             HHHHHHcCCC--EEEEcCCCCcHHHHH
Confidence            4455667765  678889999999764


No 293
>KOG0744|consensus
Probab=52.69  E-value=5.8  Score=32.55  Aligned_cols=20  Identities=30%  Similarity=0.421  Sum_probs=16.3

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      |-.++..|++|+|||..+.+
T Consensus       177 NRliLlhGPPGTGKTSLCKa  196 (423)
T KOG0744|consen  177 NRLILLHGPPGTGKTSLCKA  196 (423)
T ss_pred             eeEEEEeCCCCCChhHHHHH
Confidence            44568889999999998855


No 294
>KOG0727|consensus
Probab=52.56  E-value=7  Score=31.11  Aligned_cols=64  Identities=22%  Similarity=0.413  Sum_probs=40.7

Q ss_pred             CCCHHHHHHHHhHHHHHHhhc---CCC--eeEEeeccCCCCCceeec--------------cCC---CCCCcHHHHHHHH
Q psy12524         22 FASQEKVFDALGRDILDNAFQ---GYN--ACIFAYGQTGSGKSYTMM--------------GSQ---DNKGIIPRLCDSL   79 (151)
Q Consensus        22 ~~~q~~vy~~~~~~lv~~~~~---G~~--~~v~~yG~~~sGKt~t~~--------------G~~---~~~Gli~~~~~~l   79 (151)
                      +.--++|-+.+-.|+.+.=+-   |.+  --|+.||+.|+|||-...              |+.   ...|-=||.++++
T Consensus       161 d~qkqeireavelplt~~~ly~qigidpprgvllygppg~gktml~kava~~t~a~firvvgsefvqkylgegprmvrdv  240 (408)
T KOG0727|consen  161 DVQKQEIREAVELPLTHADLYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDV  240 (408)
T ss_pred             hhhHHHHHHHHhccchHHHHHHHhCCCCCcceEEeCCCCCcHHHHHHHHhhccchheeeeccHHHHHHHhccCcHHHHHH
Confidence            344456666666677765331   443  368999999999985542              221   1245668999999


Q ss_pred             HHHHHh
Q psy12524         80 FDLIAK   85 (151)
Q Consensus        80 f~~~~~   85 (151)
                      |+...+
T Consensus       241 frlake  246 (408)
T KOG0727|consen  241 FRLAKE  246 (408)
T ss_pred             HHHHhc
Confidence            987653


No 295
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1. This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis.
Probab=52.56  E-value=11  Score=30.22  Aligned_cols=28  Identities=21%  Similarity=0.310  Sum_probs=21.1

Q ss_pred             HHHHHhhcC-C--CeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQG-Y--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G-~--~~~v~~yG~~~sGKt~t~   62 (151)
                      +-++.++.| .  ......||.+|||||..+
T Consensus        83 ~~LD~lLgGGi~~G~iteI~G~~GsGKTql~  113 (313)
T TIGR02238        83 QALDGILGGGIESMSITEVFGEFRCGKTQLS  113 (313)
T ss_pred             HHHHHHhCCCCcCCeEEEEECCCCCCcCHHH
Confidence            556777764 4  345678999999999876


No 296
>PRK08233 hypothetical protein; Provisional
Probab=52.49  E-value=7.1  Score=27.76  Aligned_cols=16  Identities=25%  Similarity=0.266  Sum_probs=12.1

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .|..-|.+|||||...
T Consensus         5 iI~I~G~~GsGKtTla   20 (182)
T PRK08233          5 IITIAAVSGGGKTTLT   20 (182)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3455699999998754


No 297
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=52.28  E-value=5.8  Score=29.50  Aligned_cols=16  Identities=31%  Similarity=0.559  Sum_probs=14.3

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      ++...|.+|+|||..+
T Consensus        24 ~~~i~G~NGsGKTTLl   39 (204)
T cd03240          24 LTLIVGQNGAGKTTII   39 (204)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            6778899999999887


No 298
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family. This model represents a rather narrowly distributed archaeal protein family in which members have a single copy of the KaiC domain. This stands in contrast to the circadian clock protein KaiC itself, with two copies of the domain. Members are expected to have weak ATPase activity, by homology to the autokinase/autophosphorylase KaiC itself.
Probab=52.23  E-value=13  Score=27.79  Aligned_cols=26  Identities=31%  Similarity=0.578  Sum_probs=18.7

Q ss_pred             HHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         37 LDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        37 v~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      ++.++. |.  ...++..|.+|+|||...
T Consensus         5 LD~~l~gGi~~g~~~li~G~~G~GKt~~~   33 (224)
T TIGR03880         5 LDEMLGGGFPEGHVIVVIGEYGTGKTTFS   33 (224)
T ss_pred             hHHHhcCCCCCCeEEEEECCCCCCHHHHH
Confidence            455554 43  556778999999998765


No 299
>PRK13531 regulatory ATPase RavA; Provisional
Probab=52.03  E-value=12  Score=32.07  Aligned_cols=18  Identities=28%  Similarity=0.469  Sum_probs=14.9

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      +..++.+|.+|+|||+..
T Consensus        39 g~hVLL~GpPGTGKT~LA   56 (498)
T PRK13531         39 GESVFLLGPPGIAKSLIA   56 (498)
T ss_pred             CCCEEEECCCChhHHHHH
Confidence            345689999999999877


No 300
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=51.97  E-value=5.5  Score=32.63  Aligned_cols=15  Identities=27%  Similarity=0.561  Sum_probs=12.5

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      +...|++|||||.++
T Consensus        34 ~~lLGPSGcGKTTlL   48 (352)
T COG3842          34 VTLLGPSGCGKTTLL   48 (352)
T ss_pred             EEEECCCCCCHHHHH
Confidence            345699999999988


No 301
>TIGR00580 mfd transcription-repair coupling factor (mfd). All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transacribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). This family is closely related to the RecG and UvrB families.
Probab=51.94  E-value=15  Score=33.95  Aligned_cols=32  Identities=16%  Similarity=0.071  Sum_probs=21.8

Q ss_pred             HHhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         31 ALGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        31 ~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .++..+.++.-.+....++..|.||||||...
T Consensus       458 ~aI~~I~~d~~~~~~~d~Ll~adTGsGKT~va  489 (926)
T TIGR00580       458 KAIEEIKADMESPRPMDRLVCGDVGFGKTEVA  489 (926)
T ss_pred             HHHHHHHhhhcccCcCCEEEECCCCccHHHHH
Confidence            34444445544555556789999999999754


No 302
>PRK04040 adenylate kinase; Provisional
Probab=51.76  E-value=6.8  Score=28.89  Aligned_cols=16  Identities=25%  Similarity=0.509  Sum_probs=13.9

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++.+|.+|||||..+
T Consensus         4 ~i~v~G~pG~GKtt~~   19 (188)
T PRK04040          4 VVVVTGVPGVGKTTVL   19 (188)
T ss_pred             EEEEEeCCCCCHHHHH
Confidence            4778999999999877


No 303
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=51.59  E-value=8  Score=28.63  Aligned_cols=17  Identities=29%  Similarity=0.563  Sum_probs=13.0

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      -+|+..|+.|||||..+
T Consensus         4 ~~vlL~Gps~SGKTaLf   20 (181)
T PF09439_consen    4 PTVLLVGPSGSGKTALF   20 (181)
T ss_dssp             -EEEEE-STTSSHHHHH
T ss_pred             ceEEEEcCCCCCHHHHH
Confidence            46888999999999765


No 304
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=51.57  E-value=14  Score=27.49  Aligned_cols=27  Identities=26%  Similarity=0.417  Sum_probs=19.6

Q ss_pred             HHHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      -++.++. |.  ..+++.+|.+|+|||...
T Consensus         8 ~LD~~l~GGi~~G~~~~i~G~~G~GKT~l~   37 (229)
T TIGR03881         8 GLDKLLEGGIPRGFFVAVTGEPGTGKTIFC   37 (229)
T ss_pred             hHHHhhcCCCcCCeEEEEECCCCCChHHHH
Confidence            3455553 43  567888999999998865


No 305
>PRK00300 gmk guanylate kinase; Provisional
Probab=51.54  E-value=8.7  Score=28.10  Aligned_cols=17  Identities=35%  Similarity=0.477  Sum_probs=13.7

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...|++|||||..+
T Consensus         6 ~~i~i~G~sGsGKstl~   22 (205)
T PRK00300          6 LLIVLSGPSGAGKSTLV   22 (205)
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            45778899999999754


No 306
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=51.48  E-value=8.8  Score=31.26  Aligned_cols=20  Identities=30%  Similarity=0.365  Sum_probs=16.9

Q ss_pred             CCCeeEEeeccCCCCCceee
Q psy12524         43 GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +....++..|.+|+|||.|+
T Consensus       137 ~~p~Vil~vGVNG~GKTTTI  156 (340)
T COG0552         137 KKPFVILFVGVNGVGKTTTI  156 (340)
T ss_pred             CCcEEEEEEecCCCchHhHH
Confidence            44567788899999999998


No 307
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=51.44  E-value=5.4  Score=31.96  Aligned_cols=17  Identities=35%  Similarity=0.493  Sum_probs=14.9

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      -+++..|.|+||||..|
T Consensus       144 ~siii~G~t~sGKTt~l  160 (312)
T COG0630         144 KSIIICGGTASGKTTLL  160 (312)
T ss_pred             CcEEEECCCCCCHHHHH
Confidence            35788999999999988


No 308
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=51.44  E-value=11  Score=30.12  Aligned_cols=28  Identities=32%  Similarity=0.451  Sum_probs=20.5

Q ss_pred             HHHHHhhcC-C--CeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQG-Y--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G-~--~~~v~~yG~~~sGKt~t~   62 (151)
                      +-++.++.| .  ...+..+|.+|+|||..+
T Consensus        89 ~~lD~~l~GGi~~g~vtei~G~~GsGKT~l~  119 (317)
T PRK04301         89 KELDELLGGGIETQSITEFYGEFGSGKTQIC  119 (317)
T ss_pred             HHHHHHhcCCccCCcEEEEECCCCCCHhHHH
Confidence            445666663 3  456778999999999876


No 309
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=51.23  E-value=5.8  Score=26.90  Aligned_cols=16  Identities=38%  Similarity=0.524  Sum_probs=13.4

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|||||..+
T Consensus        13 ~~~i~G~nGsGKStLl   28 (137)
T PF00005_consen   13 IVAIVGPNGSGKSTLL   28 (137)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             EEEEEccCCCccccce
Confidence            4567899999999877


No 310
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional
Probab=51.14  E-value=12  Score=31.50  Aligned_cols=26  Identities=31%  Similarity=0.551  Sum_probs=18.9

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+..+++|.+.  +...+||||||...
T Consensus       116 ~ai~~~~~G~dv--i~~apTGSGKTlay  141 (475)
T PRK01297        116 QVLGYTLAGHDA--IGRAQTGTGKTAAF  141 (475)
T ss_pred             HHHHHHhCCCCE--EEECCCCChHHHHH
Confidence            455667889876  44569999999554


No 311
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family. Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.
Probab=51.12  E-value=9.2  Score=29.03  Aligned_cols=27  Identities=26%  Similarity=0.442  Sum_probs=19.5

Q ss_pred             HHHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      -++.++. |.  ..+++.+|.+|||||-..
T Consensus         9 ~LD~~l~GG~~~gs~~lI~G~pGsGKT~la   38 (237)
T TIGR03877         9 GMDEILHGGIPERNVVLLSGGPGTGKSIFS   38 (237)
T ss_pred             hHHHHhcCCCcCCeEEEEEcCCCCCHHHHH
Confidence            3455554 44  567889999999998744


No 312
>PF02367 UPF0079:  Uncharacterised P-loop hydrolase UPF0079;  InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop. They are probably essential to bacteria as members are found in all genomes so far sequenced and no equivalent genes have been found in the archaea and eukaryotes, suggesting the protein may be involved in cell wall biosynthesis. The sequence of YjeE, from Haemophilus influenzae, has been determined to 1.7-A resolution. The protein has a nucleotide-binding fold with a four-stranded parallel beta-sheet flanked by antiparallel beta-strands on each side. The topology of the beta-sheet is unique among P-loop proteins and has features of different families of enzymes. ADP has been shown to bind to the P-loop in the presence of Mg2+ and ATPase activity has been confirmed by kinetic measurements [].; PDB: 1HTW_A 1FL9_A.
Probab=50.69  E-value=5.3  Score=27.66  Aligned_cols=18  Identities=28%  Similarity=0.438  Sum_probs=15.6

Q ss_pred             eeEEeeccCCCCCceeec
Q psy12524         46 ACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~   63 (151)
                      ..|+.+|.-|+|||....
T Consensus        16 ~vi~L~GdLGaGKTtf~r   33 (123)
T PF02367_consen   16 DVILLSGDLGAGKTTFVR   33 (123)
T ss_dssp             EEEEEEESTTSSHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            568899999999999883


No 313
>PF01443 Viral_helicase1:  Viral (Superfamily 1) RNA helicase;  InterPro: IPR000606 This entry includes RNA and DNA helicases. Some of the members are found in positive-strand single stranded RNA viruses. The helicase has multiple roles at different stages of viral RNA replication, as dissected by mutational analysis [].; GO: 0004386 helicase activity
Probab=50.65  E-value=4.7  Score=29.98  Aligned_cols=15  Identities=40%  Similarity=0.488  Sum_probs=12.7

Q ss_pred             EeeccCCCCCceeec
Q psy12524         49 FAYGQTGSGKSYTMM   63 (151)
Q Consensus        49 ~~yG~~~sGKt~t~~   63 (151)
                      +..|..|||||+.+.
T Consensus         2 vv~G~pGsGKSt~i~   16 (234)
T PF01443_consen    2 VVHGVPGSGKSTLIK   16 (234)
T ss_pred             EEEcCCCCCHHHHHH
Confidence            567999999999883


No 314
>PRK13700 conjugal transfer protein TraD; Provisional
Probab=50.55  E-value=7.8  Score=34.77  Aligned_cols=16  Identities=31%  Similarity=0.441  Sum_probs=13.6

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      -++..|.+|||||..|
T Consensus       187 H~li~GttGSGKS~~i  202 (732)
T PRK13700        187 NFCLHGTVGAGKSEVI  202 (732)
T ss_pred             ceEEeCCCCCCHHHHH
Confidence            3578899999999876


No 315
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional
Probab=50.37  E-value=8.6  Score=30.77  Aligned_cols=16  Identities=38%  Similarity=0.719  Sum_probs=13.7

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|+|+||||...
T Consensus         6 ii~I~GpTasGKS~LA   21 (300)
T PRK14729          6 IVFIFGPTAVGKSNIL   21 (300)
T ss_pred             EEEEECCCccCHHHHH
Confidence            5788899999999855


No 316
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=50.35  E-value=21  Score=30.10  Aligned_cols=17  Identities=41%  Similarity=0.556  Sum_probs=15.0

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...|++|+|||.++
T Consensus       242 ~vI~LVGptGvGKTTTi  258 (436)
T PRK11889        242 QTIALIGPTGVGKTTTL  258 (436)
T ss_pred             cEEEEECCCCCcHHHHH
Confidence            46778899999999998


No 317
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=50.29  E-value=8.2  Score=26.79  Aligned_cols=15  Identities=40%  Similarity=0.581  Sum_probs=11.9

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..|++|||||..+
T Consensus         2 i~i~GpsGsGKstl~   16 (137)
T cd00071           2 IVLSGPSGVGKSTLL   16 (137)
T ss_pred             EEEECCCCCCHHHHH
Confidence            456799999999754


No 318
>PHA02774 E1; Provisional
Probab=50.24  E-value=14  Score=32.41  Aligned_cols=27  Identities=30%  Similarity=0.618  Sum_probs=20.1

Q ss_pred             HHHHhhcCCC--eeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYN--ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~--~~v~~yG~~~sGKt~t~   62 (151)
                      .+..++.|..  .|++.||+.++|||+..
T Consensus       423 ~lk~~l~~~PKknciv~~GPP~TGKS~fa  451 (613)
T PHA02774        423 ALKDFLKGIPKKNCLVIYGPPDTGKSMFC  451 (613)
T ss_pred             HHHHHHhcCCcccEEEEECCCCCCHHHHH
Confidence            3445555543  48899999999999876


No 319
>PRK14527 adenylate kinase; Provisional
Probab=50.24  E-value=9.1  Score=27.89  Aligned_cols=18  Identities=28%  Similarity=0.501  Sum_probs=14.7

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...++..|.+|||||...
T Consensus         6 ~~~i~i~G~pGsGKsT~a   23 (191)
T PRK14527          6 NKVVIFLGPPGAGKGTQA   23 (191)
T ss_pred             CcEEEEECCCCCCHHHHH
Confidence            346889999999998755


No 320
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=50.23  E-value=19  Score=32.63  Aligned_cols=17  Identities=29%  Similarity=0.425  Sum_probs=14.8

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ++++.+|++|+|||++.
T Consensus       489 ~~~Lf~GP~GvGKT~lA  505 (758)
T PRK11034        489 GSFLFAGPTGVGKTEVT  505 (758)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            57899999999999765


No 321
>PRK05580 primosome assembly protein PriA; Validated
Probab=50.18  E-value=12  Score=33.23  Aligned_cols=17  Identities=35%  Similarity=0.428  Sum_probs=14.4

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.+|.||||||...
T Consensus       163 ~~~Ll~~~TGSGKT~v~  179 (679)
T PRK05580        163 SPFLLDGVTGSGKTEVY  179 (679)
T ss_pred             CcEEEECCCCChHHHHH
Confidence            34789999999999766


No 322
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=50.10  E-value=5.9  Score=27.08  Aligned_cols=15  Identities=33%  Similarity=0.390  Sum_probs=12.6

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |...|.+|+|||..+
T Consensus         2 i~l~G~~g~GKTtL~   16 (170)
T cd01876           2 IAFAGRSNVGKSSLI   16 (170)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            467899999999877


No 323
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family. This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
Probab=50.03  E-value=9.3  Score=29.57  Aligned_cols=18  Identities=28%  Similarity=0.355  Sum_probs=14.8

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+++.+|.+|+|||...
T Consensus        36 gs~~lI~G~pGtGKT~l~   53 (259)
T TIGR03878        36 YSVINITGVSDTGKSLMV   53 (259)
T ss_pred             CcEEEEEcCCCCCHHHHH
Confidence            456788999999998754


No 324
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional
Probab=50.00  E-value=11  Score=30.70  Aligned_cols=29  Identities=28%  Similarity=0.378  Sum_probs=21.1

Q ss_pred             HHHHHHhhcC-C--CeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQG-Y--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G-~--~~~v~~yG~~~sGKt~t~   62 (151)
                      .+-++.++.| .  ......||.+|||||..+
T Consensus       112 ~~~LD~lLgGGi~~G~ItEI~G~~GsGKTql~  143 (344)
T PLN03187        112 SQALDELLGGGIETRCITEAFGEFRSGKTQLA  143 (344)
T ss_pred             cHhHHhhcCCCCCCCeEEEEecCCCCChhHHH
Confidence            3556777763 3  345568999999999866


No 325
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=49.99  E-value=9.4  Score=29.32  Aligned_cols=26  Identities=27%  Similarity=0.524  Sum_probs=19.0

Q ss_pred             HHHhhcC---CCeeEEeeccCCCCCceee
Q psy12524         37 LDNAFQG---YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        37 v~~~~~G---~~~~v~~yG~~~sGKt~t~   62 (151)
                      ++.++.|   ....++.+|.+|||||-..
T Consensus        12 lD~~l~GG~p~g~~~lI~G~pGsGKT~f~   40 (260)
T COG0467          12 LDEILGGGLPRGSVVLITGPPGTGKTIFA   40 (260)
T ss_pred             hHHHhcCCCcCCcEEEEEcCCCCcHHHHH
Confidence            4555553   3567899999999998655


No 326
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional
Probab=49.99  E-value=13  Score=32.23  Aligned_cols=25  Identities=32%  Similarity=0.486  Sum_probs=18.7

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+..+++|.+  +++..+||||||...
T Consensus        39 ~ip~~l~G~D--vi~~ApTGSGKTlaf   63 (572)
T PRK04537         39 TLPVALPGGD--VAGQAQTGTGKTLAF   63 (572)
T ss_pred             HHHHHhCCCC--EEEEcCCCCcHHHHH
Confidence            3455778887  466779999999653


No 327
>KOG0745|consensus
Probab=49.83  E-value=8.2  Score=32.86  Aligned_cols=17  Identities=35%  Similarity=0.593  Sum_probs=14.3

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..|+..|+||||||...
T Consensus       227 SNvLllGPtGsGKTlla  243 (564)
T KOG0745|consen  227 SNVLLLGPTGSGKTLLA  243 (564)
T ss_pred             ccEEEECCCCCchhHHH
Confidence            45789999999998765


No 328
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=49.74  E-value=8  Score=32.31  Aligned_cols=17  Identities=41%  Similarity=0.597  Sum_probs=14.9

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.+|++|+|||...
T Consensus       109 ~~iLl~Gp~GtGKT~lA  125 (412)
T PRK05342        109 SNILLIGPTGSGKTLLA  125 (412)
T ss_pred             ceEEEEcCCCCCHHHHH
Confidence            56899999999999766


No 329
>KOG0742|consensus
Probab=49.63  E-value=8.4  Score=32.69  Aligned_cols=14  Identities=43%  Similarity=0.842  Sum_probs=12.4

Q ss_pred             eEEeeccCCCCCce
Q psy12524         47 CIFAYGQTGSGKSY   60 (151)
Q Consensus        47 ~v~~yG~~~sGKt~   60 (151)
                      .++.||+.|+|||-
T Consensus       386 NilfyGPPGTGKTm  399 (630)
T KOG0742|consen  386 NILFYGPPGTGKTM  399 (630)
T ss_pred             heeeeCCCCCCchH
Confidence            67999999999974


No 330
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated
Probab=49.62  E-value=6.9  Score=29.26  Aligned_cols=20  Identities=25%  Similarity=0.414  Sum_probs=17.3

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ...|..|+.+|.|||+..+|
T Consensus        22 ~g~v~v~~g~GkGKtt~a~g   41 (191)
T PRK05986         22 KGLLIVHTGNGKGKSTAAFG   41 (191)
T ss_pred             CCeEEEECCCCCChHHHHHH
Confidence            46889999999999999854


No 331
>COG3596 Predicted GTPase [General function prediction only]
Probab=49.57  E-value=13  Score=29.66  Aligned_cols=24  Identities=25%  Similarity=0.337  Sum_probs=19.9

Q ss_pred             HhhcCCCeeEEeeccCCCCCceee
Q psy12524         39 NAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        39 ~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.+-....++..|.||+||+.++
T Consensus        33 ~l~~~~pvnvLi~G~TG~GKSSli   56 (296)
T COG3596          33 QLTEKEPVNVLLMGATGAGKSSLI   56 (296)
T ss_pred             hhcccCceeEEEecCCCCcHHHHH
Confidence            345667788899999999999887


No 332
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=49.52  E-value=14  Score=31.49  Aligned_cols=28  Identities=21%  Similarity=0.381  Sum_probs=21.2

Q ss_pred             HHHHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      +-++.++. |+  ...++.+|.+|+|||-..
T Consensus        18 ~~LD~~l~GG~p~Gs~~li~G~pGsGKT~l~   48 (509)
T PRK09302         18 EGFDDITHGGLPKGRPTLVSGTAGTGKTLFA   48 (509)
T ss_pred             hhHHHhhcCCCCCCcEEEEEeCCCCCHHHHH
Confidence            45567775 43  567899999999998755


No 333
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=49.47  E-value=6.8  Score=33.49  Aligned_cols=17  Identities=35%  Similarity=0.464  Sum_probs=14.6

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...|.+|+|||.|+
T Consensus       257 ~Vi~LvGpnGvGKTTTi  273 (484)
T PRK06995        257 GVFALMGPTGVGKTTTT  273 (484)
T ss_pred             cEEEEECCCCccHHHHH
Confidence            45677799999999998


No 334
>PRK03839 putative kinase; Provisional
Probab=49.44  E-value=8.4  Score=27.68  Aligned_cols=15  Identities=33%  Similarity=0.430  Sum_probs=12.5

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|..|||||...
T Consensus         3 I~l~G~pGsGKsT~~   17 (180)
T PRK03839          3 IAITGTPGVGKTTVS   17 (180)
T ss_pred             EEEECCCCCCHHHHH
Confidence            677899999998654


No 335
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=49.43  E-value=6.7  Score=32.83  Aligned_cols=17  Identities=41%  Similarity=0.597  Sum_probs=15.2

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.+|++|+|||...
T Consensus       117 ~~iLL~GP~GsGKT~lA  133 (413)
T TIGR00382       117 SNILLIGPTGSGKTLLA  133 (413)
T ss_pred             ceEEEECCCCcCHHHHH
Confidence            57899999999999877


No 336
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional
Probab=49.21  E-value=14  Score=32.32  Aligned_cols=25  Identities=32%  Similarity=0.561  Sum_probs=18.1

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCcee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYT   61 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t   61 (151)
                      ..++.++.|.++  ++..+||+|||-+
T Consensus        32 ~ai~~il~g~dv--lv~apTGsGKTl~   56 (607)
T PRK11057         32 EIIDAVLSGRDC--LVVMPTGGGKSLC   56 (607)
T ss_pred             HHHHHHHcCCCE--EEEcCCCchHHHH
Confidence            345566788876  4456999999964


No 337
>CHL00095 clpC Clp protease ATP binding subunit
Probab=49.19  E-value=11  Score=34.32  Aligned_cols=20  Identities=25%  Similarity=0.361  Sum_probs=16.5

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..+++.+|.+|+|||..+.|
T Consensus       200 ~~n~lL~G~pGvGKTal~~~  219 (821)
T CHL00095        200 KNNPILIGEPGVGKTAIAEG  219 (821)
T ss_pred             cCCeEEECCCCCCHHHHHHH
Confidence            34678999999999998854


No 338
>TIGR01351 adk adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.
Probab=49.09  E-value=8.9  Score=28.44  Aligned_cols=15  Identities=33%  Similarity=0.547  Sum_probs=12.5

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|.+||||+...
T Consensus         2 I~i~G~pGsGKsT~a   16 (210)
T TIGR01351         2 LVLLGPPGSGKGTQA   16 (210)
T ss_pred             EEEECCCCCCHHHHH
Confidence            678999999997654


No 339
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=49.08  E-value=6.3  Score=28.81  Aligned_cols=15  Identities=40%  Similarity=0.454  Sum_probs=12.1

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      +..-|.+|||||.++
T Consensus         2 igi~G~~GsGKSTl~   16 (198)
T cd02023           2 IGIAGGSGSGKTTVA   16 (198)
T ss_pred             EEEECCCCCCHHHHH
Confidence            345699999999876


No 340
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=49.02  E-value=8.4  Score=27.09  Aligned_cols=15  Identities=47%  Similarity=0.636  Sum_probs=12.1

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..|.+|||||...
T Consensus         2 i~i~G~~GsGKSTla   16 (149)
T cd02027           2 IWLTGLSGSGKSTIA   16 (149)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            567799999998743


No 341
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=48.98  E-value=6.6  Score=28.75  Aligned_cols=15  Identities=40%  Similarity=0.443  Sum_probs=12.1

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |-..|.+|||||...
T Consensus         2 IgI~G~sgSGKTTla   16 (194)
T PF00485_consen    2 IGIAGPSGSGKTTLA   16 (194)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEECCCCCCHHHHH
Confidence            456799999998765


No 342
>PRK01172 ski2-like helicase; Provisional
Probab=48.81  E-value=14  Score=32.62  Aligned_cols=24  Identities=21%  Similarity=0.333  Sum_probs=17.2

Q ss_pred             HHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         37 LDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        37 v~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ++.+.+|.|  ++..++||||||...
T Consensus        31 i~~l~~~~n--vlv~apTGSGKTl~a   54 (674)
T PRK01172         31 IEQLRKGEN--VIVSVPTAAGKTLIA   54 (674)
T ss_pred             HHHHhcCCc--EEEECCCCchHHHHH
Confidence            344566665  577789999999753


No 343
>TIGR02655 circ_KaiC circadian clock protein KaiC. Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (Pfam model pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor.
Probab=48.79  E-value=14  Score=31.29  Aligned_cols=28  Identities=21%  Similarity=0.406  Sum_probs=20.6

Q ss_pred             HHHHHhhc-C--CCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQ-G--YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~-G--~~~~v~~yG~~~sGKt~t~   62 (151)
                      +-++.++. |  ...+++..|.+|||||-..
T Consensus         8 ~gLD~il~GGlp~g~~~Li~G~pGsGKT~la   38 (484)
T TIGR02655         8 EGFDDISHGGLPIGRSTLVSGTSGTGKTLFS   38 (484)
T ss_pred             hhHHHhcCCCCCCCeEEEEEcCCCCCHHHHH
Confidence            34566665 4  3678899999999998554


No 344
>PF13304 AAA_21:  AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A.
Probab=48.65  E-value=5.8  Score=28.78  Aligned_cols=14  Identities=43%  Similarity=0.646  Sum_probs=0.0

Q ss_pred             EeeccCCCCCceee
Q psy12524         49 FAYGQTGSGKSYTM   62 (151)
Q Consensus        49 ~~yG~~~sGKt~t~   62 (151)
                      +-+|.+|||||..+
T Consensus         3 viiG~N~sGKS~il   16 (303)
T PF13304_consen    3 VIIGPNGSGKSNIL   16 (303)
T ss_dssp             --------------
T ss_pred             cccccccccccccc
Confidence            35799999999988


No 345
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=48.53  E-value=9.7  Score=27.66  Aligned_cols=16  Identities=38%  Similarity=0.652  Sum_probs=13.3

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|++|||||..+
T Consensus         4 ~i~l~G~sGsGKsTl~   19 (186)
T PRK10078          4 LIWLMGPSGSGKDSLL   19 (186)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4667899999998766


No 346
>CHL00176 ftsH cell division protein; Validated
Probab=48.52  E-value=6.6  Score=34.69  Aligned_cols=17  Identities=24%  Similarity=0.477  Sum_probs=15.1

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.||++|+|||+..
T Consensus       217 ~gVLL~GPpGTGKT~LA  233 (638)
T CHL00176        217 KGVLLVGPPGTGKTLLA  233 (638)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            45899999999999887


No 347
>PRK14530 adenylate kinase; Provisional
Probab=48.46  E-value=8.9  Score=28.56  Aligned_cols=16  Identities=31%  Similarity=0.495  Sum_probs=13.2

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .|+..|.+|||||...
T Consensus         5 ~I~i~G~pGsGKsT~~   20 (215)
T PRK14530          5 RILLLGAPGAGKGTQS   20 (215)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4778999999998655


No 348
>KOG0743|consensus
Probab=48.44  E-value=5.8  Score=33.52  Aligned_cols=15  Identities=40%  Similarity=0.731  Sum_probs=13.2

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      -+.||++||||+..+
T Consensus       238 YLLYGPPGTGKSS~I  252 (457)
T KOG0743|consen  238 YLLYGPPGTGKSSFI  252 (457)
T ss_pred             ceeeCCCCCCHHHHH
Confidence            489999999999876


No 349
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=48.38  E-value=7.2  Score=34.84  Aligned_cols=39  Identities=15%  Similarity=0.292  Sum_probs=26.6

Q ss_pred             eeEEeeccCCCCCceeecc------C-----------CCCCCcHHHHHHHHHHHHH
Q psy12524         46 ACIFAYGQTGSGKSYTMMG------S-----------QDNKGIIPRLCDSLFDLIA   84 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~G------~-----------~~~~Gli~~~~~~lf~~~~   84 (151)
                      ..++.||++|+|||.....      .           ....|=-...++.+|....
T Consensus       488 ~giLL~GppGtGKT~lakalA~e~~~~fi~v~~~~l~~~~vGese~~i~~~f~~A~  543 (733)
T TIGR01243       488 KGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIFRKAR  543 (733)
T ss_pred             ceEEEECCCCCCHHHHHHHHHHhcCCCEEEEehHHHhhcccCcHHHHHHHHHHHHH
Confidence            3578899999999987622      0           0123555677888887665


No 350
>KOG2035|consensus
Probab=48.35  E-value=17  Score=29.21  Aligned_cols=36  Identities=19%  Similarity=0.405  Sum_probs=24.0

Q ss_pred             HHHHHHhHHHHHHhhc-CCCeeEEeeccCCCCCceee
Q psy12524         27 KVFDALGRDILDNAFQ-GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        27 ~vy~~~~~~lv~~~~~-G~~~~v~~yG~~~sGKt~t~   62 (151)
                      -.|..-..+.+.+... |----++.||++|+||-..+
T Consensus        15 l~~~~e~~~~Lksl~~~~d~PHll~yGPSGaGKKTri   51 (351)
T KOG2035|consen   15 LIYHEELANLLKSLSSTGDFPHLLVYGPSGAGKKTRI   51 (351)
T ss_pred             cccHHHHHHHHHHhcccCCCCeEEEECCCCCCchhhH
Confidence            3444555566666554 54456899999999996554


No 351
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=48.35  E-value=7.6  Score=29.13  Aligned_cols=16  Identities=38%  Similarity=0.459  Sum_probs=13.0

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|++|+|||.+|
T Consensus        27 i~~ivGpNGaGKSTll   42 (212)
T cd03274          27 FSAIVGPNGSGKSNVI   42 (212)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            3446699999999988


No 352
>TIGR00763 lon ATP-dependent protease La. This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock.
Probab=48.28  E-value=19  Score=32.45  Aligned_cols=17  Identities=24%  Similarity=0.307  Sum_probs=14.5

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.+|++|+|||...
T Consensus       348 ~~lll~GppG~GKT~lA  364 (775)
T TIGR00763       348 PILCLVGPPGVGKTSLG  364 (775)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            35788999999999876


No 353
>PRK06851 hypothetical protein; Provisional
Probab=48.25  E-value=9.9  Score=31.34  Aligned_cols=27  Identities=33%  Similarity=0.514  Sum_probs=21.6

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +.+.++.+.+-.++.-|.+|+|||.+|
T Consensus        21 ~~~~~~~~~~~~~il~G~pGtGKStl~   47 (367)
T PRK06851         21 LYDSIIDGANRIFILKGGPGTGKSTLM   47 (367)
T ss_pred             hhhhhccccceEEEEECCCCCCHHHHH
Confidence            334555677778899999999999988


No 354
>PF02463 SMC_N:  RecF/RecN/SMC N terminal domain;  InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []. The domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.; PDB: 3HTK_A 1W1W_C 2WD5_A 3L51_A 1XEW_Y 3KTA_B 3NWC_B 1XEX_A 1GXL_C 1GXK_A ....
Probab=48.19  E-value=9.5  Score=28.27  Aligned_cols=16  Identities=38%  Similarity=0.468  Sum_probs=13.5

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      ..+.+|++|+|||-.+
T Consensus        26 ~~~i~G~NGsGKS~il   41 (220)
T PF02463_consen   26 LNVIVGPNGSGKSNIL   41 (220)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             CEEEEcCCCCCHHHHH
Confidence            5578899999999776


No 355
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=48.17  E-value=7.2  Score=28.87  Aligned_cols=16  Identities=38%  Similarity=0.366  Sum_probs=12.8

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|||||..+
T Consensus         8 vi~I~G~sGsGKSTl~   23 (207)
T TIGR00235         8 IIGIGGGSGSGKTTVA   23 (207)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4566799999999765


No 356
>PRK10865 protein disaggregation chaperone; Provisional
Probab=48.08  E-value=12  Score=34.26  Aligned_cols=31  Identities=19%  Similarity=0.250  Sum_probs=21.2

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..+++-+.......++.+|.+|+|||..+.|
T Consensus       188 ~~~i~iL~r~~~~n~lL~G~pGvGKT~l~~~  218 (857)
T PRK10865        188 RRTIQVLQRRTKNNPVLIGEPGVGKTAIVEG  218 (857)
T ss_pred             HHHHHHHhcCCcCceEEECCCCCCHHHHHHH
Confidence            4444333344444677899999999999855


No 357
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=48.04  E-value=13  Score=26.67  Aligned_cols=28  Identities=21%  Similarity=0.144  Sum_probs=22.0

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +.++......-..|...|.+|+|||..+
T Consensus        14 ~~~~~~~~~~~~~v~ivG~~~~GKSsli   41 (196)
T PRK00454         14 PKLEQLPPDDGPEIAFAGRSNVGKSSLI   41 (196)
T ss_pred             ccHhhCCCCCCCEEEEEcCCCCCHHHHH
Confidence            4566666666667899999999999877


No 358
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=48.01  E-value=9.9  Score=27.86  Aligned_cols=15  Identities=40%  Similarity=0.612  Sum_probs=12.2

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|++||||+.-.
T Consensus         3 iiilG~pGaGK~T~A   17 (178)
T COG0563           3 ILILGPPGAGKSTLA   17 (178)
T ss_pred             EEEECCCCCCHHHHH
Confidence            678899999997544


No 359
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=47.97  E-value=6.9  Score=31.87  Aligned_cols=15  Identities=33%  Similarity=0.627  Sum_probs=13.0

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      +...|++|||||.++
T Consensus        32 ~vllGPSGcGKSTlL   46 (338)
T COG3839          32 VVLLGPSGCGKSTLL   46 (338)
T ss_pred             EEEECCCCCCHHHHH
Confidence            456799999999988


No 360
>KOG0738|consensus
Probab=47.70  E-value=18  Score=30.40  Aligned_cols=57  Identities=23%  Similarity=0.361  Sum_probs=37.1

Q ss_pred             HHhHHHH-HHhhcCCCe---eEEeeccCCCCCceee------ccC-----------CCCCCcHHHHHHHHHHHHHhhc
Q psy12524         31 ALGRDIL-DNAFQGYNA---CIFAYGQTGSGKSYTM------MGS-----------QDNKGIIPRLCDSLFDLIAKQE   87 (151)
Q Consensus        31 ~~~~~lv-~~~~~G~~~---~v~~yG~~~sGKt~t~------~G~-----------~~~~Gli~~~~~~lf~~~~~~~   87 (151)
                      .++.|+. ..+|.|.-.   .|+..|+.|||||-..      .|.           ..-+|=-...++-||.+.....
T Consensus       227 AVvlPi~mPe~F~GirrPWkgvLm~GPPGTGKTlLAKAvATEc~tTFFNVSsstltSKwRGeSEKlvRlLFemARfyA  304 (491)
T KOG0738|consen  227 AVVLPIWMPEFFKGIRRPWKGVLMVGPPGTGKTLLAKAVATECGTTFFNVSSSTLTSKWRGESEKLVRLLFEMARFYA  304 (491)
T ss_pred             HHhhhhhhHHHHhhcccccceeeeeCCCCCcHHHHHHHHHHhhcCeEEEechhhhhhhhccchHHHHHHHHHHHHHhC
Confidence            4445554 557777643   6889999999998544      221           1126777788888887765443


No 361
>KOG0741|consensus
Probab=47.62  E-value=10  Score=33.11  Aligned_cols=16  Identities=38%  Similarity=0.733  Sum_probs=14.1

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      -++.||+.|+|||-..
T Consensus       258 GiLLyGPPGTGKTLiA  273 (744)
T KOG0741|consen  258 GILLYGPPGTGKTLIA  273 (744)
T ss_pred             eEEEECCCCCChhHHH
Confidence            4899999999999765


No 362
>KOG1547|consensus
Probab=47.60  E-value=25  Score=27.76  Aligned_cols=33  Identities=27%  Similarity=0.503  Sum_probs=24.2

Q ss_pred             HHHhHHHHHHhh-cCCCeeEEeeccCCCCCceee
Q psy12524         30 DALGRDILDNAF-QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        30 ~~~~~~lv~~~~-~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +.++..+=...+ .|+.-.+++-|++|.||+..+
T Consensus        30 dtI~~Qm~~k~mk~GF~FNIMVVgqSglgkstli   63 (336)
T KOG1547|consen   30 DTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLI   63 (336)
T ss_pred             HHHHHHHHHHHHhccCceEEEEEecCCCCchhhH
Confidence            344444444444 599999999999999998655


No 363
>PRK10246 exonuclease subunit SbcC; Provisional
Probab=47.59  E-value=23  Score=33.17  Aligned_cols=18  Identities=33%  Similarity=0.488  Sum_probs=14.2

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+.-.|.||+|||..+
T Consensus        30 ~~l~~I~G~tGaGKStil   47 (1047)
T PRK10246         30 NGLFAITGPTGAGKTTLL   47 (1047)
T ss_pred             CCEEEEECCCCCCHHHHH
Confidence            445677899999998765


No 364
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=47.54  E-value=21  Score=32.52  Aligned_cols=27  Identities=22%  Similarity=0.255  Sum_probs=19.6

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+++.+.++.  .++..|.||||||..+
T Consensus        11 ~~i~~~l~~~~--~vvv~A~TGSGKTt~~   37 (812)
T PRK11664         11 PELLTALKTAP--QVLLKAPTGAGKSTWL   37 (812)
T ss_pred             HHHHHHHHhCC--CEEEEcCCCCCHHHHH
Confidence            55665654443  4678999999999776


No 365
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=47.50  E-value=24  Score=29.75  Aligned_cols=17  Identities=41%  Similarity=0.733  Sum_probs=14.4

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++..|.+|+|||.++
T Consensus       224 ~vi~lvGptGvGKTTta  240 (432)
T PRK12724        224 KVVFFVGPTGSGKTTSI  240 (432)
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            45677799999999988


No 366
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=47.47  E-value=5  Score=30.37  Aligned_cols=13  Identities=38%  Similarity=0.391  Sum_probs=11.0

Q ss_pred             eeccCCCCCceee
Q psy12524         50 AYGQTGSGKSYTM   62 (151)
Q Consensus        50 ~yG~~~sGKt~t~   62 (151)
                      .-|.+|||||.++
T Consensus         4 I~G~sGSGKTTla   16 (220)
T cd02025           4 IAGSVAVGKSTTA   16 (220)
T ss_pred             eeCCCCCCHHHHH
Confidence            3499999999887


No 367
>TIGR01389 recQ ATP-dependent DNA helicase RecQ. The ATP-dependent DNA helicase RecQ of E. coli is about 600 residues long. This model represents bacterial proteins with a high degree of similarity in domain architecture and in primary sequence to E. coli RecQ. The model excludes eukaryotic and archaeal proteins with RecQ-like regions, as well as more distantly related bacterial helicases related to RecQ.
Probab=47.44  E-value=17  Score=31.57  Aligned_cols=26  Identities=27%  Similarity=0.506  Sum_probs=19.0

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.+++|.++  ++.-+||+|||...
T Consensus        20 ~~i~~il~g~dv--lv~~PTG~GKTl~y   45 (591)
T TIGR01389        20 EIISHVLDGRDV--LVVMPTGGGKSLCY   45 (591)
T ss_pred             HHHHHHHcCCCE--EEEcCCCccHhHHH
Confidence            345566788875  55569999999864


No 368
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=47.30  E-value=7.6  Score=28.25  Aligned_cols=16  Identities=38%  Similarity=0.465  Sum_probs=13.5

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|||||..+
T Consensus         5 ~i~l~G~sGsGKSTl~   20 (176)
T PRK09825          5 SYILMGVSGSGKSLIG   20 (176)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4677899999999866


No 369
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=47.30  E-value=24  Score=32.32  Aligned_cols=37  Identities=24%  Similarity=0.464  Sum_probs=0.0

Q ss_pred             CHHHHHHHHhHHHHHHhhcCCC------eeEEeeccCCCCCcee
Q psy12524         24 SQEKVFDALGRDILDNAFQGYN------ACIFAYGQTGSGKSYT   61 (151)
Q Consensus        24 ~q~~vy~~~~~~lv~~~~~G~~------~~v~~yG~~~sGKt~t   61 (151)
                      .|++.-+.+ ...+..+..|.+      ++++..|++|+|||++
T Consensus       570 GQ~~Av~~v-~~~i~~~~~gl~~~~~p~~~~lf~Gp~GvGKT~l  612 (852)
T TIGR03345       570 GQDHALEAI-AERIRTARAGLEDPRKPLGVFLLVGPSGVGKTET  612 (852)
T ss_pred             ChHHHHHHH-HHHHHHHhcCCCCCCCCceEEEEECCCCCCHHHH


No 370
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=47.25  E-value=8.2  Score=28.73  Aligned_cols=17  Identities=35%  Similarity=0.581  Sum_probs=13.9

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...|++|||||..+
T Consensus        29 ~~~~i~G~NGsGKSTll   45 (213)
T cd03279          29 GLFLICGPTGAGKSTIL   45 (213)
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            35667899999999877


No 371
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=46.97  E-value=12  Score=34.10  Aligned_cols=32  Identities=19%  Similarity=0.194  Sum_probs=21.5

Q ss_pred             hHHHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         33 GRDILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        33 ~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      +..+++-+..+.-.+++.+|.+|+|||..+.|
T Consensus       182 i~~~~~~l~r~~~~n~lL~G~pGvGKT~l~~~  213 (852)
T TIGR03346       182 IRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEG  213 (852)
T ss_pred             HHHHHHHHhcCCCCceEEEcCCCCCHHHHHHH
Confidence            34444443344445567799999999998854


No 372
>PRK00279 adk adenylate kinase; Reviewed
Probab=46.89  E-value=10  Score=28.24  Aligned_cols=15  Identities=27%  Similarity=0.543  Sum_probs=12.7

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+.+|..|||||...
T Consensus         3 I~v~G~pGsGKsT~a   17 (215)
T PRK00279          3 LILLGPPGAGKGTQA   17 (215)
T ss_pred             EEEECCCCCCHHHHH
Confidence            788999999998653


No 373
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=46.66  E-value=8.8  Score=29.70  Aligned_cols=20  Identities=40%  Similarity=0.697  Sum_probs=16.9

Q ss_pred             CCCeeEEeeccCCCCCceee
Q psy12524         43 GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .....|+..|.+|+||+.++
T Consensus        29 ~~~~~IllvG~tGvGKSSli   48 (249)
T cd01853          29 DFSLTILVLGKTGVGKSSTI   48 (249)
T ss_pred             cCCeEEEEECCCCCcHHHHH
Confidence            35668899999999999886


No 374
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=46.61  E-value=22  Score=31.90  Aligned_cols=17  Identities=29%  Similarity=0.403  Sum_probs=14.4

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ++++.+|++|+|||++.
T Consensus       485 ~~~lf~Gp~GvGKT~lA  501 (731)
T TIGR02639       485 GSFLFTGPTGVGKTELA  501 (731)
T ss_pred             eeEEEECCCCccHHHHH
Confidence            46788999999999765


No 375
>KOG0340|consensus
Probab=46.57  E-value=13  Score=30.73  Aligned_cols=28  Identities=21%  Similarity=0.387  Sum_probs=22.6

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      .+|..+++|.+|  +....||||||.-+-.
T Consensus        36 ~cIpkILeGrdc--ig~AkTGsGKT~AFaL   63 (442)
T KOG0340|consen   36 ACIPKILEGRDC--IGCAKTGSGKTAAFAL   63 (442)
T ss_pred             hhhHHHhccccc--ccccccCCCcchhhhH
Confidence            456678999998  5677999999988855


No 376
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=46.50  E-value=7.4  Score=28.45  Aligned_cols=16  Identities=38%  Similarity=0.536  Sum_probs=13.4

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|++|+|||..+
T Consensus        23 ~~~l~G~nG~GKSTLl   38 (176)
T cd03238          23 LVVVTGVSGSGKSTLV   38 (176)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3466799999999888


No 377
>PRK05480 uridine/cytidine kinase; Provisional
Probab=46.36  E-value=9.7  Score=28.10  Aligned_cols=18  Identities=33%  Similarity=0.327  Sum_probs=13.9

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...|..-|.+|||||...
T Consensus         6 ~~iI~I~G~sGsGKTTl~   23 (209)
T PRK05480          6 PIIIGIAGGSGSGKTTVA   23 (209)
T ss_pred             CEEEEEECCCCCCHHHHH
Confidence            345667799999999766


No 378
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=46.35  E-value=7.4  Score=26.78  Aligned_cols=15  Identities=40%  Similarity=0.651  Sum_probs=13.3

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|..++|||..+
T Consensus         3 v~v~G~~~~GKTtli   17 (164)
T smart00175        3 IILIGDSGVGKSSLL   17 (164)
T ss_pred             EEEECCCCCCHHHHH
Confidence            678899999999877


No 379
>TIGR02173 cyt_kin_arch cytidylate kinase, putative. Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.
Probab=46.07  E-value=10  Score=26.59  Aligned_cols=16  Identities=38%  Similarity=0.459  Sum_probs=13.5

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .|...|..|||||...
T Consensus         2 iI~i~G~~GSGKstia   17 (171)
T TIGR02173         2 IITISGPPGSGKTTVA   17 (171)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3678899999999776


No 380
>KOG0735|consensus
Probab=45.98  E-value=9.5  Score=34.47  Aligned_cols=42  Identities=21%  Similarity=0.350  Sum_probs=29.9

Q ss_pred             CCCeeEEeeccCCCCCceeecc--------------CC---CCCCcHHHHHHHHHHHHH
Q psy12524         43 GYNACIFAYGQTGSGKSYTMMG--------------SQ---DNKGIIPRLCDSLFDLIA   84 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~~G--------------~~---~~~Gli~~~~~~lf~~~~   84 (151)
                      ...+.|+.||.+|+|||+..--              +.   ...|--...+++||.+.+
T Consensus       699 r~~~giLLyGppGcGKT~la~a~a~~~~~~fisvKGPElL~KyIGaSEq~vR~lF~rA~  757 (952)
T KOG0735|consen  699 RLRTGILLYGPPGCGKTLLASAIASNSNLRFISVKGPELLSKYIGASEQNVRDLFERAQ  757 (952)
T ss_pred             ccccceEEECCCCCcHHHHHHHHHhhCCeeEEEecCHHHHHHHhcccHHHHHHHHHHhh
Confidence            3456789999999999997632              10   124666778889998755


No 381
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=45.92  E-value=11  Score=26.99  Aligned_cols=16  Identities=31%  Similarity=0.391  Sum_probs=13.4

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|.+|||||...
T Consensus         4 ~i~l~G~~gsGKst~a   19 (175)
T cd00227           4 IIILNGGSSAGKSSIA   19 (175)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            5788899999998655


No 382
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=45.90  E-value=8.6  Score=26.10  Aligned_cols=16  Identities=25%  Similarity=0.362  Sum_probs=13.1

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|+|||..+
T Consensus         5 ~i~~~G~~g~GKttl~   20 (168)
T cd04163           5 FVAIVGRPNVGKSTLL   20 (168)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4667799999998766


No 383
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=45.64  E-value=8.9  Score=29.40  Aligned_cols=16  Identities=25%  Similarity=0.569  Sum_probs=13.8

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .|.+.|++|+|||..+
T Consensus        33 ~vv~lGpSGcGKTTLL   48 (259)
T COG4525          33 LVVVLGPSGCGKTTLL   48 (259)
T ss_pred             EEEEEcCCCccHHHHH
Confidence            5688999999999766


No 384
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=45.64  E-value=25  Score=31.72  Aligned_cols=41  Identities=24%  Similarity=0.264  Sum_probs=29.2

Q ss_pred             CCCeeEEeeccCCCCCceeecc---------C-----CCCCCcHHHHHHHHHHHH
Q psy12524         43 GYNACIFAYGQTGSGKSYTMMG---------S-----QDNKGIIPRLCDSLFDLI   83 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~~G---------~-----~~~~Gli~~~~~~lf~~~   83 (151)
                      |.....+.+|.||||||-..+.         .     -++.++.|++++.+-.+.
T Consensus       215 ~~~~~~Ll~GvTGSGKTEvYl~~i~~~L~~GkqvLvLVPEI~Ltpq~~~rf~~rF  269 (730)
T COG1198         215 GGFAPFLLDGVTGSGKTEVYLEAIAKVLAQGKQVLVLVPEIALTPQLLARFKARF  269 (730)
T ss_pred             ccccceeEeCCCCCcHHHHHHHHHHHHHHcCCEEEEEeccccchHHHHHHHHHHh
Confidence            4455677899999999976633         1     256788888887765544


No 385
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=45.58  E-value=12  Score=27.14  Aligned_cols=23  Identities=30%  Similarity=0.497  Sum_probs=17.4

Q ss_pred             HHhhcCCCeeEEeeccCCCCCceee
Q psy12524         38 DNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        38 ~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+.+  -+++..|++|.||+..+
T Consensus        30 ~~~l~~--k~~vl~G~SGvGKSSLi   52 (161)
T PF03193_consen   30 KELLKG--KTSVLLGQSGVGKSSLI   52 (161)
T ss_dssp             HHHHTT--SEEEEECSTTSSHHHHH
T ss_pred             HHHhcC--CEEEEECCCCCCHHHHH
Confidence            345555  46677899999999877


No 386
>TIGR01075 uvrD DNA helicase II. Designed to identify uvrD members of the uvrD/rep subfamily.
Probab=45.52  E-value=10  Score=33.82  Aligned_cols=20  Identities=20%  Similarity=0.366  Sum_probs=15.7

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      .+.++..+..|||||.||..
T Consensus        17 ~g~~lV~AgaGSGKT~~L~~   36 (715)
T TIGR01075        17 PGNLLVLAGAGSGKTRVLTH   36 (715)
T ss_pred             CCCEEEEecCCCCHHHHHHH
Confidence            34567778999999999943


No 387
>PRK13767 ATP-dependent helicase; Provisional
Probab=45.42  E-value=17  Score=33.30  Aligned_cols=24  Identities=29%  Similarity=0.422  Sum_probs=17.0

Q ss_pred             HHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         37 LDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        37 v~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ++.+++|.|+  +...+||||||...
T Consensus        41 i~~il~g~nv--li~APTGSGKTlaa   64 (876)
T PRK13767         41 IPLIHEGKNV--LISSPTGSGKTLAA   64 (876)
T ss_pred             HHHHHcCCCE--EEECCCCCcHHHHH
Confidence            3445678875  44569999999864


No 388
>PRK14738 gmk guanylate kinase; Provisional
Probab=45.28  E-value=10  Score=28.19  Aligned_cols=19  Identities=21%  Similarity=0.338  Sum_probs=14.9

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      ....++..|++|+||+..+
T Consensus        12 ~~~~ivi~GpsG~GK~tl~   30 (206)
T PRK14738         12 KPLLVVISGPSGVGKDAVL   30 (206)
T ss_pred             CCeEEEEECcCCCCHHHHH
Confidence            3445677899999999866


No 389
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=45.26  E-value=8.1  Score=26.10  Aligned_cols=15  Identities=33%  Similarity=0.375  Sum_probs=12.3

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      +...|.+|+|||..+
T Consensus         2 i~i~G~~~~GKssl~   16 (159)
T cd04159           2 ITLVGLQNSGKTTLV   16 (159)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            456799999999776


No 390
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).
Probab=45.17  E-value=8.4  Score=34.39  Aligned_cols=18  Identities=33%  Similarity=0.565  Sum_probs=16.2

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      |...+..|.+|+|||.++
T Consensus       434 ~~n~~I~G~tGsGKS~~~  451 (785)
T TIGR00929       434 LGHTLIFGPTGSGKTTLL  451 (785)
T ss_pred             CceEEEECCCCCCHHHHH
Confidence            677889999999999988


No 391
>PRK11773 uvrD DNA-dependent helicase II; Provisional
Probab=45.17  E-value=10  Score=33.88  Aligned_cols=20  Identities=20%  Similarity=0.363  Sum_probs=15.7

Q ss_pred             CeeEEeeccCCCCCceeecc
Q psy12524         45 NACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ...++..+..|||||.+|..
T Consensus        22 ~g~~lV~AgaGSGKT~vl~~   41 (721)
T PRK11773         22 LGNMLVLAGAGSGKTRVLVH   41 (721)
T ss_pred             CCCEEEEecCCCCHHHHHHH
Confidence            44567778899999999943


No 392
>PRK02496 adk adenylate kinase; Provisional
Probab=45.15  E-value=11  Score=27.11  Aligned_cols=15  Identities=27%  Similarity=0.519  Sum_probs=12.7

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..|.+|||||...
T Consensus         4 i~i~G~pGsGKst~a   18 (184)
T PRK02496          4 LIFLGPPGAGKGTQA   18 (184)
T ss_pred             EEEECCCCCCHHHHH
Confidence            677899999998765


No 393
>TIGR00064 ftsY signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.
Probab=44.86  E-value=11  Score=29.64  Aligned_cols=17  Identities=35%  Similarity=0.548  Sum_probs=14.0

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...|.+|+|||.|+
T Consensus        73 ~vi~l~G~~G~GKTTt~   89 (272)
T TIGR00064        73 NVILFVGVNGVGKTTTI   89 (272)
T ss_pred             eEEEEECCCCCcHHHHH
Confidence            45556699999999988


No 394
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=44.84  E-value=9.9  Score=26.45  Aligned_cols=19  Identities=26%  Similarity=0.419  Sum_probs=16.2

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      ....++..|..|+|||..+
T Consensus         6 ~~~~v~v~G~~~~GKSsli   24 (169)
T cd04114           6 FLFKIVLIGNAGVGKTCLV   24 (169)
T ss_pred             ceeEEEEECCCCCCHHHHH
Confidence            3567889999999999887


No 395
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown]
Probab=44.76  E-value=16  Score=28.68  Aligned_cols=35  Identities=17%  Similarity=0.299  Sum_probs=26.4

Q ss_pred             HHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         27 KVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        27 ~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ++| .+..||+..+.+.-....+..|+.++|||..+
T Consensus       120 ~v~-Gt~~~li~~ly~~g~lntLiigpP~~GKTTlL  154 (308)
T COG3854         120 QVF-GTANPLIKDLYQNGWLNTLIIGPPQVGKTTLL  154 (308)
T ss_pred             hhh-ccchHHHHHHHhcCceeeEEecCCCCChHHHH
Confidence            344 34478999988755555678899999999877


No 396
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA. Designed to identify pcrA members of the uvrD/rep subfamily.
Probab=44.73  E-value=10  Score=33.76  Aligned_cols=21  Identities=19%  Similarity=0.309  Sum_probs=16.7

Q ss_pred             CCeeEEeeccCCCCCceeecc
Q psy12524         44 YNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      ....++..|..|||||.++.-
T Consensus        16 ~~g~~lV~AgaGSGKT~~l~~   36 (726)
T TIGR01073        16 TEGPLLIMAGAGSGKTRVLTH   36 (726)
T ss_pred             CCCCEEEEeCCCCCHHHHHHH
Confidence            345678888999999999943


No 397
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=44.47  E-value=8.3  Score=26.70  Aligned_cols=15  Identities=33%  Similarity=0.494  Sum_probs=13.0

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |...|..|+|||..+
T Consensus         3 i~v~G~~~~GKTsli   17 (164)
T smart00173        3 LVVLGSGGVGKSALT   17 (164)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567799999999876


No 398
>PRK05541 adenylylsulfate kinase; Provisional
Probab=44.41  E-value=12  Score=26.71  Aligned_cols=17  Identities=35%  Similarity=0.495  Sum_probs=13.8

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++..|.+|||||...
T Consensus         8 ~~I~i~G~~GsGKst~a   24 (176)
T PRK05541          8 YVIWITGLAGSGKTTIA   24 (176)
T ss_pred             CEEEEEcCCCCCHHHHH
Confidence            36777899999998766


No 399
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional
Probab=44.36  E-value=8.6  Score=35.00  Aligned_cols=18  Identities=28%  Similarity=0.444  Sum_probs=15.8

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      |...+..|.+|||||.++
T Consensus       449 N~N~~I~G~sGsGKS~l~  466 (844)
T PRK13721        449 NYNMAVCGTSGAGKTGLI  466 (844)
T ss_pred             cccEEEEcCCCCCHHHHH
Confidence            556889999999999988


No 400
>PTZ00110 helicase; Provisional
Probab=44.25  E-value=17  Score=31.38  Aligned_cols=24  Identities=29%  Similarity=0.480  Sum_probs=17.9

Q ss_pred             HHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         37 LDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        37 v~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +..+++|.+.  ++..+||||||...
T Consensus       161 ip~~l~G~dv--I~~ApTGSGKTlay  184 (545)
T PTZ00110        161 WPIALSGRDM--IGIAETGSGKTLAF  184 (545)
T ss_pred             HHHHhcCCCE--EEEeCCCChHHHHH
Confidence            4456788865  56679999999753


No 401
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]
Probab=44.24  E-value=13  Score=29.99  Aligned_cols=16  Identities=38%  Similarity=0.383  Sum_probs=14.0

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++.+|+|+||||...
T Consensus         5 ~i~I~GPTAsGKT~la   20 (308)
T COG0324           5 LIVIAGPTASGKTALA   20 (308)
T ss_pred             EEEEECCCCcCHHHHH
Confidence            4788999999999876


No 402
>PHA02530 pseT polynucleotide kinase; Provisional
Probab=44.14  E-value=12  Score=29.16  Aligned_cols=16  Identities=44%  Similarity=0.507  Sum_probs=13.4

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|.+|||||...
T Consensus         4 liil~G~pGSGKSTla   19 (300)
T PHA02530          4 IILTVGVPGSGKSTWA   19 (300)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            5778899999998764


No 403
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=44.04  E-value=13  Score=28.18  Aligned_cols=18  Identities=28%  Similarity=0.379  Sum_probs=15.1

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...++..|.+|+|||...
T Consensus        24 g~~~~i~G~~G~GKTtl~   41 (230)
T PRK08533         24 GSLILIEGDESTGKSILS   41 (230)
T ss_pred             CcEEEEECCCCCCHHHHH
Confidence            347889999999999884


No 404
>TIGR00602 rad24 checkpoint protein rad24. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=43.93  E-value=18  Score=32.06  Aligned_cols=16  Identities=38%  Similarity=0.640  Sum_probs=14.4

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++.+|++|+|||.++
T Consensus       112 illL~GP~GsGKTTl~  127 (637)
T TIGR00602       112 ILLITGPSGCGKSTTI  127 (637)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4788999999999987


No 405
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=43.62  E-value=8.9  Score=32.17  Aligned_cols=18  Identities=33%  Similarity=0.405  Sum_probs=15.1

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+...|.+|+|||.|+
T Consensus       191 g~vi~lvGpnG~GKTTtl  208 (420)
T PRK14721        191 GGVYALIGPTGVGKTTTT  208 (420)
T ss_pred             CcEEEEECCCCCCHHHHH
Confidence            345677899999999999


No 406
>PRK10867 signal recognition particle protein; Provisional
Probab=43.56  E-value=34  Score=28.83  Aligned_cols=18  Identities=33%  Similarity=0.508  Sum_probs=15.1

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...++..|.+|+|||.|.
T Consensus       100 p~vI~~vG~~GsGKTTta  117 (433)
T PRK10867        100 PTVIMMVGLQGAGKTTTA  117 (433)
T ss_pred             CEEEEEECCCCCcHHHHH
Confidence            456778899999999987


No 407
>KOG0336|consensus
Probab=43.42  E-value=17  Score=30.83  Aligned_cols=20  Identities=40%  Similarity=0.542  Sum_probs=15.4

Q ss_pred             hhcCCCeeEEeeccCCCCCcee
Q psy12524         40 AFQGYNACIFAYGQTGSGKSYT   61 (151)
Q Consensus        40 ~~~G~~~~v~~yG~~~sGKt~t   61 (151)
                      +++|.++.-+|  +||+|||-.
T Consensus       254 ~LQG~DliGVA--QTgtgKtL~  273 (629)
T KOG0336|consen  254 LLQGIDLIGVA--QTGTGKTLA  273 (629)
T ss_pred             eecCcceEEEE--ecCCCcCHH
Confidence            57888886555  899999854


No 408
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]
Probab=43.39  E-value=9.2  Score=32.33  Aligned_cols=42  Identities=19%  Similarity=0.247  Sum_probs=30.6

Q ss_pred             CCCeeEEeeccCCCCCceeecc--C---------------CCCCCcHHHHHHHHHHHHH
Q psy12524         43 GYNACIFAYGQTGSGKSYTMMG--S---------------QDNKGIIPRLCDSLFDLIA   84 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~~G--~---------------~~~~Gli~~~~~~lf~~~~   84 (151)
                      .....++-||+.|+|||.+..-  .               ...-|-....++.+|....
T Consensus       274 ~~~~giLl~GpPGtGKT~lAkava~~~~~~fi~v~~~~l~sk~vGesek~ir~~F~~A~  332 (494)
T COG0464         274 RPPKGVLLYGPPGTGKTLLAKAVALESRSRFISVKGSELLSKWVGESEKNIRELFEKAR  332 (494)
T ss_pred             CCCCeeEEECCCCCCHHHHHHHHHhhCCCeEEEeeCHHHhccccchHHHHHHHHHHHHH
Confidence            3444799999999999987722  1               1135777888899998765


No 409
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=43.39  E-value=9.9  Score=31.74  Aligned_cols=18  Identities=44%  Similarity=0.580  Sum_probs=14.8

Q ss_pred             eeEEeeccCCCCCceeec
Q psy12524         46 ACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~   63 (151)
                      -.+...|++|+|||.++.
T Consensus       207 ~ii~lvGptGvGKTTt~a  224 (407)
T PRK12726        207 RIISLIGQTGVGKTTTLV  224 (407)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            356778999999999883


No 410
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional
Probab=43.36  E-value=28  Score=27.59  Aligned_cols=17  Identities=29%  Similarity=0.542  Sum_probs=14.6

Q ss_pred             eEEeeccCCCCCceeec
Q psy12524         47 CIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~~   63 (151)
                      .++..|.+|||||..+.
T Consensus         8 ~i~i~G~~GsGKtt~~~   24 (288)
T PRK05416          8 LVIVTGLSGAGKSVALR   24 (288)
T ss_pred             EEEEECCCCCcHHHHHH
Confidence            57888999999998873


No 411
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=43.25  E-value=24  Score=30.41  Aligned_cols=23  Identities=17%  Similarity=0.247  Sum_probs=17.7

Q ss_pred             hhcCC-CeeEEeeccCCCCCceee
Q psy12524         40 AFQGY-NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        40 ~~~G~-~~~v~~yG~~~sGKt~t~   62 (151)
                      +..|. ...++.+|+.|+|||.+.
T Consensus        37 i~~~ri~~a~Lf~Gp~G~GKTT~A   60 (507)
T PRK06645         37 ILNDRLAGGYLLTGIRGVGKTTSA   60 (507)
T ss_pred             HHcCCCCceEEEECCCCCCHHHHH
Confidence            34444 457899999999999876


No 412
>PRK11545 gntK gluconate kinase 1; Provisional
Probab=43.17  E-value=6.1  Score=28.28  Aligned_cols=13  Identities=46%  Similarity=0.588  Sum_probs=10.9

Q ss_pred             eccCCCCCceeec
Q psy12524         51 YGQTGSGKSYTMM   63 (151)
Q Consensus        51 yG~~~sGKt~t~~   63 (151)
                      .|.+|||||..+.
T Consensus         1 ~G~sGsGKSTla~   13 (163)
T PRK11545          1 MGVSGSGKSAVAS   13 (163)
T ss_pred             CCCCCCcHHHHHH
Confidence            4899999998873


No 413
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=43.11  E-value=9.2  Score=26.77  Aligned_cols=19  Identities=21%  Similarity=0.345  Sum_probs=15.9

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      ....+...|.+|+|||..+
T Consensus        13 ~~~~v~i~G~~g~GKStLl   31 (173)
T cd04155          13 EEPRILILGLDNAGKTTIL   31 (173)
T ss_pred             CccEEEEEccCCCCHHHHH
Confidence            3556889999999999877


No 414
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated
Probab=42.99  E-value=12  Score=27.07  Aligned_cols=16  Identities=38%  Similarity=0.364  Sum_probs=13.3

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|.+|||||...
T Consensus         3 ~ili~G~~~sGKS~~a   18 (170)
T PRK05800          3 LILVTGGARSGKSRFA   18 (170)
T ss_pred             EEEEECCCCccHHHHH
Confidence            4788999999998655


No 415
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional
Probab=42.98  E-value=16  Score=31.36  Aligned_cols=20  Identities=30%  Similarity=0.443  Sum_probs=17.0

Q ss_pred             CCCeeEEeeccCCCCCceee
Q psy12524         43 GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+..|+.+|.+||||++..
T Consensus       225 ~~~~pvlI~GE~GtGK~~lA  244 (520)
T PRK10820        225 MLDAPLLITGDTGTGKDLLA  244 (520)
T ss_pred             CCCCCEEEECCCCccHHHHH
Confidence            45667999999999998876


No 416
>TIGR00678 holB DNA polymerase III, delta' subunit. At position 126-127 of the seed alignment, this family lacks the HM motif of gamma/tau; at 132 it has a near-invariant A vs. an invariant F in gamma/tau.
Probab=42.90  E-value=19  Score=26.00  Aligned_cols=24  Identities=21%  Similarity=0.263  Sum_probs=17.7

Q ss_pred             HhhcC-CCeeEEeeccCCCCCceee
Q psy12524         39 NAFQG-YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        39 ~~~~G-~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+-.| ...+++-||+.|+|||..+
T Consensus         7 ~i~~~~~~~~~L~~G~~G~gkt~~a   31 (188)
T TIGR00678         7 ALEKGRLAHAYLFAGPEGVGKELLA   31 (188)
T ss_pred             HHHcCCCCeEEEEECCCCCCHHHHH
Confidence            33344 4567889999999998665


No 417
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=42.82  E-value=14  Score=26.67  Aligned_cols=17  Identities=41%  Similarity=0.507  Sum_probs=14.4

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..|+..|.+|+|||...
T Consensus         5 ~~I~liG~~GaGKStl~   21 (172)
T PRK05057          5 RNIFLVGPMGAGKSTIG   21 (172)
T ss_pred             CEEEEECCCCcCHHHHH
Confidence            35888999999998766


No 418
>PLN02200 adenylate kinase family protein
Probab=42.81  E-value=14  Score=28.26  Aligned_cols=19  Identities=32%  Similarity=0.391  Sum_probs=15.3

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      ....++..|.+||||+...
T Consensus        42 ~~~ii~I~G~PGSGKsT~a   60 (234)
T PLN02200         42 TPFITFVLGGPGSGKGTQC   60 (234)
T ss_pred             CCEEEEEECCCCCCHHHHH
Confidence            3456889999999998764


No 419
>TIGR00554 panK_bact pantothenate kinase, bacterial type. Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.
Probab=42.79  E-value=22  Score=28.25  Aligned_cols=17  Identities=35%  Similarity=0.259  Sum_probs=13.3

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      -.+-..|.+|||||.++
T Consensus        63 ~IIGIaG~~GSGKSTla   79 (290)
T TIGR00554        63 YIISIAGSVAVGKSTTA   79 (290)
T ss_pred             EEEEEECCCCCCHHHHH
Confidence            34455699999999887


No 420
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=42.77  E-value=12  Score=25.40  Aligned_cols=15  Identities=33%  Similarity=0.508  Sum_probs=13.0

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..|..|+|||..+
T Consensus         2 i~i~G~~~~GKTsli   16 (160)
T cd00876           2 VVVLGAGGVGKSAIT   16 (160)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999999876


No 421
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=42.72  E-value=9.4  Score=26.29  Aligned_cols=15  Identities=27%  Similarity=0.490  Sum_probs=12.6

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|..|+|||..+
T Consensus         2 i~i~G~~~~GKTsl~   16 (160)
T cd04156           2 VLLLGLDSAGKSTLL   16 (160)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            456799999999876


No 422
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase. A conserved gene neighborhood widely spread in the Actinobacteria contains this uncharacterized DEAH-box family helicase encoded convergently towards an operon of genes for protein homologous to type II secretion and pilus formation proteins. The context suggests that this helicase may play a role in conjugal transfer of DNA.
Probab=42.71  E-value=20  Score=32.25  Aligned_cols=26  Identities=27%  Similarity=0.284  Sum_probs=18.8

Q ss_pred             HHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         35 DILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        35 ~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+..+++|.|..+  --+||||||...
T Consensus        43 ~ai~~il~G~nvvv--~apTGSGKTla~   68 (742)
T TIGR03817        43 RAAELAHAGRHVVV--ATGTASGKSLAY   68 (742)
T ss_pred             HHHHHHHCCCCEEE--ECCCCCcHHHHH
Confidence            34556788998644  448999999764


No 423
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=42.70  E-value=9.4  Score=28.24  Aligned_cols=16  Identities=38%  Similarity=0.457  Sum_probs=13.5

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|+|||..+
T Consensus        24 ~~~i~G~nGsGKStll   39 (197)
T cd03278          24 LTAIVGPNGSGKSNII   39 (197)
T ss_pred             cEEEECCCCCCHHHHH
Confidence            3457899999999887


No 424
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional
Probab=42.53  E-value=24  Score=30.22  Aligned_cols=23  Identities=22%  Similarity=0.215  Sum_probs=17.3

Q ss_pred             hhcCCC-eeEEeeccCCCCCceee
Q psy12524         40 AFQGYN-ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        40 ~~~G~~-~~v~~yG~~~sGKt~t~   62 (151)
                      +-.|.- -.++.+|..|+|||.+.
T Consensus        29 ~~~~ri~ha~Lf~Gp~G~GKTT~A   52 (491)
T PRK14964         29 FTLNKIPQSILLVGASGVGKTTCA   52 (491)
T ss_pred             HHcCCCCceEEEECCCCccHHHHH
Confidence            334543 37999999999999855


No 425
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=42.50  E-value=9.6  Score=25.83  Aligned_cols=16  Identities=25%  Similarity=0.370  Sum_probs=13.3

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|+|||..+
T Consensus         3 ~i~l~G~~~~GKstli   18 (157)
T cd04164           3 KVVIVGKPNVGKSSLL   18 (157)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4678899999999766


No 426
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=42.50  E-value=14  Score=28.50  Aligned_cols=18  Identities=33%  Similarity=0.532  Sum_probs=14.8

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+...|.+|||||..+
T Consensus        30 Ge~~~i~G~nGsGKSTL~   47 (235)
T COG1122          30 GERVLLIGPNGSGKSTLL   47 (235)
T ss_pred             CCEEEEECCCCCCHHHHH
Confidence            346688999999999876


No 427
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=42.48  E-value=12  Score=28.50  Aligned_cols=15  Identities=40%  Similarity=0.426  Sum_probs=13.1

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+..|..|||||...
T Consensus         2 Ivl~G~pGSGKST~a   16 (249)
T TIGR03574         2 IILTGLPGVGKSTFS   16 (249)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            678899999999876


No 428
>PF13337 Lon_2:  Putative ATP-dependent Lon protease
Probab=42.45  E-value=26  Score=29.82  Aligned_cols=32  Identities=25%  Similarity=0.362  Sum_probs=22.2

Q ss_pred             HHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         26 EKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        26 ~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+=.-+-|+|+     .|..++=.|+.||||||..
T Consensus       194 Kl~~L~RLiPlVE-----~N~NliELgPrGTGKS~vy  225 (457)
T PF13337_consen  194 KLLLLARLIPLVE-----RNYNLIELGPRGTGKSYVY  225 (457)
T ss_pred             HHHHHHhHHHhcc-----cccceEEEcCCCCCceeeh
Confidence            3333344446554     3667789999999999986


No 429
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU). CobU is bifunctional cobalbumin biosynthesis enzymes which display adenosylcobinamide kinase and adenosylcobinamide phosphate guanyltransferase activity. This enzyme is a homotrimer with a propeller-like shape.
Probab=42.44  E-value=13  Score=26.96  Aligned_cols=15  Identities=40%  Similarity=0.421  Sum_probs=12.3

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..|.+|||||...
T Consensus         2 ~li~G~~~sGKS~~a   16 (169)
T cd00544           2 ILVTGGARSGKSRFA   16 (169)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999998654


No 430
>PRK13889 conjugal transfer relaxase TraA; Provisional
Probab=42.40  E-value=16  Score=34.08  Aligned_cols=27  Identities=26%  Similarity=0.315  Sum_probs=20.2

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceeec
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      .|..++.+.+. ++.-|..|||||++|.
T Consensus       354 Av~~il~s~~v-~vv~G~AGTGKTT~l~  380 (988)
T PRK13889        354 ALAHVTDGRDL-GVVVGYAGTGKSAMLG  380 (988)
T ss_pred             HHHHHhcCCCe-EEEEeCCCCCHHHHHH
Confidence            45566766664 4588999999999873


No 431
>KOG3347|consensus
Probab=42.37  E-value=13  Score=27.21  Aligned_cols=17  Identities=35%  Similarity=0.503  Sum_probs=14.8

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      -.|+..|.+|+|||.+.
T Consensus         8 PNILvtGTPG~GKstl~   24 (176)
T KOG3347|consen    8 PNILVTGTPGTGKSTLA   24 (176)
T ss_pred             CCEEEeCCCCCCchhHH
Confidence            46889999999999876


No 432
>KOG0922|consensus
Probab=42.35  E-value=16  Score=32.35  Aligned_cols=19  Identities=42%  Similarity=0.635  Sum_probs=15.9

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      .|..++.-|.||||||.-+
T Consensus        65 ~nqvlIviGeTGsGKSTQi   83 (674)
T KOG0922|consen   65 DNQVLIVIGETGSGKSTQI   83 (674)
T ss_pred             HCCEEEEEcCCCCCccccH
Confidence            4667788999999998766


No 433
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR. At least five distinct pathways exists for the catabolism of propionate by way of propionyl-CoA. Members of this family represent the transcriptional regulatory protein PrpR, whose gene is found in most cases divergently transcribed from an operon for the methylcitric acid cycle of propionate catabolism. 2-methylcitric acid, a catabolite by this pathway, is a coactivator of PrpR.
Probab=42.29  E-value=18  Score=31.23  Aligned_cols=21  Identities=24%  Similarity=0.517  Sum_probs=17.6

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+..|+..|.+||||+...
T Consensus       232 A~~~~pVLI~GE~GTGKe~lA  252 (526)
T TIGR02329       232 ARSDATVLILGESGTGKELVA  252 (526)
T ss_pred             hCCCCcEEEECCCCcCHHHHH
Confidence            456778999999999997765


No 434
>cd03071 PDI_b'_NRX PDIb' family, NRX subgroup, redox inactive TRX-like domain b'; composed of vertebrate nucleoredoxins (NRX). NRX is a 400-amino acid nuclear protein with one redox active TRX domain followed by one redox inactive TRX-like domain homologous to the b' domain of PDI. In vitro studies show that NRX has thiol oxidoreductase activity and that it may be involved in the redox regulation of transcription, in a manner different from that of TRX or glutaredoxin. NRX enhances the activation of NF-kB by TNFalpha, as well as PMA-1 induced AP-1 and FK-induced CREB activation. Mouse NRX transcripts are expressed in all adult tissues but is restricted to the nervous system and limb buds in embryos. The mouse NRX gene is implicated in streptozotocin-induced diabetes. Similar to PDI, the b' domain of NRX is likely involved in substrate recognition.
Probab=42.24  E-value=7.1  Score=26.57  Aligned_cols=74  Identities=9%  Similarity=0.164  Sum_probs=49.3

Q ss_pred             CcHHHHHHHHHHHHHhhcCCCceEEEEEEEEEEE---CCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHH
Q psy12524         70 GIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIY---NEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQAR  146 (151)
Q Consensus        70 Gli~~~~~~lf~~~~~~~~~~~~~~v~~S~~eiy---~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~  146 (151)
                      -+++.+.+.++..-....... .   ..-++..-   -+.++|++|-......|-+.+-+.++.||-...+++..+++++
T Consensus        35 ~llQpiAd~~~aka~~k~~da-p---~~f~~a~ede~tdsLRDf~nL~d~~P~LviLDip~r~~~v~~~eeIT~e~~~~f  110 (116)
T cd03071          35 QLIQPIAEKIIAKYKAKEEEA-P---LLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEAF  110 (116)
T ss_pred             HHHHHHHHHHHHHhhccCCCc-c---eeeeeeccchHHHHHHHhcCCCccCceEEEEeccccceEeCchHhcCHHHHHHH
Confidence            466666777666544333222 1   11122222   2346888887766677999999999999999999998888877


Q ss_pred             h
Q psy12524        147 A  147 (151)
Q Consensus       147 ~  147 (151)
                      .
T Consensus       111 v  111 (116)
T cd03071         111 V  111 (116)
T ss_pred             H
Confidence            5


No 435
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed
Probab=42.21  E-value=14  Score=29.64  Aligned_cols=16  Identities=38%  Similarity=0.437  Sum_probs=13.6

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|+||||||...
T Consensus         6 ~i~i~GptgsGKt~la   21 (307)
T PRK00091          6 VIVIVGPTASGKTALA   21 (307)
T ss_pred             EEEEECCCCcCHHHHH
Confidence            5778899999998765


No 436
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional
Probab=42.19  E-value=18  Score=32.08  Aligned_cols=21  Identities=24%  Similarity=0.502  Sum_probs=17.4

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+..|+..|.+||||++..
T Consensus       396 a~~~~pVLI~GE~GTGK~~lA  416 (686)
T PRK15429        396 AQSDSTVLILGETGTGKELIA  416 (686)
T ss_pred             hCCCCCEEEECCCCcCHHHHH
Confidence            355678999999999999765


No 437
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=42.09  E-value=10  Score=28.59  Aligned_cols=16  Identities=38%  Similarity=0.468  Sum_probs=13.4

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .....|++|+|||..|
T Consensus        25 ~~~i~GpNGsGKStll   40 (243)
T cd03272          25 HNVVVGRNGSGKSNFF   40 (243)
T ss_pred             cEEEECCCCCCHHHHH
Confidence            4457799999999987


No 438
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA. This protein contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, pfam03389) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, TIGR02760). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer.
Probab=42.04  E-value=16  Score=32.81  Aligned_cols=27  Identities=19%  Similarity=0.316  Sum_probs=18.8

Q ss_pred             HHHhhcCCCeeEEeeccCCCCCceeecc
Q psy12524         37 LDNAFQGYNACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        37 v~~~~~G~~~~v~~yG~~~sGKt~t~~G   64 (151)
                      +..++.+ +..++.-|..|+|||+++..
T Consensus       361 v~~i~~s-~~~~il~G~aGTGKTtll~~  387 (744)
T TIGR02768       361 VRHVTGS-GDIAVVVGRAGTGKSTMLKA  387 (744)
T ss_pred             HHHHhcC-CCEEEEEecCCCCHHHHHHH
Confidence            3444544 33567889999999998843


No 439
>TIGR01425 SRP54_euk signal recognition particle protein SRP54. This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model.
Probab=41.98  E-value=40  Score=28.44  Aligned_cols=18  Identities=39%  Similarity=0.508  Sum_probs=15.3

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...++..|.+|+|||.|+
T Consensus       100 ~~vi~lvG~~GvGKTTta  117 (429)
T TIGR01425       100 QNVIMFVGLQGSGKTTTC  117 (429)
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            456778899999999988


No 440
>PF01745 IPT:  Isopentenyl transferase;  InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [].; GO: 0004161 dimethylallyltranstransferase activity, 0009058 biosynthetic process; PDB: 2ZE8_C 2ZE5_A 2ZE7_A 2ZE6_A.
Probab=41.98  E-value=14  Score=28.48  Aligned_cols=15  Identities=33%  Similarity=0.523  Sum_probs=11.8

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      .+.+|+|+||||..-
T Consensus         4 ~~i~GpT~tGKt~~a   18 (233)
T PF01745_consen    4 YLIVGPTGTGKTALA   18 (233)
T ss_dssp             EEEE-STTSSHHHHH
T ss_pred             EEEECCCCCChhHHH
Confidence            567899999999875


No 441
>KOG0924|consensus
Probab=41.96  E-value=15  Score=33.10  Aligned_cols=20  Identities=35%  Similarity=0.551  Sum_probs=17.5

Q ss_pred             CCCeeEEeeccCCCCCceee
Q psy12524         43 GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~   62 (151)
                      +-|..|+..|.||||||.-+
T Consensus       369 r~n~vvvivgETGSGKTTQl  388 (1042)
T KOG0924|consen  369 RENQVVVIVGETGSGKTTQL  388 (1042)
T ss_pred             hhCcEEEEEecCCCCchhhh
Confidence            56788999999999999776


No 442
>PRK13949 shikimate kinase; Provisional
Probab=41.94  E-value=14  Score=26.68  Aligned_cols=16  Identities=38%  Similarity=0.482  Sum_probs=13.6

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .|+..|..|||||...
T Consensus         3 ~I~liG~~GsGKstl~   18 (169)
T PRK13949          3 RIFLVGYMGAGKTTLG   18 (169)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4788999999999765


No 443
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=41.93  E-value=13  Score=25.45  Aligned_cols=15  Identities=33%  Similarity=0.488  Sum_probs=12.8

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |..+|.+|+|||..+
T Consensus         3 i~~~G~~~~GKTsl~   17 (164)
T cd04139           3 VIVVGAGGVGKSALT   17 (164)
T ss_pred             EEEECCCCCCHHHHH
Confidence            677899999999865


No 444
>PRK14528 adenylate kinase; Provisional
Probab=41.89  E-value=14  Score=27.04  Aligned_cols=16  Identities=31%  Similarity=0.470  Sum_probs=13.5

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|.+|||||...
T Consensus         3 ~i~i~G~pGsGKtt~a   18 (186)
T PRK14528          3 NIIFMGPPGAGKGTQA   18 (186)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4678999999998766


No 445
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=41.77  E-value=16  Score=25.15  Aligned_cols=16  Identities=25%  Similarity=0.370  Sum_probs=13.9

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      -++..|.+++|||..+
T Consensus         3 ki~v~G~~~~GKSsli   18 (163)
T cd01860           3 KLVLLGDSSVGKSSLV   18 (163)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4778999999999877


No 446
>COG5022 Myosin heavy chain [Cytoskeleton]
Probab=41.71  E-value=17  Score=34.96  Aligned_cols=21  Identities=29%  Similarity=0.465  Sum_probs=18.9

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.|.||+.-|.+|+|||-.-
T Consensus       149 ~~eNQtIiISGESGAGKTe~a  169 (1463)
T COG5022         149 EKENQTIIISGESGAGKTENA  169 (1463)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            488999999999999999765


No 447
>KOG0987|consensus
Probab=41.71  E-value=29  Score=29.99  Aligned_cols=35  Identities=34%  Similarity=0.715  Sum_probs=22.9

Q ss_pred             CCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         23 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..|..+|+ .   ++..+....-..++ ||..|+|||+..
T Consensus       120 ~eqk~v~d-~---~~~~v~~~~g~~ff-~g~~gtgKt~l~  154 (540)
T KOG0987|consen  120 PEQKRVYD-A---ILEAVENNLGGVFF-YGFGGTGKTYLL  154 (540)
T ss_pred             HHHHHHHH-H---HHHHHhccccceee-eccCCccceeeH
Confidence            45666666 2   22334444455566 999999999987


No 448
>PF13166 AAA_13:  AAA domain
Probab=41.70  E-value=12  Score=33.09  Aligned_cols=16  Identities=44%  Similarity=0.623  Sum_probs=13.0

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .-+.||.+|||||...
T Consensus        18 ~n~IYG~NGsGKStls   33 (712)
T PF13166_consen   18 INLIYGRNGSGKSTLS   33 (712)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            3468999999999655


No 449
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit. This family describes the exodeoxyribonuclease V alpha subunit, RecD. RecD is part of a RecBCD complex. A related family in the Gram-positive bacteria separates in a phylogenetic tree, has an additional N-terminal extension of about 200 residues, and is not supported as a member of a RecBCD complex by neighboring genes. The related family is consequently described by a different model.
Probab=41.67  E-value=10  Score=33.23  Aligned_cols=17  Identities=29%  Similarity=0.466  Sum_probs=14.2

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ...+..|..|||||+++
T Consensus       161 ~~~vitGgpGTGKTt~v  177 (586)
T TIGR01447       161 NFSLITGGPGTGKTTTV  177 (586)
T ss_pred             CeEEEEcCCCCCHHHHH
Confidence            45567899999999987


No 450
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I. This model represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll. This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria.
Probab=41.66  E-value=21  Score=28.96  Aligned_cols=37  Identities=27%  Similarity=0.328  Sum_probs=24.6

Q ss_pred             CCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeec
Q psy12524         23 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        23 ~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~   63 (151)
                      ..|+++=...    +-.+++.....++..|.+|+|||..+.
T Consensus         7 vgq~~~~~al----~~~~~~~~~g~vli~G~~G~gKttl~r   43 (337)
T TIGR02030         7 VGQDEMKLAL----LLNVIDPKIGGVMVMGDRGTGKSTAVR   43 (337)
T ss_pred             ccHHHHHHHH----HHHhcCCCCCeEEEEcCCCCCHHHHHH
Confidence            3566554433    334455444568899999999998873


No 451
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=41.64  E-value=9.2  Score=26.83  Aligned_cols=19  Identities=26%  Similarity=0.555  Sum_probs=15.4

Q ss_pred             eeEEeeccCCCCCceeecc
Q psy12524         46 ACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~G   64 (151)
                      ..++..|..|+|||..+.+
T Consensus        23 ~~i~l~G~lGaGKTtl~~~   41 (133)
T TIGR00150        23 TVVLLKGDLGAGKTTLVQG   41 (133)
T ss_pred             CEEEEEcCCCCCHHHHHHH
Confidence            3578899999999988743


No 452
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=41.59  E-value=9.7  Score=25.63  Aligned_cols=16  Identities=31%  Similarity=0.520  Sum_probs=13.3

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .|+..|..++|||..+
T Consensus         2 ~i~~~G~~~~GKStl~   17 (159)
T cd00154           2 KIVLIGDSGVGKTSLL   17 (159)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            3678899999999666


No 453
>COG1660 Predicted P-loop-containing kinase [General function prediction only]
Probab=41.50  E-value=1.5e+02  Score=23.56  Aligned_cols=37  Identities=24%  Similarity=0.302  Sum_probs=24.6

Q ss_pred             HHHHHHHHh---HHHHHHhh-cCCCeeEEeeccCCCCCceee
Q psy12524         25 QEKVFDALG---RDILDNAF-QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        25 q~~vy~~~~---~~lv~~~~-~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      -+++|+...   ..++.... +|.+...+|.|.|| ||..++
T Consensus       218 ~~ef~~~l~~~l~~~LP~y~~egks~lTIaIGCTG-GqHRSV  258 (286)
T COG1660         218 VEEFYEKLRDLLEFWLPRYEKEGKSYLTIAIGCTG-GQHRSV  258 (286)
T ss_pred             HHHHHHHHHHHHHHHhHHHHhcCCeEEEEEEccCC-CccchH
Confidence            344555442   23343333 59999999999999 887776


No 454
>PTZ00035 Rad51 protein; Provisional
Probab=41.43  E-value=21  Score=28.96  Aligned_cols=29  Identities=21%  Similarity=0.311  Sum_probs=21.8

Q ss_pred             HHHHHHhhc-CC--CeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQ-GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~-G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      .+-++.++. |.  ...+..+|.+|||||..+
T Consensus       104 ~~~LD~lLgGGi~~G~iteI~G~~GsGKT~l~  135 (337)
T PTZ00035        104 STQLDKLLGGGIETGSITELFGEFRTGKTQLC  135 (337)
T ss_pred             cHHHHHHhCCCCCCCeEEEEECCCCCchhHHH
Confidence            356677776 43  445678999999999876


No 455
>PRK10919 ATP-dependent DNA helicase Rep; Provisional
Probab=41.22  E-value=13  Score=32.97  Aligned_cols=17  Identities=24%  Similarity=0.358  Sum_probs=13.4

Q ss_pred             eEEeeccCCCCCceeec
Q psy12524         47 CIFAYGQTGSGKSYTMM   63 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~~   63 (151)
                      -++..+..|||||.|+.
T Consensus        17 ~~lV~AgpGSGKT~vL~   33 (672)
T PRK10919         17 PCLVLAGAGSGKTRVIT   33 (672)
T ss_pred             CEEEEecCCCCHHHHHH
Confidence            44566789999999984


No 456
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain. This model represents a clade within a larger family of proteins from viruses of bacteria and animals. Members of this family are found in phage and plasmids of bacteria and archaea only. The model describes a domain of about 300 residues, found generally toward the protein C-terminus.
Probab=41.18  E-value=14  Score=29.20  Aligned_cols=19  Identities=37%  Similarity=0.550  Sum_probs=15.4

Q ss_pred             CCeeEEeeccCCCCCceee
Q psy12524         44 YNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        44 ~~~~v~~yG~~~sGKt~t~   62 (151)
                      ....++.+|..|+||+..+
T Consensus        75 ~~~~~~l~G~g~nGKStl~   93 (304)
T TIGR01613        75 EQKLFFLYGNGGNGKSTFQ   93 (304)
T ss_pred             ceEEEEEECCCCCcHHHHH
Confidence            3456889999999998776


No 457
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=41.18  E-value=19  Score=28.06  Aligned_cols=26  Identities=42%  Similarity=0.676  Sum_probs=18.4

Q ss_pred             HhhcCCCeeE------EeeccCCCCCce---eecc
Q psy12524         39 NAFQGYNACI------FAYGQTGSGKSY---TMMG   64 (151)
Q Consensus        39 ~~~~G~~~~v------~~yG~~~sGKt~---t~~G   64 (151)
                      .++.|.|-+|      ...|++||||+.   ++.|
T Consensus        18 eILkgvnL~v~~GEvhaiMGPNGsGKSTLa~~i~G   52 (251)
T COG0396          18 EILKGVNLTVKEGEVHAIMGPNGSGKSTLAYTIMG   52 (251)
T ss_pred             hhhcCcceeEcCCcEEEEECCCCCCHHHHHHHHhC
Confidence            4566776665      567999999964   4455


No 458
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional
Probab=41.13  E-value=35  Score=29.29  Aligned_cols=25  Identities=20%  Similarity=0.337  Sum_probs=18.0

Q ss_pred             HHhhcCC-CeeEEeeccCCCCCceee
Q psy12524         38 DNAFQGY-NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        38 ~~~~~G~-~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+-.|. ..+++.+|+.|+|||.+.
T Consensus        32 ~~i~~~ri~ha~Lf~GP~GtGKTTlA   57 (484)
T PRK14956         32 NALKSGKIGHAYIFFGPRGVGKTTIA   57 (484)
T ss_pred             HHHHcCCCCeEEEEECCCCCCHHHHH
Confidence            3334444 346899999999999776


No 459
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=41.11  E-value=11  Score=27.93  Aligned_cols=16  Identities=38%  Similarity=0.551  Sum_probs=13.1

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|||||..+
T Consensus        32 ~~~l~G~nGsGKSTLl   47 (218)
T cd03255          32 FVAIVGPSGSGKSTLL   47 (218)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            4567799999999776


No 460
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]
Probab=41.10  E-value=1.2e+02  Score=22.01  Aligned_cols=13  Identities=31%  Similarity=0.419  Sum_probs=10.8

Q ss_pred             eeccCCCCCceee
Q psy12524         50 AYGQTGSGKSYTM   62 (151)
Q Consensus        50 ~yG~~~sGKt~t~   62 (151)
                      ..|..+||||..+
T Consensus         7 ivG~k~SGKTTLi   19 (161)
T COG1763           7 IVGYKNSGKTTLI   19 (161)
T ss_pred             EEecCCCChhhHH
Confidence            3489999999877


No 461
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=41.03  E-value=11  Score=28.27  Aligned_cols=18  Identities=28%  Similarity=0.412  Sum_probs=14.0

Q ss_pred             CeeEEeeccCCCCCceee
Q psy12524         45 NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+...|.+|||||..+
T Consensus        31 Ge~~~l~G~nGsGKSTLl   48 (233)
T cd03258          31 GEIFGIIGRSGAGKSTLI   48 (233)
T ss_pred             CCEEEEECCCCCCHHHHH
Confidence            335567799999999776


No 462
>COG1162 Predicted GTPases [General function prediction only]
Probab=41.03  E-value=38  Score=27.21  Aligned_cols=64  Identities=20%  Similarity=0.286  Sum_probs=34.5

Q ss_pred             HHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHHHHHHhhcCCCceEEEEEEEEEE-ECCeeee
Q psy12524         37 LDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEI-YNEKVHD  109 (151)
Q Consensus        37 v~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf~~~~~~~~~~~~~~v~~S~~ei-y~e~v~D  109 (151)
                      +...+.|.  +....|++|-||+..+      .-|.|..-...=. +.+....+...+-...++.+ .+..|.|
T Consensus       158 l~~~l~~~--~svl~GqSGVGKSSLi------N~L~p~~~~~t~e-IS~~~~rGkHTTt~~~l~~l~~gG~iiD  222 (301)
T COG1162         158 LAELLAGK--ITVLLGQSGVGKSTLI------NALLPELNQKTGE-ISEKLGRGRHTTTHVELFPLPGGGWIID  222 (301)
T ss_pred             HHHHhcCC--eEEEECCCCCcHHHHH------HhhCchhhhhhhh-hcccCCCCCCccceEEEEEcCCCCEEEe
Confidence            34556666  3445699999999888      4444432222211 22222233344455666666 3555555


No 463
>PF04670 Gtr1_RagA:  Gtr1/RagA G protein conserved region;  InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1. RCC1 catalyzes guanine nucleotide exchange on Ran, a well characterised nuclear Ras-like small G protein that plays an essential role in the import and export of proteins and RNAs across the nuclear membrane through the nuclear pore complex. RCC1 is located inside the nucleus, bound to chromatin. The concentration of GTP within the cell is ~30 times higher than the concentration of GDP, thus resulting in the preferential production of the GTP form of Ran by RCC1 within the nucleus. Gtr1p is located within both the cytoplasm and the nucleus and has been reported to play a role in cell growth. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1 and Rag A and Gtr1p belong to the sixth subfamily of the Ras-like small GTPase superfamily []. ; GO: 0005525 GTP binding, 0005634 nucleus, 0005737 cytoplasm; PDB: 3R7W_B 2Q3F_B 3LLU_A.
Probab=41.00  E-value=13  Score=28.57  Aligned_cols=15  Identities=33%  Similarity=0.426  Sum_probs=12.8

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |+.+|..+||||...
T Consensus         2 iLLmG~~~SGKTSi~   16 (232)
T PF04670_consen    2 ILLMGPRRSGKTSIR   16 (232)
T ss_dssp             EEEEESTTSSHHHHH
T ss_pred             EEEEcCCCCChhhHH
Confidence            678999999999754


No 464
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=40.81  E-value=11  Score=34.01  Aligned_cols=17  Identities=35%  Similarity=0.481  Sum_probs=14.6

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...|++|+|||.|+
T Consensus       186 ~Vi~lVGpnGvGKTTTi  202 (767)
T PRK14723        186 GVLALVGPTGVGKTTTT  202 (767)
T ss_pred             eEEEEECCCCCcHHHHH
Confidence            46677899999999998


No 465
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP. This family consists of the BtuR, CobO, CobP proteins all of which are Cob(I)alamin (vitamin B12) adenosyltransferase, which is involved in cobalamin (vitamin B12) biosynthesis. This enzyme is a homodimer,  which catalyzes the adenosylation reaction: ATP + cob(I)alamin + H2O <= phosphate + diphosphate + adenosylcobalamin.
Probab=40.80  E-value=9.7  Score=27.57  Aligned_cols=19  Identities=32%  Similarity=0.564  Sum_probs=16.2

Q ss_pred             eeEEeeccCCCCCceeecc
Q psy12524         46 ACIFAYGQTGSGKSYTMMG   64 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~~G   64 (151)
                      +.+..|+.+|.|||+...|
T Consensus         3 G~i~vy~g~G~Gkt~~a~g   21 (159)
T cd00561           3 GLIQVYTGNGKGKTTAALG   21 (159)
T ss_pred             CEEEEECCCCCCHHHHHHH
Confidence            4688999999999999855


No 466
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=40.78  E-value=9.7  Score=27.43  Aligned_cols=27  Identities=30%  Similarity=0.369  Sum_probs=17.3

Q ss_pred             HHHHhhcCC---CeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGY---NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~---~~~v~~yG~~~sGKt~t~   62 (151)
                      -.+.++.|.   ....+.+|.+|+|||..+
T Consensus        20 ~~~~li~g~~~~g~l~~i~g~~g~GKT~~~   49 (193)
T PF13481_consen   20 PLDWLIDGLLPRGELTLIAGPPGSGKTTLA   49 (193)
T ss_dssp             ---EEETTEE-TTSEEEEEECSTSSHHHHH
T ss_pred             CcceeECCcccCCeEEEEEeCCCCCHHHHH
Confidence            334455443   235678899999999877


No 467
>cd00983 recA RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange.
Probab=40.74  E-value=27  Score=28.26  Aligned_cols=29  Identities=38%  Similarity=0.458  Sum_probs=22.0

Q ss_pred             HHHHHHhhc--CC--CeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQ--GY--NACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~--G~--~~~v~~yG~~~sGKt~t~   62 (151)
                      .+-++.++.  |.  ...+..||++|||||..+
T Consensus        40 i~~LD~~Lg~GGlp~G~iteI~Gp~GsGKTtLa   72 (325)
T cd00983          40 SLSLDIALGIGGYPKGRIIEIYGPESSGKTTLA   72 (325)
T ss_pred             CHHHHHHhcCCCccCCeEEEEECCCCCCHHHHH
Confidence            466778776  54  345779999999999766


No 468
>KOG0925|consensus
Probab=40.74  E-value=18  Score=31.42  Aligned_cols=20  Identities=40%  Similarity=0.501  Sum_probs=18.0

Q ss_pred             CCCeeEEeeccCCCCCceee
Q psy12524         43 GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..|.+++.-|.||||||.-+
T Consensus        60 ~~nQ~~v~vGetgsGKttQi   79 (699)
T KOG0925|consen   60 LNNQIIVLVGETGSGKTTQI   79 (699)
T ss_pred             hcCceEEEEecCCCCccccC
Confidence            67899999999999999766


No 469
>TIGR01587 cas3_core CRISPR-associated helicase Cas3. This model represents the highly conserved core region of an alignment of Cas3, a protein found in association with CRISPR repeat elements in a broad range of bacteria and archaea. Cas3 appears to be a helicase, with regions found by pfam00270 (DEAD/DEAH box helicase) and pfam00271 (Helicase conserved C-terminal domain). Some but not all members have an N-terminal HD domain region (pfam01966) that is not included within this model.
Probab=40.59  E-value=14  Score=29.53  Aligned_cols=15  Identities=27%  Similarity=0.344  Sum_probs=12.3

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..++||||||...
T Consensus         2 vvi~apTGsGKT~~~   16 (358)
T TIGR01587         2 LVIEAPTGYGKTEAA   16 (358)
T ss_pred             EEEEeCCCCCHHHHH
Confidence            567789999999764


No 470
>KOG0335|consensus
Probab=40.58  E-value=14  Score=31.55  Aligned_cols=58  Identities=22%  Similarity=0.370  Sum_probs=34.7

Q ss_pred             hcCCCeeEEeeccCCCCCceeeccC---------CC---------CCCcHH-----HHHHHHHHHHHhhcCCCceEEEEE
Q psy12524         41 FQGYNACIFAYGQTGSGKSYTMMGS---------QD---------NKGIIP-----RLCDSLFDLIAKQESSELTYKVEV   97 (151)
Q Consensus        41 ~~G~~~~v~~yG~~~sGKt~t~~G~---------~~---------~~Gli~-----~~~~~lf~~~~~~~~~~~~~~v~~   97 (151)
                      .+|..  ++++++||||||.-...+         ..         .|+.+-     -.+..||......     .+...+
T Consensus       109 ~~Grd--l~acAqTGsGKT~aFLiPii~~~~~~~~~~~~~~~~~~~P~~lIlapTReL~~Qi~nea~k~-----~~~s~~  181 (482)
T KOG0335|consen  109 SGGRD--LMACAQTGSGKTAAFLIPIISYLLDEGPEDRGESGGGVYPRALILAPTRELVDQIYNEARKF-----SYLSGM  181 (482)
T ss_pred             ecCCc--eEEEccCCCcchHHHHHHHHHHHHhcCcccCcccCCCCCCceEEEeCcHHHhhHHHHHHHhh-----cccccc
Confidence            34444  489999999999887552         00         121111     1345666655422     455677


Q ss_pred             EEEEEECC
Q psy12524         98 SYMEIYNE  105 (151)
Q Consensus        98 S~~eiy~e  105 (151)
                      -...+|+.
T Consensus       182 ~~~~~ygg  189 (482)
T KOG0335|consen  182 KSVVVYGG  189 (482)
T ss_pred             eeeeeeCC
Confidence            78888866


No 471
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=40.58  E-value=10  Score=26.33  Aligned_cols=16  Identities=31%  Similarity=0.574  Sum_probs=13.5

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      -|+..|..++|||..+
T Consensus         2 ki~viG~~~~GKSsl~   17 (172)
T cd01862           2 KVIILGDSGVGKTSLM   17 (172)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3678899999999876


No 472
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=40.57  E-value=12  Score=34.39  Aligned_cols=26  Identities=27%  Similarity=0.500  Sum_probs=18.6

Q ss_pred             CeeEEeeccCCCCCceee-------ccCCCCCC
Q psy12524         45 NACIFAYGQTGSGKSYTM-------MGSQDNKG   70 (151)
Q Consensus        45 ~~~v~~yG~~~sGKt~t~-------~G~~~~~G   70 (151)
                      ....+-.|+||||||..+       +|..+..|
T Consensus        25 ~gi~lI~G~nGsGKSSIldAI~~ALyG~~~~~~   57 (908)
T COG0419          25 SGIFLIVGPNGAGKSSILDAITFALYGKTPRLG   57 (908)
T ss_pred             CCeEEEECCCCCcHHHHHHHHHHHHcCCCCCcc
Confidence            444567899999998665       67665444


No 473
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional
Probab=40.55  E-value=20  Score=31.10  Aligned_cols=21  Identities=29%  Similarity=0.510  Sum_probs=17.4

Q ss_pred             cCCCeeEEeeccCCCCCceee
Q psy12524         42 QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...+..|+..|.+||||+...
T Consensus       239 A~s~~pVLI~GE~GTGKe~~A  259 (538)
T PRK15424        239 ARSSAAVLIQGETGTGKELAA  259 (538)
T ss_pred             hCCCCcEEEECCCCCCHHHHH
Confidence            456778999999999997655


No 474
>PRK13947 shikimate kinase; Provisional
Probab=40.50  E-value=16  Score=25.84  Aligned_cols=16  Identities=31%  Similarity=0.372  Sum_probs=13.5

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .|+..|..|||||..-
T Consensus         3 ~I~l~G~~GsGKst~a   18 (171)
T PRK13947          3 NIVLIGFMGTGKTTVG   18 (171)
T ss_pred             eEEEEcCCCCCHHHHH
Confidence            4788899999998765


No 475
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=40.46  E-value=14  Score=26.84  Aligned_cols=15  Identities=33%  Similarity=0.403  Sum_probs=12.4

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      |..-|.+|||||...
T Consensus         2 i~i~G~sgsGKttla   16 (179)
T cd02028           2 VGIAGPSGSGKTTFA   16 (179)
T ss_pred             EEEECCCCCCHHHHH
Confidence            456799999999876


No 476
>KOG0328|consensus
Probab=40.38  E-value=32  Score=27.79  Aligned_cols=25  Identities=28%  Similarity=0.527  Sum_probs=19.4

Q ss_pred             HHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         36 ILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        36 lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      -|..++.|.++  +|-.++|+|||.+.
T Consensus        57 Ai~~IlkGrdV--iaQaqSGTGKTa~~   81 (400)
T KOG0328|consen   57 AIPQILKGRDV--IAQAQSGTGKTATF   81 (400)
T ss_pred             hhhhhhcccce--EEEecCCCCceEEE
Confidence            34457778875  77779999999887


No 477
>PF01078 Mg_chelatase:  Magnesium chelatase, subunit ChlI;  InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. As a result, it is thought that Mg-chelatase has an important role in channeling intermediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weights between 38-42 kDa.; GO: 0016851 magnesium chelatase activity, 0015979 photosynthesis, 0015995 chlorophyll biosynthetic process; PDB: 2X31_J 1G8P_A 3K1J_B.
Probab=40.32  E-value=24  Score=26.68  Aligned_cols=17  Identities=24%  Similarity=0.481  Sum_probs=12.6

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      -.++.+|..|+|||...
T Consensus        23 h~lLl~GppGtGKTmlA   39 (206)
T PF01078_consen   23 HHLLLIGPPGTGKTMLA   39 (206)
T ss_dssp             --EEEES-CCCTHHHHH
T ss_pred             CCeEEECCCCCCHHHHH
Confidence            36899999999999766


No 478
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=40.32  E-value=10  Score=26.01  Aligned_cols=16  Identities=31%  Similarity=0.625  Sum_probs=13.4

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .|+..|..|+|||..+
T Consensus         2 ki~~vG~~~vGKTsli   17 (168)
T cd04119           2 KVISMGNSGVGKSCII   17 (168)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3678899999999776


No 479
>PF05872 DUF853:  Bacterial protein of unknown function (DUF853);  InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold. This family is restricted to bacterial proteins, none of which have currently been characterised.
Probab=40.32  E-value=13  Score=31.75  Aligned_cols=14  Identities=43%  Similarity=0.750  Sum_probs=12.5

Q ss_pred             EeeccCCCCCceee
Q psy12524         49 FAYGQTGSGKSYTM   62 (151)
Q Consensus        49 ~~yG~~~sGKt~t~   62 (151)
                      +.-|.||||||-|+
T Consensus        23 LIaGATGTGKTvTL   36 (502)
T PF05872_consen   23 LIAGATGTGKTVTL   36 (502)
T ss_pred             eeeccCCCCceehH
Confidence            45699999999999


No 480
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional
Probab=40.25  E-value=23  Score=33.61  Aligned_cols=27  Identities=37%  Similarity=0.711  Sum_probs=20.2

Q ss_pred             HHHHHHhhcCCCeeEEeeccCCCCCceee
Q psy12524         34 RDILDNAFQGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        34 ~~lv~~~~~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ...|..++.|.++.+  .-+||+|||..-
T Consensus       466 ~eaI~aiL~GrDVLV--imPTGSGKSLcY  492 (1195)
T PLN03137        466 REIINATMSGYDVFV--LMPTGGGKSLTY  492 (1195)
T ss_pred             HHHHHHHHcCCCEEE--EcCCCccHHHHH
Confidence            356677889998644  448999999763


No 481
>PRK10689 transcription-repair coupling factor; Provisional
Probab=40.19  E-value=31  Score=32.77  Aligned_cols=37  Identities=19%  Similarity=0.214  Sum_probs=22.5

Q ss_pred             CCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCcee
Q psy12524         21 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYT   61 (151)
Q Consensus        21 ~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t   61 (151)
                      +...|.+....+.    .+.-.+....+++.|.+|+|||..
T Consensus       601 ~T~~Q~~aI~~il----~d~~~~~~~d~Ll~a~TGsGKT~v  637 (1147)
T PRK10689        601 TTPDQAQAINAVL----SDMCQPLAMDRLVCGDVGFGKTEV  637 (1147)
T ss_pred             CCHHHHHHHHHHH----HHhhcCCCCCEEEEcCCCcCHHHH
Confidence            3444444443333    333334455689999999999964


No 482
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion.
Probab=40.19  E-value=12  Score=22.92  Aligned_cols=15  Identities=33%  Similarity=0.496  Sum_probs=11.8

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++.+|..|+|||.+.
T Consensus         2 ~~~~g~~G~Gktt~~   16 (99)
T cd01983           2 IVVTGKGGVGKTTLA   16 (99)
T ss_pred             EEEECCCCCCHHHHH
Confidence            355677799999887


No 483
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF. Members of this protein family are PspF, the sigma-54-dependent transcriptional activator of the phage shock protein (psp) operon, in Escherichia coli and numerous other species. The psp operon is induced by a number of stress conditions, including heat shock, ethanol, and filamentous phage infection. Changed com_name to adhere to TIGR role notes conventions. 09/15/06 - DMH
Probab=40.13  E-value=20  Score=28.85  Aligned_cols=20  Identities=20%  Similarity=0.424  Sum_probs=17.0

Q ss_pred             CCCeeEEeeccCCCCCceee
Q psy12524         43 GYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        43 G~~~~v~~yG~~~sGKt~t~   62 (151)
                      ..+..|+..|.+||||+...
T Consensus        20 ~~~~pVLI~GE~GtGK~~lA   39 (329)
T TIGR02974        20 PLDRPVLIIGERGTGKELIA   39 (329)
T ss_pred             CCCCCEEEECCCCChHHHHH
Confidence            56777999999999998765


No 484
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit. This model represents the ATPase subunit of HslVU, while the proteasome-related peptidase subunit is HslV. Residues 54-61 of the model contain a P-loop ATP-binding motif. Cys-287 of E. coli (position 308 in the seed alignment), studied in PubMed:98389714, is Ser in other members of the seed alignment.
Probab=40.08  E-value=12  Score=31.60  Aligned_cols=17  Identities=35%  Similarity=0.475  Sum_probs=15.0

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.+|++|+|||...
T Consensus        48 ~~ILLiGppG~GKT~lA   64 (441)
T TIGR00390        48 KNILMIGPTGVGKTEIA   64 (441)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            56899999999998876


No 485
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=40.04  E-value=12  Score=27.46  Aligned_cols=16  Identities=38%  Similarity=0.517  Sum_probs=13.2

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|+|||..+
T Consensus        26 ~~~i~G~nGsGKSTLl   41 (206)
T TIGR03608        26 MYAIIGESGSGKSTLL   41 (206)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4567799999999876


No 486
>TIGR00174 miaA tRNA isopentenyltransferase (miaA). Catalyzes the first step in the modification of an adenosine near the anticodon to 2-methylthio-N6-isopentyladenosine.
Probab=40.03  E-value=15  Score=29.25  Aligned_cols=15  Identities=47%  Similarity=0.594  Sum_probs=12.9

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      ++..|+||||||...
T Consensus         2 i~i~G~t~~GKs~la   16 (287)
T TIGR00174         2 IFIMGPTAVGKSQLA   16 (287)
T ss_pred             EEEECCCCCCHHHHH
Confidence            578899999999765


No 487
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=39.99  E-value=10  Score=27.71  Aligned_cols=17  Identities=29%  Similarity=0.432  Sum_probs=15.0

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..++.+|..|+|||..+
T Consensus         6 ~kivv~G~~g~GKTtl~   22 (219)
T COG1100           6 FKIVVLGDGGVGKTTLL   22 (219)
T ss_pred             EEEEEEcCCCccHHHHH
Confidence            46889999999999877


No 488
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=39.95  E-value=13  Score=27.35  Aligned_cols=17  Identities=24%  Similarity=0.292  Sum_probs=14.7

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      -.+...|++|+|||..+
T Consensus        30 ~~~~l~G~Ng~GKStll   46 (202)
T cd03243          30 RLLLITGPNMGGKSTYL   46 (202)
T ss_pred             eEEEEECCCCCccHHHH
Confidence            45678899999999988


No 489
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=39.88  E-value=12  Score=27.54  Aligned_cols=16  Identities=31%  Similarity=0.443  Sum_probs=13.2

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|||||..+
T Consensus        28 ~~~i~G~nGsGKSTLl   43 (205)
T cd03226          28 IIALTGKNGAGKTTLA   43 (205)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4567799999999876


No 490
>COG1660 Predicted P-loop-containing kinase [General function prediction only]
Probab=39.86  E-value=48  Score=26.30  Aligned_cols=34  Identities=26%  Similarity=0.553  Sum_probs=23.3

Q ss_pred             eEEeeccCCCCCceee-----ccCC----CCCCcHHHHHHHHH
Q psy12524         47 CIFAYGQTGSGKSYTM-----MGSQ----DNKGIIPRLCDSLF   80 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~-----~G~~----~~~Gli~~~~~~lf   80 (151)
                      .|+.-|.+|+|||--+     .|.-    =.+.|+|..++-+.
T Consensus         3 lvIVTGlSGAGKsvAl~~lEDlGyycvDNLPp~Llp~~~~~~~   45 (286)
T COG1660           3 LVIVTGLSGAGKSVALRVLEDLGYYCVDNLPPQLLPKLADLML   45 (286)
T ss_pred             EEEEecCCCCcHHHHHHHHHhcCeeeecCCCHHHHHHHHHHHh
Confidence            3678899999999877     3422    24677777776444


No 491
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=39.79  E-value=10  Score=26.26  Aligned_cols=16  Identities=19%  Similarity=0.436  Sum_probs=13.2

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      +|...|..|+|||..+
T Consensus         1 ~i~~vG~~~~GKstLi   16 (167)
T cd04160           1 SVLILGLDNAGKTTFL   16 (167)
T ss_pred             CEEEEecCCCCHHHHH
Confidence            3567899999999876


No 492
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional
Probab=39.77  E-value=33  Score=28.28  Aligned_cols=21  Identities=24%  Similarity=0.233  Sum_probs=15.5

Q ss_pred             cCCC-eeEEeeccCCCCCceee
Q psy12524         42 QGYN-ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        42 ~G~~-~~v~~yG~~~sGKt~t~   62 (151)
                      .|.- .+++-+|+.|+|||...
T Consensus        34 ~~~~~ha~lf~Gp~G~GKtt~A   55 (397)
T PRK14955         34 MGRVGHGYIFSGLRGVGKTTAA   55 (397)
T ss_pred             hCCcceeEEEECCCCCCHHHHH
Confidence            4443 35888999999999554


No 493
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=39.73  E-value=11  Score=28.66  Aligned_cols=16  Identities=44%  Similarity=0.534  Sum_probs=13.6

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      ....+|.+|||||-.+
T Consensus        24 ~~~i~G~NGsGKStll   39 (247)
T cd03275          24 FTCIIGPNGSGKSNLM   39 (247)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            4568899999999886


No 494
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=39.73  E-value=12  Score=27.85  Aligned_cols=17  Identities=29%  Similarity=0.442  Sum_probs=13.6

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...|.+|||||..+
T Consensus        27 e~~~i~G~nGsGKSTLl   43 (220)
T cd03265          27 EIFGLLGPNGAGKTTTI   43 (220)
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            34567799999999777


No 495
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair]
Probab=39.60  E-value=13  Score=30.42  Aligned_cols=40  Identities=23%  Similarity=0.414  Sum_probs=26.0

Q ss_pred             CCCCHHHHHHHHhHHHHHHhh-cCCCeeEEeeccCCCCCceee
Q psy12524         21 NFASQEKVFDALGRDILDNAF-QGYNACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        21 ~~~~q~~vy~~~~~~lv~~~~-~G~~~~v~~yG~~~sGKt~t~   62 (151)
                      .+.++.+-=.+....+|+.++ .|+.  ++.||.+|.|||..+
T Consensus        66 ~~~~~~eWdrs~~P~lId~~fr~g~~--~~~~gdsg~GKttll  106 (402)
T COG3598          66 EAMRLSEWDRSNSPQLIDEFFRKGYV--SILYGDSGVGKTTLL  106 (402)
T ss_pred             hhcChhhcCcccChhhhhHHhhcCee--EEEecCCcccHhHHH
Confidence            333443332344466777765 4654  478999999999887


No 496
>PLN02165 adenylate isopentenyltransferase
Probab=39.59  E-value=15  Score=29.86  Aligned_cols=16  Identities=44%  Similarity=0.571  Sum_probs=13.7

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .++..|+||||||...
T Consensus        45 iivIiGPTGSGKStLA   60 (334)
T PLN02165         45 VVVIMGATGSGKSRLS   60 (334)
T ss_pred             EEEEECCCCCcHHHHH
Confidence            5777899999999766


No 497
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=39.39  E-value=12  Score=27.11  Aligned_cols=16  Identities=31%  Similarity=0.532  Sum_probs=12.9

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|||||..+
T Consensus        20 ~~~i~G~nGsGKSTLl   35 (190)
T TIGR01166        20 VLALLGANGAGKSTLL   35 (190)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3456799999999876


No 498
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=39.39  E-value=12  Score=27.98  Aligned_cols=17  Identities=29%  Similarity=0.466  Sum_probs=13.7

Q ss_pred             eeEEeeccCCCCCceee
Q psy12524         46 ACIFAYGQTGSGKSYTM   62 (151)
Q Consensus        46 ~~v~~yG~~~sGKt~t~   62 (151)
                      ..+...|.+|||||..+
T Consensus        27 e~~~l~G~nGsGKSTLl   43 (232)
T cd03218          27 EIVGLLGPNGAGKTTTF   43 (232)
T ss_pred             cEEEEECCCCCCHHHHH
Confidence            34567799999999876


No 499
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=39.28  E-value=11  Score=26.03  Aligned_cols=15  Identities=20%  Similarity=0.251  Sum_probs=12.9

Q ss_pred             EEeeccCCCCCceee
Q psy12524         48 IFAYGQTGSGKSYTM   62 (151)
Q Consensus        48 v~~yG~~~sGKt~t~   62 (151)
                      +...|.+|+|||..+
T Consensus         3 i~vvG~~~~GKtsl~   17 (164)
T cd04101           3 CAVVGDPAVGKTAFV   17 (164)
T ss_pred             EEEECCCCCCHHHHH
Confidence            567899999999876


No 500
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=39.17  E-value=12  Score=27.77  Aligned_cols=16  Identities=31%  Similarity=0.499  Sum_probs=13.1

Q ss_pred             eEEeeccCCCCCceee
Q psy12524         47 CIFAYGQTGSGKSYTM   62 (151)
Q Consensus        47 ~v~~yG~~~sGKt~t~   62 (151)
                      .+...|.+|||||..+
T Consensus        32 ~~~i~G~nGsGKSTLl   47 (220)
T cd03293          32 FVALVGPSGCGKSTLL   47 (220)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4566799999999877


Done!