Query         psy12526
Match_columns 103
No_of_seqs    169 out of 1131
Neff          7.6 
Searched_HMMs 46136
Date          Fri Aug 16 21:35:34 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12526.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12526hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0245|consensus              100.0 5.8E-30 1.3E-34  208.5   9.3   87   15-103    28-116 (1221)
  2 cd01365 KISc_KIF1A_KIF1B Kines  99.9 1.9E-25 4.2E-30  168.3  10.8   88   16-103    26-115 (356)
  3 cd01368 KISc_KIF23_like Kinesi  99.9 2.2E-25 4.8E-30  167.6  10.4   63   34-103    53-115 (345)
  4 cd01370 KISc_KIP3_like Kinesin  99.9 1.6E-25 3.4E-30  167.9   9.2   63   34-103    52-114 (338)
  5 KOG4280|consensus               99.9 1.2E-25 2.6E-30  176.9   8.3   78   19-103    35-113 (574)
  6 KOG0241|consensus               99.9   1E-25 2.2E-30  183.2   7.8   89   15-103    28-120 (1714)
  7 cd01367 KISc_KIF2_like Kinesin  99.9 3.8E-25 8.3E-30  164.9   9.9   62   35-103    50-111 (322)
  8 cd01373 KISc_KLP2_like Kinesin  99.9 1.3E-24 2.8E-29  163.0  10.1   59   34-99     39-97  (337)
  9 KOG0243|consensus               99.9 9.3E-25   2E-29  179.2   7.8   62   35-103    94-163 (1041)
 10 KOG0239|consensus               99.9 1.3E-24 2.8E-29  174.4   8.0   73   23-103   347-420 (670)
 11 cd01376 KISc_KID_like Kinesin   99.9 4.5E-24 9.8E-29  158.8  10.0   63   34-103    45-107 (319)
 12 KOG0242|consensus               99.9 2.4E-24 5.2E-29  173.2   7.9   62   35-103    52-113 (675)
 13 cd01371 KISc_KIF3 Kinesin moto  99.9 8.6E-24 1.9E-28  158.1   9.2   78   19-103    31-111 (333)
 14 cd01374 KISc_CENP_E Kinesin mo  99.9   1E-23 2.2E-28  156.9   9.5   63   34-103    38-100 (321)
 15 PLN03188 kinesin-12 family pro  99.9 7.4E-24 1.6E-28  176.0   8.4   58   34-98    130-187 (1320)
 16 cd01369 KISc_KHC_KIF5 Kinesin   99.9 3.5E-23 7.5E-28  154.2   9.7   63   34-103    41-106 (325)
 17 cd00106 KISc Kinesin motor dom  99.9 6.5E-23 1.4E-27  152.4  10.9   77   20-103    29-105 (328)
 18 cd01372 KISc_KIF4 Kinesin moto  99.9 1.8E-23 3.9E-28  156.5   7.6   95    2-103     2-106 (341)
 19 cd01364 KISc_BimC_Eg5 Kinesin   99.9 6.4E-23 1.4E-27  154.3   9.8   60   34-100    46-105 (352)
 20 cd01375 KISc_KIF9_like Kinesin  99.9 3.8E-23 8.2E-28  154.8   8.3   62   34-103    46-110 (334)
 21 PF00225 Kinesin:  Kinesin moto  99.9 1.1E-22 2.4E-27  151.4   5.1   64   33-103    38-103 (335)
 22 cd01366 KISc_C_terminal Kinesi  99.9 1.1E-21 2.3E-26  146.3   9.9   63   33-103    42-104 (329)
 23 KOG0240|consensus               99.8 1.3E-21 2.8E-26  152.8   6.9   59   36-101    49-107 (607)
 24 smart00129 KISc Kinesin motor,  99.8 5.1E-21 1.1E-25  142.8   9.7   64   33-103    43-106 (335)
 25 COG5059 KIP1 Kinesin-like prot  99.8 8.9E-20 1.9E-24  144.8   6.5   62   35-103    55-116 (568)
 26 KOG0246|consensus               99.8 2.1E-19 4.5E-24  140.8   7.7   56   35-97    257-312 (676)
 27 KOG0247|consensus               99.7 7.1E-18 1.5E-22  135.0   7.0   63   34-103    79-141 (809)
 28 cd01363 Motor_domain Myosin an  99.7 5.6E-17 1.2E-21  112.6   5.2   43   60-103     8-50  (186)
 29 KOG0244|consensus               99.6 2.4E-16 5.2E-21  128.6   5.6   62   29-97     25-86  (913)
 30 PF00308 Bac_DnaA:  Bacterial d  96.4   0.002 4.4E-08   45.8   2.1   50   36-95      3-52  (219)
 31 PRK14086 dnaA chromosomal repl  96.0  0.0074 1.6E-07   49.2   3.4   51   35-95    282-332 (617)
 32 COG0556 UvrB Helicase subunit   95.9  0.0076 1.7E-07   48.6   3.2   48   36-95      3-50  (663)
 33 COG2805 PilT Tfp pilus assembl  95.9   0.004 8.6E-08   47.1   1.5   30   66-95    114-143 (353)
 34 PRK06620 hypothetical protein;  95.4   0.015 3.2E-07   41.3   2.9   51   35-96     10-63  (214)
 35 PRK09087 hypothetical protein;  95.4   0.017 3.8E-07   41.3   3.1   48   35-95     15-62  (226)
 36 COG2804 PulE Type II secretory  95.0   0.013 2.9E-07   46.7   1.7   30   67-96    248-277 (500)
 37 PRK06893 DNA replication initi  94.8   0.029 6.4E-07   39.9   3.0   24   72-95     34-57  (229)
 38 PF04851 ResIII:  Type III rest  94.8   0.016 3.5E-07   38.4   1.5   37   56-96      7-44  (184)
 39 cd00009 AAA The AAA+ (ATPases   94.5    0.03 6.4E-07   35.1   2.2   26   69-94     11-36  (151)
 40 TIGR02928 orc1/cdc6 family rep  94.4   0.032 6.8E-07   41.8   2.5   39   55-94     18-57  (365)
 41 PRK00411 cdc6 cell division co  94.4   0.038 8.3E-07   41.8   2.9   40   54-94     32-72  (394)
 42 PRK14088 dnaA chromosomal repl  94.3   0.035 7.5E-07   43.5   2.5   50   35-95     99-148 (440)
 43 PRK00149 dnaA chromosomal repl  93.9   0.041   9E-07   42.9   2.2   50   36-95    117-166 (450)
 44 PRK08084 DNA replication initi  93.8   0.073 1.6E-06   38.1   3.3   48   35-95     16-63  (235)
 45 PF01935 DUF87:  Domain of unkn  93.8   0.018 3.9E-07   40.5   0.1   16   80-95     26-41  (229)
 46 COG1484 DnaC DNA replication p  93.7   0.076 1.7E-06   38.7   3.3   40   53-95     84-123 (254)
 47 TIGR00362 DnaA chromosomal rep  93.7    0.05 1.1E-06   41.7   2.4   50   36-95    105-154 (405)
 48 COG1474 CDC6 Cdc6-related prot  93.6   0.064 1.4E-06   41.2   2.8   33   61-94     26-59  (366)
 49 PRK10436 hypothetical protein;  93.5   0.031 6.6E-07   44.2   0.9   28   68-95    209-236 (462)
 50 TIGR02533 type_II_gspE general  93.5   0.036 7.8E-07   44.0   1.3   28   68-95    233-260 (486)
 51 TIGR02538 type_IV_pilB type IV  93.3   0.036 7.8E-07   44.7   1.1   28   68-95    307-334 (564)
 52 PRK06526 transposase; Provisio  93.3   0.034 7.4E-07   40.5   0.9   20   74-95     97-116 (254)
 53 COG0593 DnaA ATPase involved i  93.2   0.059 1.3E-06   42.1   2.1   51   34-95     80-131 (408)
 54 TIGR01420 pilT_fam pilus retra  93.0   0.048   1E-06   41.3   1.2   28   68-95    113-140 (343)
 55 PRK08116 hypothetical protein;  93.0   0.076 1.7E-06   38.9   2.2   40   55-95     91-132 (268)
 56 PRK05642 DNA replication initi  92.9     0.1 2.3E-06   37.3   2.9   18   78-95     46-63  (234)
 57 TIGR02525 plasmid_TraJ plasmid  92.7   0.057 1.2E-06   41.6   1.4   19   77-95    149-167 (372)
 58 cd01129 PulE-GspE PulE/GspE Th  92.6   0.069 1.5E-06   39.1   1.5   27   69-95     72-98  (264)
 59 PF00437 T2SE:  Type II/IV secr  92.5   0.046   1E-06   39.5   0.6   29   66-95    117-145 (270)
 60 TIGR03420 DnaA_homol_Hda DnaA   92.3    0.16 3.4E-06   35.4   3.1   21   74-94     35-55  (226)
 61 PRK12377 putative replication   92.3    0.17 3.7E-06   36.8   3.3   39   55-95     81-119 (248)
 62 PRK08727 hypothetical protein;  92.2   0.057 1.2E-06   38.6   0.7   17   79-95     43-59  (233)
 63 TIGR02524 dot_icm_DotB Dot/Icm  92.1   0.072 1.6E-06   40.8   1.3   20   76-95    133-152 (358)
 64 PRK08181 transposase; Validate  92.1    0.18 3.9E-06   37.2   3.3   20   74-95    105-124 (269)
 65 PF00270 DEAD:  DEAD/DEAH box h  92.0   0.079 1.7E-06   34.8   1.2   26   68-95      7-32  (169)
 66 PRK14087 dnaA chromosomal repl  91.8     0.1 2.2E-06   41.0   1.9   50   37-96    111-160 (450)
 67 PRK07952 DNA replication prote  91.7    0.23 4.9E-06   36.1   3.4   39   55-95     79-117 (244)
 68 PRK06835 DNA replication prote  91.4    0.15 3.3E-06   38.6   2.3   36   58-95    166-201 (329)
 69 PRK13894 conjugal transfer ATP  91.2    0.12 2.5E-06   39.0   1.5   28   67-95    139-166 (319)
 70 PF01695 IstB_IS21:  IstB-like   91.0    0.19 4.2E-06   34.6   2.3   16   79-94     49-64  (178)
 71 TIGR02782 TrbB_P P-type conjug  90.8    0.11 2.3E-06   38.8   0.9   28   67-95    123-150 (299)
 72 PRK09183 transposase/IS protei  90.4    0.18 3.9E-06   36.7   1.8   22   72-95     99-120 (259)
 73 PRK08939 primosomal protein Dn  90.3    0.26 5.7E-06   36.9   2.7   39   56-95    135-174 (306)
 74 PRK12402 replication factor C   90.1    0.24 5.3E-06   36.4   2.3   21   74-94     33-53  (337)
 75 PRK08903 DnaA regulatory inact  89.9    0.29 6.3E-06   34.3   2.5   19   76-94     41-59  (227)
 76 PTZ00112 origin recognition co  89.9    0.26 5.7E-06   42.5   2.6   36   58-94    761-798 (1164)
 77 PF01637 Arch_ATPase:  Archaeal  89.9    0.11 2.3E-06   35.6   0.3   27   68-94     11-37  (234)
 78 PRK13833 conjugal transfer pro  89.8    0.24 5.1E-06   37.5   2.1   24   69-94    137-161 (323)
 79 PF00063 Myosin_head:  Myosin h  89.6    0.22 4.8E-06   40.9   2.0   22   73-94     81-102 (689)
 80 PF13245 AAA_19:  Part of AAA d  89.5    0.14 3.1E-06   30.5   0.6   16   80-95     13-28  (76)
 81 PF01580 FtsK_SpoIIIE:  FtsK/Sp  89.4   0.091   2E-06   36.4  -0.4   17   79-95     40-56  (205)
 82 COG5008 PilU Tfp pilus assembl  89.2     0.3 6.4E-06   36.9   2.2   30   66-95    116-145 (375)
 83 cd01130 VirB11-like_ATPase Typ  89.0    0.23 4.9E-06   34.1   1.4   27   67-95     16-43  (186)
 84 smart00242 MYSc Myosin. Large   88.9    0.41 8.9E-06   39.6   3.0   22   73-94     88-109 (677)
 85 PRK12723 flagellar biosynthesi  88.8    0.49 1.1E-05   36.7   3.2   19   77-95    174-192 (388)
 86 COG1419 FlhF Flagellar GTP-bin  88.8    0.29 6.3E-06   38.3   2.0   37   58-94    180-220 (407)
 87 PF05970 PIF1:  PIF1-like helic  88.7    0.35 7.5E-06   36.9   2.3   36   55-94      4-39  (364)
 88 smart00487 DEXDc DEAD-like hel  88.5    0.26 5.7E-06   32.3   1.4   17   79-95     26-42  (201)
 89 TIGR03015 pepcterm_ATPase puta  88.5    0.26 5.6E-06   35.1   1.5   23   73-95     39-61  (269)
 90 PF06048 DUF927:  Domain of unk  88.4    0.45 9.7E-06   35.1   2.7   34   61-95    178-211 (286)
 91 PRK12422 chromosomal replicati  88.0    0.68 1.5E-05   36.4   3.6   51   35-95    105-159 (445)
 92 PF07693 KAP_NTPase:  KAP famil  88.0    0.44 9.5E-06   34.9   2.4   20   75-94     18-37  (325)
 93 PF13191 AAA_16:  AAA ATPase do  87.9    0.11 2.4E-06   34.6  -0.7   27   68-94     15-41  (185)
 94 cd01383 MYSc_type_VIII Myosin   87.8    0.71 1.5E-05   38.3   3.7   21   74-94     89-109 (677)
 95 cd01377 MYSc_type_II Myosin mo  87.8     0.6 1.3E-05   38.8   3.3   21   73-93     87-107 (693)
 96 PHA00729 NTP-binding motif con  87.8    0.59 1.3E-05   33.8   2.9   30   65-94      5-34  (226)
 97 cd01384 MYSc_type_XI Myosin mo  87.7    0.66 1.4E-05   38.5   3.5   22   73-94     84-105 (674)
 98 PF13604 AAA_30:  AAA domain; P  87.7    0.22 4.8E-06   34.7   0.6   26   70-95     11-36  (196)
 99 PRK11776 ATP-dependent RNA hel  87.4     0.5 1.1E-05   36.7   2.6   23   69-93     35-57  (460)
100 cd00124 MYSc Myosin motor doma  87.4    0.68 1.5E-05   38.3   3.4   34   60-94     69-103 (679)
101 cd01385 MYSc_type_IX Myosin mo  87.3    0.69 1.5E-05   38.4   3.4   21   74-94     91-111 (692)
102 PRK06921 hypothetical protein;  87.3    0.24 5.2E-06   36.3   0.7   18   78-95    118-135 (266)
103 cd01381 MYSc_type_VII Myosin m  87.2    0.79 1.7E-05   38.0   3.7   22   73-94     82-103 (671)
104 PRK13851 type IV secretion sys  87.2    0.42 9.1E-06   36.5   1.9   27   67-95    153-180 (344)
105 cd01378 MYSc_type_I Myosin mot  87.0    0.79 1.7E-05   38.0   3.6   22   73-94     82-103 (674)
106 cd01382 MYSc_type_VI Myosin mo  86.9    0.69 1.5E-05   38.6   3.2   22   73-94     87-108 (717)
107 PRK13900 type IV secretion sys  86.8    0.52 1.1E-05   35.7   2.3   26   67-94    151-177 (332)
108 PHA02244 ATPase-like protein    86.8    0.96 2.1E-05   35.2   3.7   36   56-93    100-135 (383)
109 cd01380 MYSc_type_V Myosin mot  86.8    0.76 1.6E-05   38.2   3.4   21   73-93     82-102 (691)
110 PF06309 Torsin:  Torsin;  Inte  86.5       1 2.3E-05   29.8   3.3   16   78-93     53-69  (127)
111 PRK06547 hypothetical protein;  86.4    0.84 1.8E-05   31.3   2.9   25   69-93      7-31  (172)
112 cd01387 MYSc_type_XV Myosin mo  86.2    0.95 2.1E-05   37.5   3.7   22   73-94     83-104 (677)
113 COG4096 HsdR Type I site-speci  86.2     1.2 2.5E-05   37.9   4.1   37   58-95    166-203 (875)
114 PTZ00424 helicase 45; Provisio  86.1    0.63 1.4E-05   35.2   2.4   26   67-94     57-82  (401)
115 TIGR00348 hsdR type I site-spe  85.6    0.65 1.4E-05   38.3   2.4   30   65-95    247-281 (667)
116 TIGR03499 FlhF flagellar biosy  85.5    0.29 6.2E-06   36.1   0.3   17   79-95    196-212 (282)
117 PHA02653 RNA helicase NPH-II;   85.3    0.84 1.8E-05   37.9   2.9   33   55-93    163-195 (675)
118 PRK13764 ATPase; Provisional    85.2    0.38 8.2E-06   39.4   0.9   18   78-95    258-275 (602)
119 PF02562 PhoH:  PhoH-like prote  84.9     0.6 1.3E-05   33.2   1.7   17   77-93     19-35  (205)
120 PF00580 UvrD-helicase:  UvrD/R  84.8    0.24 5.2E-06   35.6  -0.4   20   76-95     12-31  (315)
121 PRK10590 ATP-dependent RNA hel  84.7    0.88 1.9E-05   35.5   2.7   23   69-93     32-54  (456)
122 PRK11192 ATP-dependent RNA hel  84.6    0.82 1.8E-05   35.2   2.5   23   69-93     32-54  (434)
123 PRK11448 hsdR type I restricti  84.5    0.53 1.1E-05   41.1   1.5   30   66-96    423-452 (1123)
124 cd00268 DEADc DEAD-box helicas  84.5    0.99 2.1E-05   30.7   2.6   22   70-93     31-52  (203)
125 PF06414 Zeta_toxin:  Zeta toxi  84.5    0.36 7.8E-06   33.4   0.4   19   76-94     14-32  (199)
126 PRK04837 ATP-dependent RNA hel  84.2    0.83 1.8E-05   35.1   2.3   23   69-93     39-61  (423)
127 KOG0989|consensus               84.1    0.94   2E-05   34.6   2.5   29   67-95     46-75  (346)
128 PRK00440 rfc replication facto  83.6    0.92   2E-05   33.0   2.3   21   74-94     35-55  (319)
129 COG4962 CpaF Flp pilus assembl  83.5    0.64 1.4E-05   35.7   1.4   27   67-94    164-190 (355)
130 PRK04328 hypothetical protein;  83.2     1.1 2.3E-05   32.3   2.5   26   67-92     10-38  (249)
131 PF13086 AAA_11:  AAA domain; P  83.0    0.48   1E-05   32.4   0.5   25   70-95     11-35  (236)
132 cd01386 MYSc_type_XVIII Myosin  82.9     1.4 2.9E-05   37.2   3.2   21   74-94     83-103 (767)
133 TIGR02640 gas_vesic_GvpN gas v  82.8     1.5 3.2E-05   31.8   3.1   29   63-93      9-37  (262)
134 COG1201 Lhr Lhr-like helicases  82.5     1.3 2.8E-05   37.7   2.9   23   69-93     31-53  (814)
135 PRK01297 ATP-dependent RNA hel  82.4     1.1 2.4E-05   35.1   2.4   25   67-93    116-140 (475)
136 PRK11634 ATP-dependent RNA hel  82.3     1.1 2.4E-05   36.7   2.5   23   69-93     37-59  (629)
137 PRK14722 flhF flagellar biosyn  82.2    0.48 1.1E-05   36.6   0.3   18   78-95    138-155 (374)
138 PRK10536 hypothetical protein;  82.1    0.95 2.1E-05   33.5   1.8   17   78-94     75-91  (262)
139 TIGR02237 recomb_radB DNA repa  82.0    0.98 2.1E-05   31.1   1.8   17   77-93     12-28  (209)
140 cd01123 Rad51_DMC1_radA Rad51_  82.0     1.3 2.8E-05   31.0   2.4   27   67-93      6-35  (235)
141 PF10923 DUF2791:  P-loop Domai  81.7     1.4   3E-05   34.6   2.7   38   56-94     29-66  (416)
142 TIGR00635 ruvB Holliday juncti  81.3     1.6 3.5E-05   31.8   2.9   41   53-94      5-47  (305)
143 PRK11331 5-methylcytosine-spec  81.2     1.8 3.8E-05   34.5   3.1   29   64-94    183-211 (459)
144 PLN03025 replication factor C   81.2     1.3 2.9E-05   32.9   2.4   17   79-95     36-52  (319)
145 TIGR02881 spore_V_K stage V sp  81.1    0.56 1.2E-05   33.8   0.3   17   78-94     43-59  (261)
146 cd01379 MYSc_type_III Myosin m  81.0     1.6 3.5E-05   36.1   2.9   21   74-94     83-103 (653)
147 COG1223 Predicted ATPase (AAA+  81.0    0.61 1.3E-05   35.2   0.5   22   72-93    146-167 (368)
148 KOG0335|consensus               80.8    0.79 1.7E-05   36.6   1.1   21   73-95    109-129 (482)
149 KOG2543|consensus               80.6    0.54 1.2E-05   36.9   0.1   18   77-94     30-47  (438)
150 PRK09270 nucleoside triphospha  80.0     3.3 7.2E-05   29.2   4.0   36   58-93     13-49  (229)
151 PRK04537 ATP-dependent RNA hel  80.0     1.5 3.3E-05   35.4   2.5   23   69-93     40-62  (572)
152 PF10236 DAP3:  Mitochondrial r  79.9     1.4 3.1E-05   32.9   2.1   24   72-95     18-41  (309)
153 TIGR02688 conserved hypothetic  79.8     2.9 6.3E-05   33.2   3.9   27   67-95    201-227 (449)
154 KOG3859|consensus               79.7    0.88 1.9E-05   34.6   1.0   24   71-94     36-59  (406)
155 PTZ00014 myosin-A; Provisional  79.7     2.2 4.8E-05   36.2   3.4   20   74-93    180-199 (821)
156 PHA02544 44 clamp loader, smal  79.6     1.4   3E-05   32.3   2.0   18   77-94     43-60  (316)
157 TIGR00614 recQ_fam ATP-depende  79.5     1.9   4E-05   33.9   2.8   23   69-93     20-42  (470)
158 PRK06067 flagellar accessory p  79.3     1.7 3.7E-05   30.6   2.3   26   67-92     12-40  (234)
159 PRK05580 primosome assembly pr  79.2     1.4 2.9E-05   36.5   2.0   34   54-94    146-179 (679)
160 TIGR02903 spore_lon_C ATP-depe  79.2     1.7 3.7E-05   35.6   2.6   27   68-94    166-192 (615)
161 TIGR00631 uvrb excinuclease AB  79.2     1.1 2.5E-05   36.9   1.6   39   53-96     10-48  (655)
162 PLN00206 DEAD-box ATP-dependen  79.1     2.1 4.6E-05   34.1   3.0   24   68-93    151-174 (518)
163 COG1125 OpuBA ABC-type proline  79.1    0.47   1E-05   35.5  -0.6   13   83-95     33-45  (309)
164 PRK11057 ATP-dependent DNA hel  78.8     1.8   4E-05   35.2   2.6   23   69-93     34-56  (607)
165 PRK09361 radB DNA repair and r  78.4     2.4 5.2E-05   29.6   2.8   27   67-93     10-39  (225)
166 PF02367 UPF0079:  Uncharacteri  78.4     2.6 5.7E-05   27.6   2.8   17   78-94     16-32  (123)
167 TIGR01242 26Sp45 26S proteasom  78.3    0.75 1.6E-05   34.9   0.2   17   78-94    157-173 (364)
168 KOG2373|consensus               78.2       3 6.4E-05   32.8   3.4   28   67-95    261-291 (514)
169 KOG0926|consensus               77.8     1.4   3E-05   37.8   1.7   18   77-94    271-288 (1172)
170 PRK00771 signal recognition pa  77.7       4 8.6E-05   32.2   4.1   18   77-94     95-112 (437)
171 PF03215 Rad17:  Rad17 cell cyc  77.5     1.5 3.2E-05   35.3   1.7   29   66-94     32-62  (519)
172 TIGR02746 TraC-F-type type-IV   77.3    0.74 1.6E-05   38.2  -0.1   18   78-95    431-448 (797)
173 PF12774 AAA_6:  Hydrolytic ATP  77.3     1.7 3.7E-05   31.3   1.9   14   82-95     37-50  (231)
174 PF12775 AAA_7:  P-loop contain  77.2     1.9   4E-05   31.7   2.1   27   68-95     25-51  (272)
175 PRK05703 flhF flagellar biosyn  77.2    0.87 1.9E-05   35.6   0.3   17   79-95    223-239 (424)
176 PRK14974 cell division protein  76.9     4.1 8.9E-05   31.0   3.9   18   77-94    140-157 (336)
177 cd01127 TrwB Bacterial conjuga  76.8    0.81 1.8E-05   35.4   0.1   17   78-94     43-59  (410)
178 PF13555 AAA_29:  P-loop contai  76.6     1.4   3E-05   25.6   1.0   13   80-92     26-38  (62)
179 TIGR01618 phage_P_loop phage n  76.2     1.2 2.5E-05   32.1   0.7   20   77-96     12-31  (220)
180 PF02456 Adeno_IVa2:  Adenoviru  76.2     1.2 2.6E-05   34.2   0.8   15   80-94     90-104 (369)
181 PF13476 AAA_23:  AAA domain; P  76.1    0.96 2.1E-05   30.3   0.3   16   79-94     21-36  (202)
182 CHL00081 chlI Mg-protoporyphyr  76.0       2 4.2E-05   33.0   1.9   36   56-95     21-56  (350)
183 PRK11889 flhF flagellar biosyn  75.6     3.1 6.7E-05   32.9   3.0   18   78-95    242-259 (436)
184 PTZ00110 helicase; Provisional  75.6     2.5 5.4E-05   34.0   2.5   23   69-93    161-183 (545)
185 COG5019 CDC3 Septin family pro  75.5     2.1 4.6E-05   33.2   2.0   25   73-97     19-46  (373)
186 PRK13341 recombination factor   75.5     1.7 3.6E-05   36.5   1.5   21   74-94     49-69  (725)
187 PF05496 RuvB_N:  Holliday junc  75.5     5.8 0.00013   28.9   4.2   39   53-92     25-65  (233)
188 TIGR02788 VirB11 P-type DNA tr  75.4     2.2 4.9E-05   31.7   2.1   28   66-94    134-161 (308)
189 TIGR03819 heli_sec_ATPase heli  75.3     1.5 3.3E-05   33.3   1.2   29   66-95    168-196 (340)
190 TIGR03158 cas3_cyano CRISPR-as  75.3     2.7 5.9E-05   31.9   2.5   25   69-93      6-30  (357)
191 COG1219 ClpX ATP-dependent pro  75.2     1.4   3E-05   34.1   0.9   15   78-92     98-112 (408)
192 COG0513 SrmB Superfamily II DN  75.2     2.5 5.4E-05   33.8   2.4   24   67-92     58-81  (513)
193 PF05673 DUF815:  Protein of un  75.1     2.5 5.5E-05   31.0   2.2   25   70-94     44-69  (249)
194 PRK10917 ATP-dependent DNA hel  75.1     3.4 7.3E-05   34.2   3.2   37   53-93    262-298 (681)
195 KOG0953|consensus               74.8     1.5 3.3E-05   36.0   1.1   16   79-94    193-208 (700)
196 PF00931 NB-ARC:  NB-ARC domain  74.6     4.7  0.0001   28.8   3.6   29   65-93      5-35  (287)
197 TIGR03744 traC_PFL_4706 conjug  74.5    0.96 2.1E-05   38.5  -0.1   18   77-94    475-492 (893)
198 TIGR02902 spore_lonB ATP-depen  74.2     3.6 7.7E-05   33.1   3.1   24   70-93     79-102 (531)
199 PRK00080 ruvB Holliday junctio  74.2     1.3 2.8E-05   33.0   0.6   40   54-94     27-68  (328)
200 cd01394 radB RadB. The archaea  74.2     3.8 8.2E-05   28.4   2.9   27   67-93      6-35  (218)
201 cd03274 ABC_SMC4_euk Eukaryoti  74.1    0.82 1.8E-05   32.2  -0.5   13   82-94     30-42  (212)
202 PRK06995 flhF flagellar biosyn  74.1     1.1 2.5E-05   35.8   0.2   18   78-95    257-274 (484)
203 PRK04195 replication factor C   73.9     3.2   7E-05   32.7   2.8   29   66-94     27-56  (482)
204 PRK06696 uridine kinase; Valid  73.9     6.2 0.00013   27.7   4.0   34   58-92      4-37  (223)
205 COG1131 CcmA ABC-type multidru  73.9       1 2.2E-05   33.4  -0.1   12   83-94     37-48  (293)
206 PRK01172 ski2-like helicase; P  73.8     2.8   6E-05   34.4   2.4   22   70-93     32-53  (674)
207 COG0630 VirB11 Type IV secreto  73.7       1 2.2E-05   33.9  -0.1   27   67-95    135-161 (312)
208 PRK13342 recombination factor   73.7     2.8 6.2E-05   32.4   2.4   40   54-94     14-53  (413)
209 PRK10416 signal recognition pa  73.6     4.7  0.0001   30.4   3.5   18   78-95    115-132 (318)
210 TIGR01389 recQ ATP-dependent D  73.2     3.3 7.2E-05   33.4   2.7   23   69-93     22-44  (591)
211 cd01393 recA_like RecA is a  b  72.9     4.1 8.8E-05   28.3   2.8   28   67-94      6-36  (226)
212 TIGR03877 thermo_KaiC_1 KaiC d  72.9     3.8 8.3E-05   29.1   2.7   26   67-92      8-36  (237)
213 TIGR00643 recG ATP-dependent D  72.8     3.9 8.5E-05   33.4   3.0   37   53-93    236-272 (630)
214 PRK03992 proteasome-activating  72.8     1.7 3.7E-05   33.5   0.9   16   78-93    166-181 (389)
215 TIGR03878 thermo_KaiC_2 KaiC d  72.6     3.2   7E-05   30.1   2.3   16   77-92     36-51  (259)
216 PHA01747 putative ATP-dependen  72.2       3 6.5E-05   32.7   2.1   29   66-94    179-207 (425)
217 PRK13767 ATP-dependent helicas  72.0     3.4 7.4E-05   35.2   2.6   22   70-93     42-63  (876)
218 KOG0340|consensus               71.8     2.7 5.9E-05   32.8   1.8   27   67-95     36-62  (442)
219 TIGR03881 KaiC_arch_4 KaiC dom  71.8     3.8 8.2E-05   28.6   2.5   28   67-94      7-37  (229)
220 PRK13531 regulatory ATPase Rav  71.5     3.8 8.3E-05   33.0   2.6   28   64-93     28-55  (498)
221 PRK12724 flagellar biosynthesi  71.3     4.7  0.0001   31.9   3.0   18   78-95    224-241 (432)
222 PF00158 Sigma54_activat:  Sigm  71.3     2.2 4.8E-05   29.1   1.1   19   74-92     19-37  (168)
223 PRK10865 protein disaggregatio  71.2       4 8.6E-05   34.8   2.8   38   56-94    572-615 (857)
224 COG0396 sufC Cysteine desulfur  71.1     2.5 5.5E-05   31.0   1.4   29   71-99     18-55  (251)
225 cd00820 PEPCK_HprK Phosphoenol  70.6     1.7 3.6E-05   27.9   0.4   16   79-94     17-32  (107)
226 COG0467 RAD55 RecA-superfamily  70.3     3.7 8.1E-05   29.4   2.2   24   69-92     12-38  (260)
227 TIGR00929 VirB4_CagE type IV s  70.2     1.5 3.2E-05   36.3   0.1   18   77-94    434-451 (785)
228 PRK11664 ATP-dependent RNA hel  70.0     5.2 0.00011   34.0   3.2   27   66-94     11-37  (812)
229 CHL00181 cbbX CbbX; Provisiona  69.9       2 4.3E-05   31.8   0.7   14   80-93     62-75  (287)
230 TIGR02236 recomb_radA DNA repa  69.8     4.9 0.00011   29.6   2.8   27   67-93     82-111 (310)
231 PF10412 TrwB_AAD_bind:  Type I  69.8     1.2 2.6E-05   34.2  -0.5   16   80-95     18-33  (386)
232 PLN00020 ribulose bisphosphate  69.7     5.2 0.00011   31.5   2.9   36   58-93    125-164 (413)
233 PF06745 KaiC:  KaiC;  InterPro  69.3     2.2 4.7E-05   29.8   0.8   24   69-92      8-34  (226)
234 PRK15483 type III restriction-  69.3       1 2.2E-05   39.0  -1.1   14   83-96     65-78  (986)
235 TIGR02880 cbbX_cfxQ probable R  69.3     2.1 4.5E-05   31.6   0.7   16   79-94     60-75  (284)
236 KOG1547|consensus               69.3     8.5 0.00018   28.8   3.8   30   63-92     31-61  (336)
237 PF14532 Sigma54_activ_2:  Sigm  69.0     1.9 4.2E-05   27.9   0.4   19   75-93     19-37  (138)
238 COG3842 PotA ABC-type spermidi  69.0     1.1 2.4E-05   34.4  -0.8   13   83-95     37-49  (352)
239 TIGR01241 FtsH_fam ATP-depende  69.0     2.2 4.7E-05   33.8   0.8   16   79-94     90-105 (495)
240 PRK14723 flhF flagellar biosyn  68.9       2 4.3E-05   36.3   0.6   18   78-95    186-203 (767)
241 PHA02624 large T antigen; Prov  68.9     5.3 0.00011   33.2   2.9   27   67-93    419-447 (647)
242 PRK14721 flhF flagellar biosyn  68.8     1.8   4E-05   34.0   0.3   18   78-95    192-209 (420)
243 PRK12726 flagellar biosynthesi  68.8     1.8   4E-05   33.9   0.3   17   79-95    208-224 (407)
244 PRK09401 reverse gyrase; Revie  68.8     4.5 9.9E-05   35.7   2.7   23   68-92     88-110 (1176)
245 TIGR00376 DNA helicase, putati  68.8     3.2   7E-05   34.2   1.7   16   80-95    176-191 (637)
246 TIGR00602 rad24 checkpoint pro  68.8     2.7 5.9E-05   34.7   1.3   16   79-94    112-127 (637)
247 KOG0354|consensus               68.5     4.8  0.0001   34.0   2.7   24   67-93     69-92  (746)
248 PF11406 Tachystatin_A:  Antimi  68.3     1.1 2.3E-05   23.6  -0.7   16   71-86      4-19  (44)
249 PF02534 T4SS-DNA_transf:  Type  67.9       5 0.00011   31.2   2.6   18   78-95     45-62  (469)
250 PRK09302 circadian clock prote  67.9     4.7  0.0001   32.0   2.4   26   67-92     18-46  (509)
251 PTZ00454 26S protease regulato  67.7     2.4 5.3E-05   32.9   0.8   18   77-94    179-196 (398)
252 PF01293 PEPCK_ATP:  Phosphoeno  67.5     2.6 5.7E-05   33.6   1.0   21   79-99    212-239 (466)
253 PTZ00361 26 proteosome regulat  67.5     1.7 3.7E-05   34.3  -0.0   16   79-94    219-234 (438)
254 COG3829 RocR Transcriptional r  67.4     4.5 9.8E-05   33.0   2.3   19   72-90    263-281 (560)
255 TIGR01970 DEAH_box_HrpB ATP-de  67.1     5.1 0.00011   34.1   2.6   26   66-93      8-33  (819)
256 TIGR03238 dnd_assoc_3 dnd syst  67.1     3.1 6.7E-05   33.5   1.3   26   70-95     19-50  (504)
257 COG1122 CbiO ABC-type cobalt t  67.0     3.2 6.9E-05   30.0   1.2   14   79-92     32-45  (235)
258 TIGR02238 recomb_DMC1 meiotic   66.8     7.3 0.00016   29.3   3.2   26   67-92     83-111 (313)
259 KOG0924|consensus               66.7     3.6 7.8E-05   34.9   1.6   20   75-94    369-388 (1042)
260 TIGR00064 ftsY signal recognit  66.6     2.3   5E-05   31.2   0.5   17   78-94     73-89  (272)
261 PRK11034 clpA ATP-dependent Cl  66.6     8.1 0.00018   32.6   3.7   37   56-93    462-504 (758)
262 cd03240 ABC_Rad50 The catalyti  66.6     3.4 7.3E-05   28.8   1.3   16   79-94     24-39  (204)
263 TIGR02655 circ_KaiC circadian   66.4     5.5 0.00012   31.6   2.6   26   67-92      8-36  (484)
264 KOG0987|consensus               66.1     7.2 0.00016   31.5   3.2   35   54-93    119-153 (540)
265 TIGR02639 ClpA ATP-dependent C  65.4       8 0.00017   32.3   3.4   37   56-93    458-500 (731)
266 cd03279 ABC_sbcCD SbcCD and ot  65.3     2.3   5E-05   29.6   0.3   16   79-94     30-45  (213)
267 TIGR02012 tigrfam_recA protein  65.3     6.7 0.00014   29.8   2.7   28   66-93     40-71  (321)
268 PRK13721 conjugal transfer ATP  65.0     2.1 4.6E-05   36.2   0.0   15   80-94    452-466 (844)
269 PRK05342 clpX ATP-dependent pr  65.0     3.1 6.6E-05   32.6   0.9   16   78-93    109-124 (412)
270 PRK04301 radA DNA repair and r  65.0     7.2 0.00016   29.0   2.9   27   67-93     89-118 (317)
271 TIGR03880 KaiC_arch_3 KaiC dom  64.9     6.4 0.00014   27.4   2.5   24   69-92      5-31  (224)
272 TIGR03117 cas_csf4 CRISPR-asso  64.9     6.6 0.00014   32.6   2.8   32   56-93      1-32  (636)
273 TIGR03345 VI_ClpV1 type VI sec  64.7      10 0.00023   32.4   4.0   37   56-93    570-612 (852)
274 cd01853 Toc34_like Toc34-like   64.6     2.7 5.9E-05   30.5   0.5   38   53-93     10-47  (249)
275 PRK14961 DNA polymerase III su  64.3     6.4 0.00014   29.9   2.5   36   55-94     19-55  (363)
276 KOG0780|consensus               64.3     7.4 0.00016   30.9   2.9   38   57-95     76-119 (483)
277 PRK10867 signal recognition pa  64.1      12 0.00026   29.6   4.0   18   77-94    100-117 (433)
278 PF02463 SMC_N:  RecF/RecN/SMC   64.0     3.6 7.8E-05   28.5   1.0   13   80-92     27-39  (220)
279 PF13166 AAA_13:  AAA domain     63.8     3.2 6.9E-05   34.0   0.8   12   81-92     20-31  (712)
280 cd03272 ABC_SMC3_euk Eukaryoti  63.8     2.6 5.6E-05   29.7   0.3   13   82-94     28-40  (243)
281 COG1198 PriA Primosomal protei  63.8     6.3 0.00014   33.2   2.5   32   55-92    201-232 (730)
282 PF00025 Arf:  ADP-ribosylation  63.6       7 0.00015   26.3   2.4   26   68-93      4-30  (175)
283 PRK11131 ATP-dependent RNA hel  63.5     3.8 8.2E-05   36.6   1.2   30   60-92     75-104 (1294)
284 COG3839 MalK ABC-type sugar tr  63.1     1.7 3.7E-05   33.2  -0.8   12   83-94     35-46  (338)
285 smart00763 AAA_PrkA PrkA AAA d  63.1      13 0.00029   28.7   4.0   36   56-92     55-93  (361)
286 COG1126 GlnQ ABC-type polar am  63.0     4.7  0.0001   29.5   1.4   12   82-93     33-44  (240)
287 PRK13873 conjugal transfer ATP  62.7     2.5 5.4E-05   35.6   0.0   15   80-94    444-458 (811)
288 TIGR02397 dnaX_nterm DNA polym  62.6     8.4 0.00018   28.5   2.8   36   55-94     17-53  (355)
289 KOG2655|consensus               62.6     6.4 0.00014   30.6   2.2   21   72-92     16-36  (366)
290 PRK13880 conjugal transfer cou  62.3     5.7 0.00012   32.8   2.0   18   78-95    176-193 (636)
291 cd03242 ABC_RecF RecF is a rec  62.3     3.1 6.7E-05   30.2   0.5   13   82-94     26-38  (270)
292 KOG0745|consensus               62.0     4.1 8.9E-05   32.8   1.1   18   73-92    224-241 (564)
293 PRK14970 DNA polymerase III su  61.6     8.3 0.00018   29.0   2.7   28   67-94     28-56  (367)
294 TIGR01243 CDC48 AAA family ATP  61.4     4.3 9.4E-05   33.7   1.2   17   78-94    213-229 (733)
295 PRK08533 flagellar accessory p  61.4     4.3 9.4E-05   28.9   1.1   17   77-93     24-40  (230)
296 cd00983 recA RecA is a  bacter  61.3     9.2  0.0002   29.1   2.9   27   66-92     40-70  (325)
297 KOG1803|consensus               61.2     3.6 7.8E-05   34.0   0.7   15   81-95    205-219 (649)
298 TIGR01425 SRP54_euk signal rec  61.1     6.9 0.00015   30.9   2.2   18   77-94    100-117 (429)
299 smart00489 DEXDc3 DEAD-like he  61.1     7.4 0.00016   28.7   2.3   37   53-95      9-45  (289)
300 smart00488 DEXDc2 DEAD-like he  61.1     7.4 0.00016   28.7   2.3   37   53-95      9-45  (289)
301 TIGR01054 rgy reverse gyrase.   60.8     7.7 0.00017   34.4   2.6   25   67-93     85-109 (1171)
302 COG1136 SalX ABC-type antimicr  60.7     4.4 9.5E-05   29.3   1.0   13   81-93     35-47  (226)
303 PRK13891 conjugal transfer pro  60.6     2.9 6.4E-05   35.5   0.1   16   79-94    490-505 (852)
304 PRK09354 recA recombinase A; P  60.6     9.5 0.00021   29.3   2.9   27   66-92     45-75  (349)
305 PRK11784 tRNA 2-selenouridine   60.6     5.2 0.00011   30.6   1.4   32   63-95    128-159 (345)
306 TIGR00580 mfd transcription-re  60.5     9.2  0.0002   33.1   3.0   21   74-94    469-489 (926)
307 PLN03187 meiotic recombination  60.5     9.6 0.00021   29.2   2.9   27   66-92    112-141 (344)
308 PRK15429 formate hydrogenlyase  60.4       7 0.00015   32.2   2.2   19   75-93    397-415 (686)
309 TIGR03817 DECH_helic helicase/  60.4       8 0.00017   32.5   2.6   24   68-93     44-67  (742)
310 TIGR00382 clpX endopeptidase C  60.1     4.2 9.2E-05   31.9   0.9   16   78-93    117-132 (413)
311 COG0552 FtsY Signal recognitio  59.8     5.4 0.00012   30.6   1.4   20   75-94    137-156 (340)
312 TIGR03689 pup_AAA proteasome A  59.7     4.1 8.9E-05   32.9   0.8   15   79-93    218-232 (512)
313 KOG0922|consensus               59.6     6.1 0.00013   32.9   1.7   18   77-94     66-83  (674)
314 TIGR00150 HI0065_YjeE ATPase,   59.6      11 0.00024   24.9   2.7   29   64-94     11-39  (133)
315 CHL00195 ycf46 Ycf46; Provisio  59.5     3.4 7.4E-05   33.1   0.3   16   78-93    260-275 (489)
316 KOG0729|consensus               59.4     5.5 0.00012   30.4   1.3   37   56-92    184-226 (435)
317 COG4555 NatA ABC-type Na+ tran  58.8     3.3 7.2E-05   30.1   0.1   21   72-94     25-45  (245)
318 KOG0923|consensus               58.6     6.9 0.00015   33.1   1.9   18   77-94    280-297 (902)
319 TIGR01967 DEAH_box_HrpA ATP-de  58.5      11 0.00025   33.7   3.3   24   67-92     74-97  (1283)
320 TIGR02759 TraD_Ftype type IV c  58.2     3.3 7.1E-05   33.7  -0.0   15   80-94    179-193 (566)
321 PRK12727 flagellar biosynthesi  58.1     3.7   8E-05   33.5   0.3   16   79-94    352-367 (559)
322 KOG1532|consensus               58.0     4.3 9.4E-05   30.9   0.6   18   77-94     19-36  (366)
323 PF14553 YqbF:  YqbF, hypotheti  57.8     5.3 0.00012   21.5   0.8    9   89-97      3-11  (43)
324 TIGR03783 Bac_Flav_CT_G Bacter  57.6     3.1 6.8E-05   35.4  -0.2   18   77-94    438-455 (829)
325 cd02019 NK Nucleoside/nucleoti  57.6     5.9 0.00013   22.7   1.0   13   81-93      3-15  (69)
326 PF00005 ABC_tran:  ABC transpo  57.3     5.7 0.00012   25.1   1.0   13   80-92     14-26  (137)
327 PRK10689 transcription-repair   57.0      10 0.00022   33.6   2.7   37   53-93    601-637 (1147)
328 TIGR03346 chaperone_ClpB ATP-d  57.0      13 0.00027   31.8   3.2   37   56-93    569-611 (852)
329 PRK13853 type IV secretion sys  56.9     3.2   7E-05   34.9  -0.3   16   79-94    428-443 (789)
330 PRK13830 conjugal transfer pro  56.7     3.8 8.3E-05   34.7   0.2   18   77-94    456-473 (818)
331 PTZ00035 Rad51 protein; Provis  56.6      13 0.00029   28.1   3.1   28   66-93    104-134 (337)
332 COG0610 Type I site-specific r  56.4     2.6 5.7E-05   36.4  -0.9   14   82-95    278-291 (962)
333 TIGR00554 panK_bact pantothena  56.3      11 0.00023   28.2   2.4   17   78-94     63-79  (290)
334 TIGR02621 cas3_GSU0051 CRISPR-  56.1     7.7 0.00017   33.2   1.8   25   68-93     23-47  (844)
335 COG1222 RPT1 ATP-dependent 26S  55.8     5.7 0.00012   31.0   1.0   34   58-91    161-199 (406)
336 TIGR02639 ClpA ATP-dependent C  55.8      10 0.00022   31.6   2.5   39   53-95    183-221 (731)
337 TIGR01243 CDC48 AAA family ATP  55.6     5.8 0.00013   33.0   1.0   15   79-93    489-503 (733)
338 TIGR01817 nifA Nif-specific re  55.6     9.5 0.00021   30.4   2.2   19   75-93    217-235 (534)
339 PF05872 DUF853:  Bacterial pro  55.4     5.3 0.00011   32.1   0.7   14   82-95     24-37  (502)
340 TIGR00959 ffh signal recogniti  55.2     6.4 0.00014   31.0   1.1   18   77-94     99-116 (428)
341 cd00984 DnaB_C DnaB helicase C  55.2      11 0.00023   26.4   2.2   24   70-93      4-29  (242)
342 TIGR01074 rep ATP-dependent DN  54.9     4.2 9.2E-05   33.2   0.1   18   78-95     15-32  (664)
343 cd03239 ABC_SMC_head The struc  54.7     6.2 0.00013   27.0   0.9   13   82-94     27-39  (178)
344 TIGR00763 lon ATP-dependent pr  54.7      17 0.00038   30.5   3.7   15   79-93    349-363 (775)
345 COG1118 CysA ABC-type sulfate/  54.4     3.3 7.3E-05   31.7  -0.5   13   82-94     33-45  (345)
346 PF13481 AAA_25:  AAA domain; P  54.3     5.3 0.00012   26.9   0.5   28   67-94     19-49  (193)
347 KOG0330|consensus               54.2     7.4 0.00016   30.8   1.3   23   69-93     92-114 (476)
348 COG5022 Myosin heavy chain [Cy  54.2      21 0.00045   32.5   4.1   32   60-92    135-167 (1463)
349 KOG1800|consensus               53.9      12 0.00026   29.7   2.4   21   68-88    101-121 (468)
350 cd03275 ABC_SMC1_euk Eukaryoti  53.8     7.2 0.00016   27.8   1.2   13   81-93     26-38  (247)
351 TIGR02767 TraG-Ti Ti-type conj  53.5       9 0.00019   31.7   1.8   19   77-95    211-229 (623)
352 PLN02165 adenylate isopentenyl  53.1     6.7 0.00015   30.0   0.9   15   79-93     45-59  (334)
353 cd03278 ABC_SMC_barmotin Barmo  53.1     4.5 9.8E-05   28.0   0.0   13   82-94     27-39  (197)
354 COG2256 MGS1 ATPase related to  53.1     7.7 0.00017   30.7   1.3   39   53-92     25-63  (436)
355 PRK05973 replicative DNA helic  53.1      10 0.00023   27.4   1.9   22   71-92     56-79  (237)
356 COG1074 RecB ATP-dependent exo  53.0     5.4 0.00012   35.0   0.5   19   77-95     16-34  (1139)
357 PRK13537 nodulation ABC transp  53.0     3.4 7.3E-05   30.7  -0.7   13   82-94     38-50  (306)
358 TIGR00390 hslU ATP-dependent p  53.0     6.5 0.00014   31.2   0.9   16   78-93     48-63  (441)
359 cd01121 Sms Sms (bacterial rad  52.9     7.6 0.00016   30.0   1.2   29   67-95     69-100 (372)
360 PF13654 AAA_32:  AAA domain; P  52.9     4.5 9.8E-05   32.5   0.0   39   54-95     10-48  (509)
361 PF03193 DUF258:  Protein of un  52.9      11 0.00023   25.9   1.8   23   69-93     29-51  (161)
362 cd03241 ABC_RecN RecN ATPase i  52.7     5.7 0.00012   28.9   0.5   18   74-94     21-38  (276)
363 cd03238 ABC_UvrA The excision   52.5     4.6 9.9E-05   27.8  -0.0   14   81-94     25-38  (176)
364 cd03225 ABC_cobalt_CbiO_domain  52.4     3.2 6.9E-05   28.6  -0.8   12   82-93     32-43  (211)
365 CHL00176 ftsH cell division pr  52.4     6.4 0.00014   32.5   0.8   16   79-94    218-233 (638)
366 KOG2035|consensus               52.2      19  0.0004   27.6   3.1   15   79-93     36-50  (351)
367 TIGR02239 recomb_RAD51 DNA rep  52.1      20 0.00042   27.0   3.3   28   67-94     83-113 (316)
368 PLN03137 ATP-dependent DNA hel  51.9      13 0.00028   33.1   2.6   26   66-93    466-491 (1195)
369 PRK12337 2-phosphoglycerate ki  51.9      10 0.00022   30.4   1.8   19   76-94    254-272 (475)
370 PRK11823 DNA repair protein Ra  51.8      14  0.0003   29.2   2.5   28   67-94     67-97  (446)
371 cd03276 ABC_SMC6_euk Eukaryoti  51.7     5.4 0.00012   27.7   0.2   13   82-94     26-38  (198)
372 KOG0344|consensus               51.5     8.1 0.00017   31.7   1.2   23   69-93    167-189 (593)
373 COG0419 SbcC ATPase involved i  51.4     8.2 0.00018   33.0   1.3   13   80-92     28-40  (908)
374 PRK06851 hypothetical protein;  51.4     7.9 0.00017   29.9   1.1   28   68-95     21-48  (367)
375 PRK10463 hydrogenase nickel in  51.4      10 0.00022   28.4   1.7   26   69-94     95-121 (290)
376 PRK05537 bifunctional sulfate   51.3      13 0.00029   30.2   2.4   37   54-92    371-407 (568)
377 cd03243 ABC_MutS_homologs The   51.2     6.2 0.00013   27.2   0.5   17   78-94     30-46  (202)
378 TIGR02030 BchI-ChlI magnesium   51.1      18  0.0004   27.5   3.0   37   55-95      7-43  (337)
379 PRK13889 conjugal transfer rel  51.0     9.4  0.0002   33.3   1.6   27   68-95    354-380 (988)
380 COG4152 ABC-type uncharacteriz  50.9     6.6 0.00014   29.4   0.6   15   80-94     30-45  (300)
381 PF01078 Mg_chelatase:  Magnesi  50.7      20 0.00043   25.6   3.0   21   70-92     17-37  (206)
382 PRK06731 flhF flagellar biosyn  50.7     5.5 0.00012   29.4   0.1   18   78-95     76-93  (270)
383 COG0444 DppD ABC-type dipeptid  50.4     4.1 8.8E-05   31.0  -0.6   12   83-94     37-48  (316)
384 TIGR00960 3a0501s02 Type II (G  50.4     3.6 7.8E-05   28.5  -0.8   12   82-93     34-45  (216)
385 PRK10869 recombination and rep  50.3     8.9 0.00019   31.1   1.3   16   74-92     22-37  (553)
386 PHA02774 E1; Provisional        50.3      13 0.00027   30.8   2.1   25   69-93    424-450 (613)
387 COG3587 Restriction endonuclea  50.2     6.9 0.00015   33.7   0.7   17   76-94     75-91  (985)
388 COG1137 YhbG ABC-type (unclass  50.2      10 0.00022   27.6   1.4   13   83-95     36-48  (243)
389 KOG0925|consensus               49.9      11 0.00024   30.9   1.7   19   75-93     60-78  (699)
390 PRK13822 conjugal transfer cou  49.9      11 0.00025   31.2   1.8   19   77-95    224-242 (641)
391 PLN02200 adenylate kinase fami  49.8     7.9 0.00017   27.7   0.8   15   78-92     44-58  (234)
392 PRK13946 shikimate kinase; Pro  49.6     8.2 0.00018   26.2   0.9   15   79-93     12-26  (184)
393 COG1119 ModF ABC-type molybden  49.5     6.7 0.00014   29.0   0.4   18   73-92     55-72  (257)
394 KOG0160|consensus               49.4      13 0.00028   32.0   2.1   24   71-94     88-111 (862)
395 PRK14701 reverse gyrase; Provi  49.2      15 0.00032   33.8   2.6   24   67-92     86-109 (1638)
396 PRK10820 DNA-binding transcrip  49.1      13 0.00028   29.8   2.0   19   75-93    225-243 (520)
397 cd03273 ABC_SMC2_euk Eukaryoti  49.0      10 0.00022   27.0   1.3   17   74-93     25-41  (251)
398 TIGR02858 spore_III_AA stage I  49.0     6.1 0.00013   29.1   0.2   16   79-94    113-128 (270)
399 KOG0735|consensus               49.0     8.1 0.00018   33.0   0.9   17   77-93    701-717 (952)
400 cd03264 ABC_drug_resistance_li  49.0     3.9 8.4E-05   28.2  -0.9   13   81-93     29-41  (211)
401 PRK13536 nodulation factor exp  48.9       4 8.7E-05   30.9  -0.8   12   83-94     73-84  (340)
402 COG5519 Superfamily II helicas  48.9      39 0.00085   27.8   4.7   40   55-95    167-206 (562)
403 cd03258 ABC_MetN_methionine_tr  48.7     6.3 0.00014   27.6   0.2   13   81-93     35-47  (233)
404 KOG0951|consensus               48.7      43 0.00093   30.6   5.1   56   36-92    282-340 (1674)
405 PRK11034 clpA ATP-dependent Cl  48.7      13 0.00028   31.5   2.0   16   81-96    211-226 (758)
406 PRK13898 type IV secretion sys  48.7     6.1 0.00013   33.3   0.1   17   78-94    447-463 (800)
407 PRK14962 DNA polymerase III su  48.7      19 0.00041   28.7   2.9   17   78-94     37-53  (472)
408 KOG0739|consensus               48.6     8.4 0.00018   29.8   0.9   31   62-92    147-181 (439)
409 TIGR02329 propionate_PrpR prop  48.6      13 0.00029   30.0   2.0   20   74-93    232-251 (526)
410 TIGR03743 SXT_TraD conjugative  48.6     5.9 0.00013   32.7   0.0   18   77-94    176-193 (634)
411 PRK00254 ski2-like helicase; P  48.6      10 0.00022   31.4   1.4   20   72-93     36-55  (720)
412 cd03293 ABC_NrtD_SsuB_transpor  48.5     6.4 0.00014   27.3   0.2   13   81-93     34-46  (220)
413 TIGR00609 recB exodeoxyribonuc  48.3     3.9 8.4E-05   35.7  -1.1   16   81-96     13-28  (1087)
414 PRK13897 type IV secretion sys  48.3      14 0.00029   30.5   2.1   18   78-95    159-176 (606)
415 PRK13850 type IV secretion sys  48.3      12 0.00027   31.2   1.8   21   75-95    137-157 (670)
416 PLN03186 DNA repair protein RA  48.3      23  0.0005   27.1   3.2   27   67-93    110-139 (342)
417 TIGR02655 circ_KaiC circadian   48.0      15 0.00033   29.1   2.3   27   66-92    249-278 (484)
418 TIGR01188 drrA daunorubicin re  48.0     6.6 0.00014   28.9   0.2   13   82-94     24-36  (302)
419 KOG0328|consensus               47.9      18  0.0004   27.7   2.5   25   68-94     57-81  (400)
420 PF00176 SNF2_N:  SNF2 family N  47.7      14  0.0003   26.3   1.8   22   74-96     23-44  (299)
421 PF03969 AFG1_ATPase:  AFG1-lik  47.4     7.1 0.00015   30.0   0.3   16   79-94     64-79  (362)
422 TIGR03608 L_ocin_972_ABC putat  47.3     6.9 0.00015   26.7   0.2   13   81-93     28-40  (206)
423 cd03265 ABC_DrrA DrrA is the A  47.3     6.9 0.00015   27.2   0.2   13   81-93     30-42  (220)
424 COG0606 Predicted ATPase with   47.1      25 0.00055   28.4   3.3   22   70-93    193-214 (490)
425 PF04665 Pox_A32:  Poxvirus A32  47.1     7.4 0.00016   28.4   0.4   17   76-94     14-30  (241)
426 PRK07667 uridine kinase; Provi  47.0     8.9 0.00019   26.4   0.7   18   75-92     15-32  (193)
427 TIGR01288 nodI ATP-binding ABC  46.9       7 0.00015   28.8   0.2   13   82-94     35-47  (303)
428 cd03263 ABC_subfamily_A The AB  46.9     4.4 9.5E-05   28.1  -0.8   12   82-93     33-44  (220)
429 KOG0348|consensus               46.8      15 0.00033   30.3   2.1   23   68-92    167-189 (708)
430 cd03245 ABCC_bacteriocin_expor  46.7     4.4 9.5E-05   28.1  -0.9   13   82-94     35-47  (220)
431 KOG0652|consensus               46.6      10 0.00022   28.9   1.0   14   79-92    207-220 (424)
432 COG2204 AtoC Response regulato  46.6      11 0.00023   30.3   1.1   18   73-90    160-177 (464)
433 cd03226 ABC_cobalt_CbiO_domain  46.5     7.2 0.00016   26.8   0.2   13   81-93     30-42  (205)
434 PRK13538 cytochrome c biogenes  46.4     4.5 9.7E-05   27.9  -0.9   12   82-93     32-43  (204)
435 PRK10584 putative ABC transpor  46.3     4.5 9.8E-05   28.2  -0.8   13   81-93     40-52  (228)
436 PLN02748 tRNA dimethylallyltra  46.3     9.9 0.00021   30.4   1.0   15   78-92     23-37  (468)
437 PRK05022 anaerobic nitric oxid  46.3     8.6 0.00019   30.6   0.6   19   75-93    208-226 (509)
438 TIGR03598 GTPase_YsxC ribosome  46.2     6.7 0.00015   26.2   0.0   17   78-94     19-35  (179)
439 PRK02362 ski2-like helicase; P  46.2      17 0.00036   30.3   2.3   20   72-93     36-55  (737)
440 TIGR00678 holB DNA polymerase   46.1      25 0.00054   23.7   2.8   22   72-93      8-30  (188)
441 COG0411 LivG ABC-type branched  46.1      11 0.00025   27.7   1.2   12   83-94     36-47  (250)
442 COG1783 XtmB Phage terminase l  46.0     9.4  0.0002   30.0   0.8   16   79-94     26-41  (414)
443 cd01919 PEPCK Phosphoenolpyruv  46.0      13 0.00029   30.0   1.7   18   79-96    219-236 (515)
444 PRK05201 hslU ATP-dependent pr  45.9     9.1  0.0002   30.4   0.7   15   78-92     51-65  (443)
445 PRK05986 cob(I)alamin adenolsy  45.8     6.6 0.00014   27.7  -0.1   19   78-96     23-41  (191)
446 PF08423 Rad51:  Rad51;  InterP  45.5     7.4 0.00016   28.3   0.2   27   66-92     24-53  (256)
447 TIGR03522 GldA_ABC_ATP gliding  45.5     7.6 0.00016   28.6   0.2   13   82-94     33-45  (301)
448 PRK13539 cytochrome c biogenes  45.4     4.8  0.0001   27.8  -0.8   12   82-93     33-44  (207)
449 TIGR03864 PQQ_ABC_ATP ABC tran  45.4     4.8  0.0001   28.3  -0.8   12   82-93     32-43  (236)
450 cd03229 ABC_Class3 This class   45.3     7.7 0.00017   26.1   0.2   12   82-93     31-42  (178)
451 PLN02840 tRNA dimethylallyltra  45.3      11 0.00023   29.8   1.0   15   79-93     23-37  (421)
452 PRK11432 fbpC ferric transport  45.2     7.8 0.00017   29.5   0.2   12   83-94     38-49  (351)
453 cd01918 HprK_C HprK/P, the bif  45.2      15 0.00034   24.7   1.7   18   76-93     13-30  (149)
454 PRK10263 DNA translocase FtsK;  45.2     7.3 0.00016   35.0   0.1   16   79-94   1012-1027(1355)
455 TIGR03265 PhnT2 putative 2-ami  45.1     7.7 0.00017   29.5   0.2   13   82-94     35-47  (353)
456 TIGR01166 cbiO cobalt transpor  45.1     7.8 0.00017   26.2   0.2   12   82-93     23-34  (190)
457 cd03297 ABC_ModC_molybdenum_tr  45.0      12 0.00027   25.8   1.2   14   79-92     25-38  (214)
458 KOG1514|consensus               45.0      34 0.00074   29.1   3.8   30   67-96    410-441 (767)
459 cd03218 ABC_YhbG The ABC trans  44.9      13 0.00027   26.0   1.2   14   80-93     29-42  (232)
460 KOG1970|consensus               44.8      30 0.00065   28.7   3.4   44   52-95     78-128 (634)
461 cd03256 ABC_PhnC_transporter A  44.7     7.9 0.00017   27.1   0.2   12   82-93     32-43  (241)
462 COG4148 ModC ABC-type molybdat  44.6     9.8 0.00021   29.1   0.7   12   82-93     29-40  (352)
463 cd03269 ABC_putative_ATPase Th  44.6       8 0.00017   26.6   0.2   13   81-93     30-42  (210)
464 TIGR02768 TraA_Ti Ti-type conj  44.5      13 0.00028   31.3   1.4   27   69-96    361-387 (744)
465 cd03214 ABC_Iron-Siderophores_  44.4       5 0.00011   27.1  -0.8   12   82-93     30-41  (180)
466 PRK06645 DNA polymerase III su  44.4      22 0.00047   28.7   2.6   17   78-94     44-60  (507)
467 cd03221 ABCF_EF-3 ABCF_EF-3  E  44.4       5 0.00011   26.3  -0.8   14   81-94     30-43  (144)
468 PRK13700 conjugal transfer pro  44.3     7.2 0.00016   32.9  -0.1   16   80-95    188-203 (732)
469 PRK11650 ugpC glycerol-3-phosp  44.3     5.5 0.00012   30.3  -0.7   13   82-94     35-47  (356)
470 TIGR03754 conj_TOL_TraD conjug  44.1      11 0.00023   31.4   0.9   15   80-94    183-197 (643)
471 cd03255 ABC_MJ0796_Lo1CDE_FtsE  44.1      13 0.00029   25.6   1.2   13   81-93     34-46  (218)
472 PRK11607 potG putrescine trans  44.0     8.1 0.00018   29.7   0.2   14   81-94     49-62  (377)
473 PRK10876 recB exonuclease V su  44.0       5 0.00011   35.4  -1.1   13   83-95     23-35  (1181)
474 CHL00095 clpC Clp protease ATP  44.0      33 0.00071   29.1   3.7   36   56-92    513-554 (821)
475 cd04155 Arl3 Arl3 subfamily.    43.9      14 0.00031   24.0   1.3   18   77-94     14-31  (173)
476 cd03261 ABC_Org_Solvent_Resist  43.8     8.4 0.00018   27.0   0.2   13   81-93     30-42  (235)
477 COG0410 LivF ABC-type branched  43.8     8.6 0.00019   28.1   0.3   13   82-94     34-46  (237)
478 TIGR00634 recN DNA repair prot  43.8      12 0.00026   30.3   1.1   18   74-94     22-39  (563)
479 TIGR00416 sms DNA repair prote  43.7      15 0.00032   29.1   1.6   29   67-95     81-112 (454)
480 PRK14964 DNA polymerase III su  43.6      23 0.00049   28.5   2.6   20   74-93     31-51  (491)
481 cd03283 ABC_MutS-like MutS-lik  43.6     9.3  0.0002   26.6   0.4   16   79-94     27-42  (199)
482 PRK04220 2-phosphoglycerate ki  43.6      27 0.00058   26.4   2.9   17   76-92     91-107 (301)
483 PRK11022 dppD dipeptide transp  43.6     5.1 0.00011   30.1  -1.0   12   82-93     38-49  (326)
484 KOG2228|consensus               43.3      49  0.0011   26.0   4.2   35   56-94     32-66  (408)
485 TIGR02974 phageshock_pspF psp   43.1     9.8 0.00021   28.7   0.5   19   75-93     20-38  (329)
486 cd03222 ABC_RNaseL_inhibitor T  43.1     7.7 0.00017   26.6  -0.1   14   80-93     28-41  (177)
487 COG1866 PckA Phosphoenolpyruva  43.1      19 0.00041   29.1   2.0   21   79-99    229-256 (529)
488 PHA02558 uvsW UvsW helicase; P  43.1      21 0.00045   28.4   2.3   24   69-94    123-146 (501)
489 PRK11629 lolD lipoprotein tran  43.0     8.7 0.00019   26.9   0.2   13   81-93     39-51  (233)
490 cd03237 ABC_RNaseL_inhibitor_d  42.9     8.8 0.00019   27.5   0.2   14   80-93     28-41  (246)
491 PRK13876 conjugal transfer cou  42.8      18 0.00039   30.2   2.0   19   76-94    143-161 (663)
492 TIGR01073 pcrA ATP-dependent D  42.8       9  0.0002   31.8   0.3   19   77-95     17-35  (726)
493 COG1221 PspF Transcriptional r  42.8      25 0.00054   27.7   2.7   20   73-92     97-116 (403)
494 cd03292 ABC_FtsE_transporter F  42.7      14 0.00031   25.3   1.3   11   82-92     32-42  (214)
495 TIGR00611 recf recF protein. A  42.7      10 0.00022   29.1   0.5   14   81-94     27-40  (365)
496 PRK00064 recF recombination pr  42.7      10 0.00022   28.9   0.5   14   81-94     27-40  (361)
497 PRK09452 potA putrescine/sperm  42.6     8.7 0.00019   29.6   0.1   13   82-94     45-57  (375)
498 TIGR01650 PD_CobS cobaltochela  42.6      11 0.00025   28.7   0.8   26   66-93     55-80  (327)
499 PRK13650 cbiO cobalt transport  42.6     5.7 0.00012   28.9  -0.9   14   81-94     37-50  (279)
500 TIGR00750 lao LAO/AO transport  42.5      17 0.00037   26.8   1.7   15   80-94     37-51  (300)

No 1  
>KOG0245|consensus
Probab=99.96  E-value=5.8e-30  Score=208.46  Aligned_cols=87  Identities=43%  Similarity=0.741  Sum_probs=76.0

Q ss_pred             ccccCCEEEEecCCCCCCCCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         15 KQVRKQTTYLTGTGRSHLKPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .++.++.+.+.+|.....  ...|+||++|||||.+.|.+++|..||++++.++|+++|+|||+||||||||||||+|||
T Consensus        28 vqm~gn~ttii~~~~~k~--~~~FtfD~SYWS~d~edPhfAsQ~qVYedlg~~mL~~AfEGYN~ClFAYGQTGSGKSYTM  105 (1221)
T KOG0245|consen   28 VQMQGNTTTIINPKGSKD--APKFTFDYSYWSHDSEDPHFASQKQVYEDLGREMLDHAFEGYNVCLFAYGQTGSGKSYTM  105 (1221)
T ss_pred             EEecCCceeeecCCCccc--CCceecceeeecCCCCCCchhhHHHHHHHHhHHHHHHHhcccceEEEEeccCCCCcceee
Confidence            556666666655544222  344999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCC--CCCCC
Q psy12526         95 NGNG--PFPLI  103 (103)
Q Consensus        95 ~G~~--~~pGi  103 (103)
                      ||..  ++|||
T Consensus       106 MG~~~~~e~GI  116 (1221)
T KOG0245|consen  106 MGFQEPDEPGI  116 (1221)
T ss_pred             eccCCCCCCCc
Confidence            9998  89997


No 2  
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins. KIF1A (Unc104) transports synaptic vesicles to the nerve  terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively.
Probab=99.93  E-value=1.9e-25  Score=168.27  Aligned_cols=88  Identities=45%  Similarity=0.806  Sum_probs=73.1

Q ss_pred             cccCCEEEEecCCCCC--CCCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         16 QVRKQTTYLTGTGRSH--LKPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        16 ~~~~~~~~~~~~~~~~--~~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ...++.+.+..+....  ....+.|.||+|||+.++..+..++|++||+.++.|+|+++++|+|+|||||||||||||||
T Consensus        26 ~~~~~~v~v~~~~~~~~~~~~~~~f~FD~vf~~~~~~~~~~~tq~~vf~~~~~p~v~~~l~G~n~~i~ayGqtGSGKT~T  105 (356)
T cd01365          26 QMPGKVTTLKNPKAADATRKKPKSFSFDHSYWSHDSEDPHYASQEDVFEDLGRELLDHAFEGYNVCLFAYGQTGSGKSYT  105 (356)
T ss_pred             EECCCEEEEEcCCcccccccCceEEECCeEecccCCCCCCCCCHHHHHHHHHHHHHHHHhCCCceEEEEecCCCCCCeEE
Confidence            3344555665554311  23468999999999776666667999999999999999999999999999999999999999


Q ss_pred             eccCCCCCCC
Q psy12526         94 LNGNGPFPLI  103 (103)
Q Consensus        94 m~G~~~~pGi  103 (103)
                      |+|+..++||
T Consensus       106 m~G~~~~~Gl  115 (356)
T cd01365         106 MMGYKEEKGI  115 (356)
T ss_pred             ecCCCCCCch
Confidence            9999999997


No 3  
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup. Members of this group may play a role in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, a
Probab=99.93  E-value=2.2e-25  Score=167.58  Aligned_cols=63  Identities=22%  Similarity=0.423  Sum_probs=60.9

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      .++.|.||+||+       +.++|++||+.++.|+|+.+++|+|+||||||||||||||||+|+.+++||
T Consensus        53 ~~~~f~Fd~vf~-------~~~tq~~vy~~~~~p~v~~~l~G~n~ti~aYGqtGSGKTyTm~G~~~~~Gl  115 (345)
T cd01368          53 KETKFSFSKVFG-------PNTTQKEFFEGTALPLVQDLLKGKNSLLFTYGVTNSGKTYTMQGSPGDGGI  115 (345)
T ss_pred             CceEeecCeEEC-------CCCCHHHHHHHHHHHHHHHHhCCCceEEEEeCCCCCCCeEEecCCCCCCch
Confidence            578999999999       899999999999999999999999999999999999999999999999997


No 4  
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup. The yeast kinesin KIP3 plays a role in positioning the mitotic spindle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a sec
Probab=99.93  E-value=1.6e-25  Score=167.95  Aligned_cols=63  Identities=30%  Similarity=0.594  Sum_probs=60.8

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      .++.|.||+||+       +.++|++||+.+++|+|+++++|||+||||||||||||||||+|+.++|||
T Consensus        52 ~~~~f~Fd~vf~-------~~~~q~~vf~~~~~plv~~~~~G~n~~i~ayGqtGSGKTyTm~G~~~~~Gi  114 (338)
T cd01370          52 KELKYSFDRVFD-------ETSTQEEVYENTTKPLVDGVLNGYNATVFAYGATGAGKTHTMLGTDSDPGL  114 (338)
T ss_pred             CceEEEeccccC-------CCCCHHHHHHHHHHHHHHHHHCCCCceEEeeCCCCCCCeEEEcCCCCCCch
Confidence            468999999999       899999999999999999999999999999999999999999999999997


No 5  
>KOG4280|consensus
Probab=99.92  E-value=1.2e-25  Score=176.93  Aligned_cols=78  Identities=27%  Similarity=0.486  Sum_probs=68.6

Q ss_pred             CCEEEEecCCCCCCCCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccC-
Q psy12526         19 KQTTYLTGTGRSHLKPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGN-   97 (103)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~-   97 (103)
                      ..++.+.++.......++.|+||.||+       +.++|++||+.++.|+|+++++|||+||||||||||||||||+|+ 
T Consensus        35 ~~~~~l~~~~~~~~~~~~~ftfD~vf~-------~~stQ~dvy~~~~~~lV~svl~GyNgtvFaYGQTGsGKTyTM~G~~  107 (574)
T KOG4280|consen   35 HGRVSLKNPVAGIEGKPKSFTFDAVFD-------SDSTQDDVYQETVAPLVESVLEGYNGTVFAYGQTGSGKTYTMIGPD  107 (574)
T ss_pred             cceeeecCCcccccCCCCCceeeeeec-------CCCCHHHHHHHHhHHHHHHHhcccCceEEEeccCCCCCceEeeCCC
Confidence            355666666666667889999999998       899999999999999999999999999999999999999999999 


Q ss_pred             CCCCCC
Q psy12526         98 GPFPLI  103 (103)
Q Consensus        98 ~~~pGi  103 (103)
                      .+.-||
T Consensus       108 ~~~~Gi  113 (574)
T KOG4280|consen  108 PELRGL  113 (574)
T ss_pred             hhhCCc
Confidence            445554


No 6  
>KOG0241|consensus
Probab=99.92  E-value=1e-25  Score=183.22  Aligned_cols=89  Identities=55%  Similarity=0.915  Sum_probs=78.7

Q ss_pred             ccccCCEEEEecCCCC----CCCCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCC
Q psy12526         15 KQVRKQTTYLTGTGRS----HLKPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKT   90 (103)
Q Consensus        15 ~~~~~~~~~~~~~~~~----~~~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGK   90 (103)
                      .+++.++++++.|...    ..+.+|+|+||+||||.++..-..++|+.||+.++..+|+.+|+|||+||||||||||||
T Consensus        28 v~vd~~q~vl~~~pp~~~~~~~k~pktFAFDhcF~s~dpes~n~agQE~Vf~~lG~~il~naf~GyNaCifaYGQtGsGK  107 (1714)
T KOG0241|consen   28 VEVDKNQTVLHPPPPNHKIGESKGPKTFAFDHCFWSMDPESKNYAGQETVFKCLGEGILENAFQGYNACIFAYGQTGSGK  107 (1714)
T ss_pred             EEeccCceeecCCCccccccccCCCceeecccccccCCccccccccchhHHHhcchHHHHHHhhccceeeEEecccCCCc
Confidence            4566778888776443    224689999999999999777789999999999999999999999999999999999999


Q ss_pred             ceEeccCCCCCCC
Q psy12526         91 NYLLNGNGPFPLI  103 (103)
Q Consensus        91 T~Tm~G~~~~pGi  103 (103)
                      ||||||..++|||
T Consensus       108 sYsmmGt~~QpGi  120 (1714)
T KOG0241|consen  108 SYSMMGTAEQPGI  120 (1714)
T ss_pred             eeEeeccCCCCCc
Confidence            9999999999997


No 7  
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group. KIF2 is a protein expressed in neurons, which has been associated with axonal transport and neuron development; alternative splice forms have been implicated in lysosomal translocation. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found in the middle (M-type) of the protein chain. M-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second (KIF2 may be slower). To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and lo
Probab=99.92  E-value=3.8e-25  Score=164.86  Aligned_cols=62  Identities=31%  Similarity=0.512  Sum_probs=60.2

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      .+.|.||+||+       +.++|++||+.+++|+|+.+++|+|+||||||||||||||||+|+.+++||
T Consensus        50 ~~~f~FD~vf~-------~~~~q~~vf~~~~~plv~~~~~G~n~~i~ayGqtGSGKTyTm~G~~~~~Gl  111 (322)
T cd01367          50 KHTFRFDYVFD-------EAVTNEEVYRSTVKPLIPHVFEGGVATCFAYGQTGSGKTYTMLGDENQEGL  111 (322)
T ss_pred             CceEecceEEC-------CCCCHHHHHHHHHHHHHHHHhCCCceEEEeccCCCCCCceEecCcCCcCcc
Confidence            58999999999       899999999999999999999999999999999999999999999999997


No 8  
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup. Members of this subgroup seem to play a role in mitosis and meiosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second
Probab=99.92  E-value=1.3e-24  Score=162.96  Aligned_cols=59  Identities=41%  Similarity=0.849  Sum_probs=56.1

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCC
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGP   99 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~   99 (103)
                      +.+.|.||+|||       +.++|++||+.++.|+|+.+++|||+||||||||||||||||+|+..
T Consensus        39 ~~~~f~FD~vf~-------~~~~q~~vy~~~~~p~v~~~~~G~n~ti~aYGqTGSGKTyTm~G~~~   97 (337)
T cd01373          39 PPRMFTFDHVAD-------SNTNQEDVFQSVGKPLVEDCLSGYNGSIFAYGQTGSGKTYTMMGPSS   97 (337)
T ss_pred             CCcEEeCCeEeC-------CCCCHHHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCceEEecCCCC
Confidence            368999999999       89999999999999999999999999999999999999999999764


No 9  
>KOG0243|consensus
Probab=99.91  E-value=9.3e-25  Score=179.16  Aligned_cols=62  Identities=39%  Similarity=0.619  Sum_probs=58.3

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEecc--------CCCCCCC
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNG--------NGPFPLI  103 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G--------~~~~pGi  103 (103)
                      .|.|+||+||+       |.+.|++||+.++.|+|..++.|||||||||||||+||||||.|        .++.+||
T Consensus        94 ~k~ftFDkVFG-------pes~Q~d~Y~~~v~p~i~eVl~GyNCTIFAYGQTGTGKTyTMeG~~~~~~g~l~~~aGI  163 (1041)
T KOG0243|consen   94 DKTFTFDKVFG-------PESQQEDLYDQAVSPIIKEVLEGYNCTIFAYGQTGTGKTYTMEGGERKKNGELPSEAGI  163 (1041)
T ss_pred             cceeecceeeC-------cchhHHHHHHHHHHHHHHHHhccCCceEEEecCCCCCceeeeecCcccccCCCCccCCc
Confidence            68999999999       89999999999999999999999999999999999999999999        5666775


No 10 
>KOG0239|consensus
Probab=99.91  E-value=1.3e-24  Score=174.45  Aligned_cols=73  Identities=37%  Similarity=0.714  Sum_probs=62.0

Q ss_pred             EEecCCCCCCCCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEecc-CCCCC
Q psy12526         23 YLTGTGRSHLKPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNG-NGPFP  101 (103)
Q Consensus        23 ~~~~~~~~~~~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G-~~~~p  101 (103)
                      .+..|........+.|.||+||.       |.++|++||.++ .|+|.++++|||+||||||||||||||||.| +.+++
T Consensus       347 ~~~~~~~~~~~~~~~f~fdkVf~-------p~~sQ~~VF~e~-~~lv~S~lDGYnVCIFAYGQTGSGKTyTM~G~~~~~~  418 (670)
T KOG0239|consen  347 QVDSPDKGDKLEPQSFKFDKVFG-------PLASQDDVFEEV-SPLVQSALDGYNVCIFAYGQTGSGKTYTMSGPTPEDP  418 (670)
T ss_pred             EeecCCCCCCCccccceeeeecC-------CcccHHHHHHHH-HHHHHHHhcCcceeEEEecccCCCccccccCCCcccC
Confidence            33334333333345699999998       999999999997 6999999999999999999999999999999 79999


Q ss_pred             CC
Q psy12526        102 LI  103 (103)
Q Consensus       102 Gi  103 (103)
                      ||
T Consensus       419 Gi  420 (670)
T KOG0239|consen  419 GI  420 (670)
T ss_pred             Cc
Confidence            97


No 11 
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup. Members of this group might play a role in regulating chromosomal movement along microtubules in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through
Probab=99.91  E-value=4.5e-24  Score=158.85  Aligned_cols=63  Identities=29%  Similarity=0.470  Sum_probs=60.6

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      .++.|.||+||+       +.++|++||+.++.|+|+.+++|+|+||||||||||||||||+|+..++||
T Consensus        45 ~~~~f~FD~vf~-------~~~~q~~vy~~~~~plv~~~~~G~n~~i~ayG~tgSGKTyTm~G~~~~~Gl  107 (319)
T cd01376          45 ETKKYQFDAFYG-------TECTQEDIFSREVKPIVPHLLSGQNATVFAYGSTGAGKTHTMLGDPNEPGL  107 (319)
T ss_pred             CccEEecCeEEC-------CCCCHHHHHHHHHHHHHHHHhCCCceEEEEECCCCCCCcEEEeCCcCccch
Confidence            468999999999       889999999999999999999999999999999999999999999999997


No 12 
>KOG0242|consensus
Probab=99.90  E-value=2.4e-24  Score=173.21  Aligned_cols=62  Identities=35%  Similarity=0.689  Sum_probs=60.3

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      +..|.||+||+       +.++|++||+..++|+|+++++|||+||||||||||||||||+|..++|||
T Consensus        52 ~~~y~FD~VF~-------~~~t~~~VYe~~tkpiv~~~l~G~N~TVFAYG~TgSGKTyTM~G~~~~PGi  113 (675)
T KOG0242|consen   52 PEKYEFDRVFG-------EESTQEDVYERTTKPLLLSVLEGFNATVFAYGQTGSGKTYTMSGSEDDPGI  113 (675)
T ss_pred             ccceeeeeecC-------CCCCHHHHHHhccHHHHHHHhcCcccceeeecCCCCCCceEEeccCCCCCe
Confidence            58999999999       889999999999999999999999999999999999999999999999997


No 13 
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins. Subgroup of kinesins, which form heterotrimers composed of 2 kinesins and one non-motor accessory subunit. Kinesins II play important roles in ciliary transport, and have been implicated in neuronal transport, melanosome transport, the secretory pathway, and mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this group the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain
Probab=99.90  E-value=8.6e-24  Score=158.14  Aligned_cols=78  Identities=31%  Similarity=0.598  Sum_probs=67.3

Q ss_pred             CCEEEEecCCCCCCCCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCC
Q psy12526         19 KQTTYLTGTGRSHLKPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNG   98 (103)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~   98 (103)
                      ..++.+..+.......++.|.||+||+       +.++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+.
T Consensus        31 ~~~v~~~~~~~~~~~~~~~f~fd~vf~-------~~~~q~~vy~~~~~plv~~~~~G~n~~i~ayG~tgSGKTyTm~G~~  103 (333)
T cd01371          31 RGQVTVHNPKADAKEPPKVFTFDAVYD-------PNSTQEDVYNETARPLVDSVLEGYNGTIFAYGQTGTGKTFTMEGVR  103 (333)
T ss_pred             CCEEEEeCCcccccCCCceeeeccccC-------CCccHHHHHHHHHHHHHHHHhCCCceeEEecCCCCCCCcEeecCCC
Confidence            344555555443344678999999999       8899999999999999999999999999999999999999999998


Q ss_pred             C---CCCC
Q psy12526         99 P---FPLI  103 (103)
Q Consensus        99 ~---~pGi  103 (103)
                      .   ++||
T Consensus       104 ~~~~~~Gl  111 (333)
T cd01371         104 EPPELRGI  111 (333)
T ss_pred             Ccccccch
Confidence            7   8886


No 14 
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to
Probab=99.90  E-value=1e-23  Score=156.90  Aligned_cols=63  Identities=32%  Similarity=0.692  Sum_probs=60.8

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      ..+.|.||+||+       +.++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+..++||
T Consensus        38 ~~~~f~fd~vf~-------~~~~q~~vy~~~~~p~v~~~l~G~n~~i~ayG~tgSGKT~T~~G~~~~~Gl  100 (321)
T cd01374          38 PGQSFTFDRVFG-------GESTNREVYERIAKPVVRSALEGYNGTIFAYGQTSSGKTFTMSGDEQEPGI  100 (321)
T ss_pred             CCeEEecCeEEC-------CCCCHHHHHHHHHHHHHHHHHCCCceeEEeecCCCCCCceeccCCCCCCch
Confidence            469999999999       889999999999999999999999999999999999999999999999996


No 15 
>PLN03188 kinesin-12 family protein; Provisional
Probab=99.90  E-value=7.4e-24  Score=175.98  Aligned_cols=58  Identities=34%  Similarity=0.669  Sum_probs=55.2

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCC
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNG   98 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~   98 (103)
                      ..+.|.||+||+       +.++|++||+.++.|+|+.+++|||+||||||||||||||||+|+.
T Consensus       130 ~~qtFtFD~VFd-------p~aTQedVFe~vv~PLV~svLdGyNaTIFAYGQTGSGKTYTM~G~~  187 (1320)
T PLN03188        130 NGQTFTFDSIAD-------PESTQEDIFQLVGAPLVENCLAGFNSSVFAYGQTGSGKTYTMWGPA  187 (1320)
T ss_pred             eCcEEeCCeeeC-------CCCCHHHHHHHHHHHHHHHHhcCCcceeecCCCCCCCCCEeeCCCC
Confidence            458999999999       8999999999999999999999999999999999999999999963


No 16 
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup. Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-c
Probab=99.89  E-value=3.5e-23  Score=154.19  Aligned_cols=63  Identities=40%  Similarity=0.699  Sum_probs=59.9

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCC---CCCC
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGP---FPLI  103 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~---~pGi  103 (103)
                      ..+.|.||+|||       +.++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+..   ++||
T Consensus        41 ~~~~f~FD~vf~-------~~~~q~~vy~~~~~~~v~~~~~G~n~~i~ayG~tgSGKT~Tm~G~~~~~~~~Gi  106 (325)
T cd01369          41 DGKTFSFDRVFP-------PNTTQEDVYNFVAKPIVDDVLNGYNGTIFAYGQTGSGKTYTMEGPPGDPELKGI  106 (325)
T ss_pred             CceEEEcCeEEC-------CCCCHHHHHHHHHHHHHHHHHcCccceEEEeCCCCCCceEEecCCCCccccCCh
Confidence            468999999999       89999999999999999999999999999999999999999999988   7786


No 17 
>cd00106 KISc Kinesin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coil
Probab=99.89  E-value=6.5e-23  Score=152.36  Aligned_cols=77  Identities=36%  Similarity=0.635  Sum_probs=68.4

Q ss_pred             CEEEEecCCCCCCCCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCC
Q psy12526         20 QTTYLTGTGRSHLKPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGP   99 (103)
Q Consensus        20 ~~~~~~~~~~~~~~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~   99 (103)
                      +++++..+........+.|.||+||+       +.++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+.+
T Consensus        29 ~~v~~~~~~~~~~~~~~~f~fd~vf~-------~~~~q~~v~~~~~~~~v~~~~~G~~~~i~~yG~tgSGKT~tl~G~~~  101 (328)
T cd00106          29 KTVTLTPPKDGRKAGPKSFTFDHVFD-------PNSTQEDVYETTAKPLVESVLEGYNGTIFAYGQTGSGKTYTMFGSPK  101 (328)
T ss_pred             CEEEEecCccccCcCceEEECCeEEc-------CCCCHHHHHHHHHHHHHHHHhCCCceeEEEecCCCCCCeEEecCCCC
Confidence            56666655543444579999999999       88999999999999999999999999999999999999999999999


Q ss_pred             CCCC
Q psy12526        100 FPLI  103 (103)
Q Consensus       100 ~pGi  103 (103)
                      ++||
T Consensus       102 ~~Gl  105 (328)
T cd00106         102 DPGI  105 (328)
T ss_pred             CCch
Confidence            9997


No 18 
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Members of this group seem to perform a variety of functions, and have been implicated in neuronal organelle transport and chromosome segregation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain,
Probab=99.89  E-value=1.8e-23  Score=156.46  Aligned_cols=95  Identities=29%  Similarity=0.395  Sum_probs=71.1

Q ss_pred             CCccccccccCccccccCC--EEEEecCC--CCCCCCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCc
Q psy12526          2 PSRDTTRVYLPTAKQVRKQ--TTYLTGTG--RSHLKPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYN   77 (103)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~--~~~~~~~~--~~~~~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n   77 (103)
                      |.+-.+|+++....+..+.  .++...+.  .......+.|.||+|||       +.++|++||+.++.|+|+.+++|+|
T Consensus         2 ~i~V~vRvRP~~~~e~~~~~~~~~~~~~~~~~v~~~~~~~f~FD~vf~-------~~~~q~~vy~~~~~plv~~~~~G~n   74 (341)
T cd01372           2 SVRVAVRVRPLLPKELLEGCQVCVSVVPGEPQVTVGTDKSFTFDYVFD-------PSTSQEEVYNTCVAPLVDGLFEGYN   74 (341)
T ss_pred             CeEEEEECCCCCchhcccCCCeEEEEeCCCCEEEecCCcEEeccccCC-------CCCCHHHHHHHHHHHHHHHHhCCCc
Confidence            3444556666554443321  22222222  22223368999999999       8899999999999999999999999


Q ss_pred             EEEEeecCCCCCCceEeccCC------CCCCC
Q psy12526         78 ACIFAYGQTGEKTNYLLNGNG------PFPLI  103 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~G~~------~~pGi  103 (103)
                      +||||||||||||||||+|+.      .++||
T Consensus        75 ~~i~ayG~tgSGKT~Tm~G~~~~~~~~~~~Gi  106 (341)
T cd01372          75 ATVLAYGQTGSGKTYTMGTAFTASEDEEEVGI  106 (341)
T ss_pred             cceeeecCCCCCCcEEecCCCccccccccCCh
Confidence            999999999999999999984      46776


No 19 
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil d
Probab=99.89  E-value=6.4e-23  Score=154.26  Aligned_cols=60  Identities=40%  Similarity=0.658  Sum_probs=56.5

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCC
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPF  100 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~  100 (103)
                      ..+.|.||+||+       +.++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|....
T Consensus        46 ~~~~f~Fd~vf~-------~~~~q~~vy~~~~~plv~~~~~G~n~~i~ayG~tgSGKTyTl~G~~~~  105 (352)
T cd01364          46 STKTYTFDKVFG-------PEADQIEVYSQVVSPILDEVLMGYNCTIFAYGQTGTGKTYTMEGDRTD  105 (352)
T ss_pred             cceeEeccccCC-------CCCCHHHHHHHHHHHHHHHHhCCCeEEEEECCCCCCCCcEEecCCCcc
Confidence            568999999999       899999999999999999999999999999999999999999998543


No 20 
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 
Probab=99.89  E-value=3.8e-23  Score=154.80  Aligned_cols=62  Identities=39%  Similarity=0.695  Sum_probs=57.7

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCC---CCCCC
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNG---PFPLI  103 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~---~~pGi  103 (103)
                      ..+.|.||+||+       + ++|++||+.++.|+|+++++|+|+||||||||||||||||+|+.   .++||
T Consensus        46 ~~~~f~FD~vf~-------~-~~q~~vy~~~~~p~v~~~~~G~n~~i~ayG~tgSGKTyTm~G~~~~~~~~Gl  110 (334)
T cd01375          46 EDFSFKFDGVFH-------N-ASQEEVYETVAKPVVDSALDGYNGTIFAYGQTGAGKTFTMTGGTESYKDRGL  110 (334)
T ss_pred             CceEEEcCcccC-------C-CCHHHHHHHHHHHHHHHHhCCCccceeeecCCCCCCeEEccCCCCcccCCch
Confidence            457899999998       7 99999999999999999999999999999999999999999976   46776


No 21 
>PF00225 Kinesin:  Kinesin motor domain;  InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport. The kinesin motor activity is directed toward the microtubule's plus end. Kinesin is an oligomeric complex composed of two heavy chains and two light chains. The maintenance of the quaternary structure does not require interchain disulphide bonds. The heavy chain is composed of three structural domains: a large globular N-terminal domain which is responsible for the motor activity of kinesin (it is known to hydrolyse ATP, to bind and move on microtubules), a central alpha-helical coiled coil domain that mediates the heavy chain dimerisation; and a small globular C-terminal domain which interacts with other proteins (such as the kinesin light chains), vesicles and membranous organelles. A number of proteins have been recently found that contain a domain similar to that of the kinesin 'motor' domain [, ]:   Drosophila melanogaster claret segregational protein (ncd). Ncd is required for normal chromosomal segregation in meiosis, in females, and in early mitotic divisions of the embryo. The ncd motor activity is directed toward the microtubule's minus end.  Homo sapiens CENP-E []. CENP-E is a protein that associates with kinetochores during chromosome congression, relocates to the spindle midzone at anaphase, and is quantitatively discarded at the end of the cell division. CENP-E is probably an important motor molecule in chromosome movement and/or spindle elongation. H. sapiens mitotic kinesin-like protein-1 (MKLP-1), a motor protein whose activity is directed toward the microtubule's plus end.  Saccharomyces cerevisiae KAR3 protein, which is essential for nuclear fusion during mating. KAR3 may mediate microtubule sliding during nuclear fusion and possibly mitosis. S. cerevisiae CIN8 and KIP1 proteins which are required for the assembly of the mitotic spindle. Both proteins seem to interact with spindle microtubules to produce an outwardly directed force acting upon the poles.  Emericella nidulans (Aspergillus nidulans) bimC, which plays an important role in nuclear division. A. nidulans klpA.  Caenorhabditis elegans unc-104, which may be required for the transport of substances needed for neuronal cell differentiation. C. elegans osm-3.  Xenopus laevis Eg5, which may be involved in mitosis.  Arabidopsis thaliana KatA, KatB and katC.  Chlamydomonas reinhardtii FLA10/KHP1 and KLP1. Both proteins seem to play a role in the rotation or twisting of the microtubules of the flagella. C. elegans hypothetical protein T09A5.2.   The kinesin motor domain is located in the N-terminal part of most of the above proteins, with the exception of KAR3, klpA, and ncd where it is located in the C-terminal section. The kinesin motor domain contains about 330 amino acids. An ATP-binding motif of type A is found near position 80 to 90, the C-terminal half of the domain is involved in microtubule-binding.; GO: 0003777 microtubule motor activity, 0005524 ATP binding, 0007018 microtubule-based movement; PDB: 3NWN_A 2Y5W_A 2Y65_C 3BFN_A 2WBE_C 2ZFL_A 2ZFI_A 1I6I_A 2ZFM_A 1IA0_K ....
Probab=99.87  E-value=1.1e-22  Score=151.45  Aligned_cols=64  Identities=39%  Similarity=0.683  Sum_probs=59.8

Q ss_pred             CCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccC--CCCCCC
Q psy12526         33 KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGN--GPFPLI  103 (103)
Q Consensus        33 ~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~--~~~pGi  103 (103)
                      ...+.|.||+|||       +.++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+  ..++||
T Consensus        38 ~~~~~f~FD~vf~-------~~~~q~~vy~~~~~~~v~~~l~G~n~~i~ayG~tgSGKT~Tm~G~~~~~~~Gl  103 (335)
T PF00225_consen   38 QKEKSFRFDRVFD-------EDATQEDVYEEVVSPLVDSVLDGYNATIFAYGQTGSGKTYTMFGSNDPSEPGL  103 (335)
T ss_dssp             TEEEEEEESEEEE-------TTSTHHHHHHHHTHHHHHHHHTT-EEEEEEEESTTSSHHHHHTBSTSTTTBSH
T ss_pred             CCceEEEcCeEEC-------CCCCHHHHHHHHHHHHHHHhhcCCceEEEeeccccccccccccccccccccch
Confidence            3568999999999       899999999999999999999999999999999999999999999  889886


No 22 
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for mi
Probab=99.87  E-value=1.1e-21  Score=146.33  Aligned_cols=63  Identities=44%  Similarity=0.771  Sum_probs=59.3

Q ss_pred             CCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         33 KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        33 ~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      ...+.|.||+||+       +.++|++||+.+ .|+|+.+++|+|+||||||+|||||||||+|..+++||
T Consensus        42 ~~~~~f~fD~vf~-------~~~~q~~v~~~v-~p~v~~~~~G~~~~i~ayG~tgSGKT~tl~G~~~~~Gl  104 (329)
T cd01366          42 GKKKSFSFDRVFD-------PDASQEDVFEEV-SPLVQSALDGYNVCIFAYGQTGSGKTYTMEGPPENPGI  104 (329)
T ss_pred             CCceEEecCEEEC-------CCCCHHHHHHHH-HHHHHHHhCCCceEEEEeCCCCCCCcEEecCCCCCCCc
Confidence            3568999999999       899999999985 89999999999999999999999999999999999997


No 23 
>KOG0240|consensus
Probab=99.85  E-value=1.3e-21  Score=152.84  Aligned_cols=59  Identities=42%  Similarity=0.777  Sum_probs=56.7

Q ss_pred             ceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCC
Q psy12526         36 KTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFP  101 (103)
Q Consensus        36 ~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~p  101 (103)
                      +.|.||+||.       +.++|++||+.++.|+|+.+|.|||+||||||||||||||||.|...+|
T Consensus        49 ~~y~FDrVF~-------pnatQe~Vy~~~a~~Iv~dVL~GYNGTvfaYGqT~sGKTytm~G~~~d~  107 (607)
T KOG0240|consen   49 KTYVFDRVFS-------PNATQEDVYEFAAKPIVDDVLLGYNGTVFAYGQTGSGKTYTMEGIGHDP  107 (607)
T ss_pred             ccceeeeecC-------CCccHHHHHHHHHHHHHHHHhcccceeEEEecCCCCCcceeecccCCCh
Confidence            8999999998       9999999999999999999999999999999999999999999998744


No 24 
>smart00129 KISc Kinesin motor, catalytic domain. ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division.
Probab=99.85  E-value=5.1e-21  Score=142.76  Aligned_cols=64  Identities=45%  Similarity=0.735  Sum_probs=61.0

Q ss_pred             CCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         33 KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        33 ~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      ...+.|.||+||+       +.++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+.+++||
T Consensus        43 ~~~~~f~fD~vf~-------~~~~q~~v~~~~~~p~v~~~~~G~~~~i~~yG~tgSGKT~tl~G~~~~~Gl  106 (335)
T smart00129       43 KEEKKFTFDKVFG-------ATASQEDVFEETAAPLVDSVLEGYNATIFAYGQTGSGKTYTMSGTPDSPGI  106 (335)
T ss_pred             CCCeEEecCEEEC-------CCCChHHHHHHHHHHHHHHHhcCCceeEEEeCCCCCCCceEecCCCCCCCH
Confidence            3568999999998       889999999999999999999999999999999999999999999999996


No 25 
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton]
Probab=99.80  E-value=8.9e-20  Score=144.82  Aligned_cols=62  Identities=39%  Similarity=0.669  Sum_probs=59.6

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      ...|.||+||+       +.++|++||+..+.|+++.++.|||||||||||||+||||||.|..+.+||
T Consensus        55 ~~~~~fdkvf~-------~~~~q~~v~e~~~~~l~~~~l~g~N~TvfayGqTgsgKtyt~~G~~~~~Gi  116 (568)
T COG5059          55 EGTYAFDKVFG-------PSATQEDVYEETIKPLIDSLLLGYNCTVFAYGQTGSGKTYTMSGTEEEPGI  116 (568)
T ss_pred             ceEEEEeeccC-------CCCcHHHHHHHhhhhHHHHHHhcccceEEEEcccCCCceeEeecCccccch
Confidence            46799999999       889999999999999999999999999999999999999999999999997


No 26 
>KOG0246|consensus
Probab=99.79  E-value=2.1e-19  Score=140.84  Aligned_cols=56  Identities=36%  Similarity=0.606  Sum_probs=54.0

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccC
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGN   97 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~   97 (103)
                      ...|.||++|+       ..+++++||..+++|||..+|+|--+|+||||||||||||||.|+
T Consensus       257 n~~F~FDyaFD-------e~~sNe~VYrfTa~PlV~~IF~~G~ATCFAYGQTGSGKT~TMggd  312 (676)
T KOG0246|consen  257 NQKFRFDYAFD-------ESASNELVYRFTAKPLVKTIFEGGMATCFAYGQTGSGKTYTMGGD  312 (676)
T ss_pred             hceEEEeeecc-------cccchHHHHHHhhhHHHHHHHhCCceeeeeeccCCCCceeecccc
Confidence            57999999999       899999999999999999999999999999999999999999886


No 27 
>KOG0247|consensus
Probab=99.73  E-value=7.1e-18  Score=135.00  Aligned_cols=63  Identities=30%  Similarity=0.522  Sum_probs=60.9

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      ..+.|.|.+||+       +.++|.+||+.++.|+|..++.|.|..+|.||-|||||||||.|+...+||
T Consensus        79 ~e~~fsFt~VF~-------p~~tQ~dvF~~~~~plV~dlLkgqn~LlFTyGVTgSGKTYTm~G~~~~~GI  141 (809)
T KOG0247|consen   79 MEKKFSFTKVFG-------PSVTQADVFDTTVAPLVKDLLKGQNSLLFTYGVTGSGKTYTMTGTPDRPGI  141 (809)
T ss_pred             eeeEeeeeeecC-------CCccHHHHHHHHhHHHHHHHHcccceeEEEeeccCCCceEEeecCCCCCCc
Confidence            468999999998       899999999999999999999999999999999999999999999999997


No 28 
>cd01363 Motor_domain Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.
Probab=99.67  E-value=5.6e-17  Score=112.61  Aligned_cols=43  Identities=47%  Similarity=0.862  Sum_probs=41.8

Q ss_pred             HHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccCCCCCCC
Q psy12526         60 VFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGNGPFPLI  103 (103)
Q Consensus        60 v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~~~~pGi  103 (103)
                      ||+.++ |+|..+++|+|+||||||||||||||||+|..+++||
T Consensus         8 vf~~~~-~~v~~~~~G~n~~i~~yG~tGsGKT~Tm~G~~~~~Gi   50 (186)
T cd01363           8 VFRDVG-PLLQSALDGYNVCIFAYGQTGSGKTYTMEGKREGAGI   50 (186)
T ss_pred             HHHHHH-HHHHHHhCCcceeEEEECCCCCcceEecCCCCCCCCc
Confidence            999999 9999999999999999999999999999999999986


No 29 
>KOG0244|consensus
Probab=99.64  E-value=2.4e-16  Score=128.61  Aligned_cols=62  Identities=32%  Similarity=0.671  Sum_probs=56.7

Q ss_pred             CCCCCCCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEeccC
Q psy12526         29 RSHLKPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNGN   97 (103)
Q Consensus        29 ~~~~~~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G~   97 (103)
                      .+.....++|+||+||.       ....|.++|+.+++|+++.+++|||+|++|||||||||||||.+.
T Consensus        25 qv~ig~~~s~t~d~v~~-------~~~~Q~~~~e~~V~~l~~~lf~gynatvlaygQtgsgkTytmgt~   86 (913)
T KOG0244|consen   25 QVAIGKDASFTYDKVFL-------DLESQKEVYESCVRPLREKLFAGYNATVLAYGQTGSGKTYTMGTN   86 (913)
T ss_pred             ceeecCCcceeeeeecc-------CchHHHHHHHHHHHHHHHHHhhhhcceeeeecccCCCceeecccc
Confidence            33445678999999998       777899999999999999999999999999999999999999887


No 30 
>PF00308 Bac_DnaA:  Bacterial dnaA  protein;  InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication. DnaA is an ATP- and DNA-binding protein. It binds specifically to 9 bp nucleotide repeats known as dnaA boxes which are found in the chromosome origin of replication (oriC). DnaA is a protein of about 50 kDa that contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP-binding domain, the second is located in the C-terminal half and could be involved in DNA-binding. The protein may also bind the RNA polymerase beta subunit, the dnaB and dnaZ proteins, and the groE gene products (chaperonins) [].; PDB: 2KJQ_A 2Z4S_A 2Z4R_C 2HCB_B 3R8F_C 1L8Q_A 3SC3_B 3BOS_A.
Probab=96.43  E-value=0.002  Score=45.80  Aligned_cols=50  Identities=30%  Similarity=0.494  Sum_probs=30.9

Q ss_pred             ceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         36 KTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        36 ~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..|+||.-.        ...+++..+..+ ..+.+.--..+|. ++-||.+|+||||-|.
T Consensus         3 ~~~tFdnfv--------~g~~N~~a~~~~-~~ia~~~~~~~~~-l~l~G~~G~GKTHLL~   52 (219)
T PF00308_consen    3 PKYTFDNFV--------VGESNELAYAAA-KAIAENPGERYNP-LFLYGPSGLGKTHLLQ   52 (219)
T ss_dssp             TT-SCCCS----------TTTTHHHHHHH-HHHHHSTTTSSSE-EEEEESTTSSHHHHHH
T ss_pred             CCCccccCC--------cCCcHHHHHHHH-HHHHhcCCCCCCc-eEEECCCCCCHHHHHH
Confidence            468888755        234566677544 3455542233554 7889999999999654


No 31 
>PRK14086 dnaA chromosomal replication initiation protein; Provisional
Probab=95.96  E-value=0.0074  Score=49.23  Aligned_cols=51  Identities=25%  Similarity=0.414  Sum_probs=33.4

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ...|+||..+-        ..+++..|..+ ..+++..-..+|. ||-||.+|+||||-+.
T Consensus       282 ~~~~TFDnFvv--------G~sN~~A~aaa-~avae~~~~~~Np-L~LyG~sGsGKTHLL~  332 (617)
T PRK14086        282 NPKYTFDTFVI--------GASNRFAHAAA-VAVAEAPAKAYNP-LFIYGESGLGKTHLLH  332 (617)
T ss_pred             CCCCCHhhhcC--------CCccHHHHHHH-HHHHhCccccCCc-EEEECCCCCCHHHHHH
Confidence            46788877553        23444555443 3455544446775 7899999999999765


No 32 
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]
Probab=95.92  E-value=0.0076  Score=48.63  Aligned_cols=48  Identities=17%  Similarity=0.256  Sum_probs=33.7

Q ss_pred             ceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         36 KTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        36 ~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +.|....-|.       |.-+|-    ..+..|++.+-+|.---+ -.|.|||||||||.
T Consensus         3 ~~F~l~s~f~-------PaGDQP----~AI~~Lv~gi~~g~~~Qt-LLGvTGSGKTfT~A   50 (663)
T COG0556           3 KPFKLHSPFK-------PAGDQP----EAIAELVEGIENGLKHQT-LLGVTGSGKTFTMA   50 (663)
T ss_pred             CceEeccCCC-------CCCCcH----HHHHHHHHHHhcCceeeE-EeeeccCCchhHHH
Confidence            3466666665       677774    445677777777765443 37999999999985


No 33 
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=95.90  E-value=0.004  Score=47.15  Aligned_cols=30  Identities=20%  Similarity=0.223  Sum_probs=26.9

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+++..+.+--++.|+.-|+|||||+.||-
T Consensus       114 P~i~~~~~~~~~GLILVTGpTGSGKSTTlA  143 (353)
T COG2805         114 PPIVRELAESPRGLILVTGPTGSGKSTTLA  143 (353)
T ss_pred             CHHHHHHHhCCCceEEEeCCCCCcHHHHHH
Confidence            677888888889999999999999999874


No 34 
>PRK06620 hypothetical protein; Validated
Probab=95.43  E-value=0.015  Score=41.27  Aligned_cols=51  Identities=16%  Similarity=0.298  Sum_probs=33.7

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCc---EEEEeecCCCCCCceEecc
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYN---ACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n---~ti~aYGqtgSGKT~Tm~G   96 (103)
                      ...|+||.-..        ..+++..|..+. .+.+ .. ++|   -.++-||..|+||||-+..
T Consensus        10 ~~~~tfd~Fvv--------g~~N~~a~~~~~-~~~~-~~-~~~~~~~~l~l~Gp~G~GKThLl~a   63 (214)
T PRK06620         10 SSKYHPDEFIV--------SSSNDQAYNIIK-NWQC-GF-GVNPYKFTLLIKGPSSSGKTYLTKI   63 (214)
T ss_pred             CCCCCchhhEe--------cccHHHHHHHHH-HHHH-cc-ccCCCcceEEEECCCCCCHHHHHHH
Confidence            45688888774        345666776654 3332 11 333   3588999999999997754


No 35 
>PRK09087 hypothetical protein; Validated
Probab=95.37  E-value=0.017  Score=41.26  Aligned_cols=48  Identities=13%  Similarity=0.102  Sum_probs=30.9

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +..|+||.-+        ...++..+|..+     .......|-.++-||.+||||||-+.
T Consensus        15 ~~~~~~~~Fi--------~~~~N~~a~~~l-----~~~~~~~~~~l~l~G~~GsGKThLl~   62 (226)
T PRK09087         15 DPAYGRDDLL--------VTESNRAAVSLV-----DHWPNWPSPVVVLAGPVGSGKTHLAS   62 (226)
T ss_pred             CCCCChhcee--------ecCchHHHHHHH-----HhcccCCCCeEEEECCCCCCHHHHHH
Confidence            3567888766        334456577643     22222235557889999999999765


No 36 
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=95.02  E-value=0.013  Score=46.65  Aligned_cols=30  Identities=20%  Similarity=0.158  Sum_probs=25.4

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceEecc
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G   96 (103)
                      ..+..+++--++-|+.-|+||||||.||+.
T Consensus       248 ~~~~~~~~~p~GliLvTGPTGSGKTTTLY~  277 (500)
T COG2804         248 ARLLRLLNRPQGLILVTGPTGSGKTTTLYA  277 (500)
T ss_pred             HHHHHHHhCCCeEEEEeCCCCCCHHHHHHH
Confidence            455677788889999999999999999974


No 37 
>PRK06893 DNA replication initiation factor; Validated
Probab=94.83  E-value=0.029  Score=39.93  Aligned_cols=24  Identities=13%  Similarity=0.223  Sum_probs=19.4

Q ss_pred             hhCCCcEEEEeecCCCCCCceEec
Q psy12526         72 AFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        72 ~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +-..+|-.++-||.+|+||||-+.
T Consensus        34 ~~~~~~~~l~l~G~~G~GKThL~~   57 (229)
T PRK06893         34 FIDLQQPFFYIWGGKSSGKSHLLK   57 (229)
T ss_pred             hhccCCCeEEEECCCCCCHHHHHH
Confidence            335677788999999999999654


No 38 
>PF04851 ResIII:  Type III restriction enzyme, res subunit;  InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3.1.21.3 from EC), the Res subunit of type III endonucleases (3.1.21.5 from EC), and the B subunit of excinuclease ABC (uvrB) [, , ].; GO: 0003677 DNA binding, 0005524 ATP binding, 0016787 hydrolase activity; PDB: 2Y3T_B 2W74_B 2FWR_A 2FZ4_A 3UWX_B 3H1T_A 3B6E_A 2FDC_A 1D9Z_A 1T5L_B ....
Probab=94.76  E-value=0.016  Score=38.41  Aligned_cols=37  Identities=8%  Similarity=0.049  Sum_probs=22.6

Q ss_pred             CHHHHHHHHHHHHHHHhhCC-CcEEEEeecCCCCCCceEecc
Q psy12526         56 SQEKVFDALGRDILDNAFQG-YNACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G-~n~ti~aYGqtgSGKT~Tm~G   96 (103)
                      -|.++...+.    +.+-.. .+..++..+.||||||++|..
T Consensus         7 ~Q~~ai~~i~----~~~~~~~~~~~~ll~~~tGsGKT~~~~~   44 (184)
T PF04851_consen    7 YQQEAIARII----NSLENKKEERRVLLNAPTGSGKTIIALA   44 (184)
T ss_dssp             HHHHHHHHHH----HHHHTTSGCSEEEEEESTTSSHHHHHHH
T ss_pred             HHHHHHHHHH----HHHHhcCCCCCEEEEECCCCCcChhhhh
Confidence            4555555443    333333 234455678999999998863


No 39 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=94.54  E-value=0.03  Score=35.12  Aligned_cols=26  Identities=15%  Similarity=0.137  Sum_probs=17.7

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...+.......++-+|.+|+|||+.+
T Consensus        11 ~~~~~~~~~~~v~i~G~~G~GKT~l~   36 (151)
T cd00009          11 REALELPPPKNLLLYGPPGTGKTTLA   36 (151)
T ss_pred             HHHHhCCCCCeEEEECCCCCCHHHHH
Confidence            33333333446788999999999754


No 40 
>TIGR02928 orc1/cdc6 family replication initiation protein. Members of this protein family are found exclusively in the archaea. This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. Several members may be found in genome and interact with each other.
Probab=94.42  E-value=0.032  Score=41.76  Aligned_cols=39  Identities=18%  Similarity=0.415  Sum_probs=25.8

Q ss_pred             CCHHHHHHHHHHHHHHHhhC-CCcEEEEeecCCCCCCceEe
Q psy12526         55 ASQEKVFDALGRDILDNAFQ-GYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~-G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...++-.+.+.. .+..++. +....++-||+.|+|||+++
T Consensus        18 ~gRe~e~~~l~~-~l~~~~~~~~~~~i~I~G~~GtGKT~l~   57 (365)
T TIGR02928        18 VHRDEQIEELAK-ALRPILRGSRPSNVFIYGKTGTGKTAVT   57 (365)
T ss_pred             CCcHHHHHHHHH-HHHHHHcCCCCCcEEEECCCCCCHHHHH
Confidence            445555555543 3444444 44557889999999999876


No 41 
>PRK00411 cdc6 cell division control protein 6; Reviewed
Probab=94.41  E-value=0.038  Score=41.79  Aligned_cols=40  Identities=18%  Similarity=0.305  Sum_probs=25.4

Q ss_pred             CCCHHHHHHHHHHHHHHHhhC-CCcEEEEeecCCCCCCceEe
Q psy12526         54 FASQEKVFDALGRDILDNAFQ-GYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        54 ~~~q~~v~~~~~~~lv~~~~~-G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ....++-.+.+. ..+...++ +....++-||+.|+|||+++
T Consensus        32 l~~Re~e~~~l~-~~l~~~~~~~~~~~~lI~G~~GtGKT~l~   72 (394)
T PRK00411         32 LPHREEQIEELA-FALRPALRGSRPLNVLIYGPPGTGKTTTV   72 (394)
T ss_pred             CCCHHHHHHHHH-HHHHHHhCCCCCCeEEEECCCCCCHHHHH
Confidence            334455555554 33344443 34456789999999999875


No 42 
>PRK14088 dnaA chromosomal replication initiation protein; Provisional
Probab=94.27  E-value=0.035  Score=43.46  Aligned_cols=50  Identities=22%  Similarity=0.367  Sum_probs=31.7

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ...|+||.-.        ...+++..|..+. .+.+. -..+|. ++-||.+|+||||-|.
T Consensus        99 ~~~~tFdnFv--------~g~~n~~a~~~~~-~~~~~-~~~~n~-l~lyG~~G~GKTHLl~  148 (440)
T PRK14088         99 NPDYTFENFV--------VGPGNSFAYHAAL-EVAKN-PGRYNP-LFIYGGVGLGKTHLLQ  148 (440)
T ss_pred             CCCCcccccc--------cCCchHHHHHHHH-HHHhC-cCCCCe-EEEEcCCCCcHHHHHH
Confidence            3567777654        2345556665543 33332 123675 8999999999999765


No 43 
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed
Probab=93.85  E-value=0.041  Score=42.88  Aligned_cols=50  Identities=26%  Similarity=0.374  Sum_probs=29.4

Q ss_pred             ceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         36 KTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        36 ~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..|+||.-.        ...+++..|..+ ..+.+.--..+| .++-||.+|+||||.+.
T Consensus       117 ~~~tfd~fv--------~g~~n~~a~~~~-~~~~~~~~~~~~-~l~l~G~~G~GKThL~~  166 (450)
T PRK00149        117 PKYTFDNFV--------VGKSNRLAHAAA-LAVAENPGKAYN-PLFIYGGVGLGKTHLLH  166 (450)
T ss_pred             CCCcccccc--------cCCCcHHHHHHH-HHHHhCcCccCC-eEEEECCCCCCHHHHHH
Confidence            556666533        223455555544 334333222345 47789999999999764


No 44 
>PRK08084 DNA replication initiation factor; Provisional
Probab=93.81  E-value=0.073  Score=38.06  Aligned_cols=48  Identities=21%  Similarity=0.384  Sum_probs=29.2

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +..++||.-+        .. .+...+..+- .+..   ..-...++-||.+|+||||-+.
T Consensus        16 ~~~~~fd~f~--------~~-~n~~a~~~l~-~~~~---~~~~~~l~l~Gp~G~GKThLl~   63 (235)
T PRK08084         16 PDDETFASFY--------PG-DNDSLLAALQ-NALR---QEHSGYIYLWSREGAGRSHLLH   63 (235)
T ss_pred             CCcCCccccc--------cC-ccHHHHHHHH-HHHh---CCCCCeEEEECCCCCCHHHHHH
Confidence            4556777544        33 5555665443 3322   2222368889999999999765


No 45 
>PF01935 DUF87:  Domain of unknown function DUF87;  InterPro: IPR002789 The function of this domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=93.79  E-value=0.018  Score=40.50  Aligned_cols=16  Identities=25%  Similarity=0.453  Sum_probs=13.2

Q ss_pred             EEeecCCCCCCceEec
Q psy12526         80 IFAYGQTGEKTNYLLN   95 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm~   95 (103)
                      +...|.||||||+|+.
T Consensus        26 ~~I~G~TGsGKS~~~~   41 (229)
T PF01935_consen   26 IAIFGTTGSGKSNTVK   41 (229)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            3468999999999873


No 46 
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]
Probab=93.74  E-value=0.076  Score=38.69  Aligned_cols=40  Identities=18%  Similarity=0.233  Sum_probs=27.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         53 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ....+..++..+. .+++.+-.+.|  ++-||+.|+||||-..
T Consensus        84 ~~~~~~~~l~~~~-~~~~~~~~~~n--l~l~G~~G~GKThLa~  123 (254)
T COG1484          84 QPGIDKKALEDLA-SLVEFFERGEN--LVLLGPPGVGKTHLAI  123 (254)
T ss_pred             CcchhHHHHHHHH-HHHHHhccCCc--EEEECCCCCcHHHHHH
Confidence            3446777777664 56656555555  4459999999999543


No 47 
>TIGR00362 DnaA chromosomal replication initiator protein DnaA. DnaA is involved in DNA biosynthesis; initiation of chromosome replication and can also be transcription regulator. The C-terminal of the family hits the pfam bacterial DnaA (bac_dnaA) domain family. For a review, see Kaguni (2006).
Probab=93.69  E-value=0.05  Score=41.73  Aligned_cols=50  Identities=26%  Similarity=0.374  Sum_probs=28.7

Q ss_pred             ceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         36 KTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        36 ~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..|+||.-.        ....+...+..+ ..+.+.--..+| .++-||.+|+||||.+.
T Consensus       105 ~~~tfd~fi--------~g~~n~~a~~~~-~~~~~~~~~~~n-~l~l~G~~G~GKThL~~  154 (405)
T TIGR00362       105 PKYTFDNFV--------VGKSNRLAHAAA-LAVAENPGKAYN-PLFIYGGVGLGKTHLLH  154 (405)
T ss_pred             CCCcccccc--------cCCcHHHHHHHH-HHHHhCcCccCC-eEEEECCCCCcHHHHHH
Confidence            456666532        223455555443 333333111244 46789999999999764


No 48 
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]
Probab=93.64  E-value=0.064  Score=41.17  Aligned_cols=33  Identities=27%  Similarity=0.458  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHHhhCCC-cEEEEeecCCCCCCceEe
Q psy12526         61 FDALGRDILDNAFQGY-NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        61 ~~~~~~~lv~~~~~G~-n~ti~aYGqtgSGKT~Tm   94 (103)
                      ++.+. .++..++.|. ...++.||.+|+|||.|+
T Consensus        26 i~~l~-~~l~~~~~~~~p~n~~iyG~~GTGKT~~~   59 (366)
T COG1474          26 INQLA-SFLAPALRGERPSNIIIYGPTGTGKTATV   59 (366)
T ss_pred             HHHHH-HHHHHHhcCCCCccEEEECCCCCCHhHHH
Confidence            34443 3344445444 333999999999999875


No 49 
>PRK10436 hypothetical protein; Provisional
Probab=93.51  E-value=0.031  Score=44.22  Aligned_cols=28  Identities=25%  Similarity=0.273  Sum_probs=22.2

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+..++..-++.|+.-|.||||||.||.
T Consensus       209 ~l~~~~~~~~GliLvtGpTGSGKTTtL~  236 (462)
T PRK10436        209 QFRQALQQPQGLILVTGPTGSGKTVTLY  236 (462)
T ss_pred             HHHHHHHhcCCeEEEECCCCCChHHHHH
Confidence            3445555567889999999999999985


No 50 
>TIGR02533 type_II_gspE general secretory pathway protein E. This family describes GspE, the E protein of the type II secretion system, also called the main terminal branch of the general secretion pathway. This model separates GspE from the PilB protein of type IV pilin biosynthesis.
Probab=93.48  E-value=0.036  Score=44.02  Aligned_cols=28  Identities=18%  Similarity=0.230  Sum_probs=22.2

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+..++..-++.|+..|.||||||.||.
T Consensus       233 ~l~~~~~~~~GlilitGptGSGKTTtL~  260 (486)
T TIGR02533       233 RFERLIRRPHGIILVTGPTGSGKTTTLY  260 (486)
T ss_pred             HHHHHHhcCCCEEEEEcCCCCCHHHHHH
Confidence            4455566666788899999999999986


No 51 
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB. This model describes a protein of type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB. This protein is an ATPase involved in protein export for pilin assembly and is closely related to GspE (TIGR02533) of type II secretion, also called the main terminal branch of the general secretion pathway. Note that type IV pilus systems are often divided into type IV-A and IV-B, with the latter group including bundle-forming pilus, mannose-sensitive hemagglutinin, etc. Members of this family are found in type IV-A systems.
Probab=93.34  E-value=0.036  Score=44.68  Aligned_cols=28  Identities=18%  Similarity=0.243  Sum_probs=22.2

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+..++..-++.|+..|.||||||.||.
T Consensus       307 ~l~~~~~~~~Glilv~G~tGSGKTTtl~  334 (564)
T TIGR02538       307 LFLEAIHKPQGMVLVTGPTGSGKTVSLY  334 (564)
T ss_pred             HHHHHHHhcCCeEEEECCCCCCHHHHHH
Confidence            3445556667889999999999999984


No 52 
>PRK06526 transposase; Provisional
Probab=93.31  E-value=0.034  Score=40.54  Aligned_cols=20  Identities=20%  Similarity=0.172  Sum_probs=16.0

Q ss_pred             CCCcEEEEeecCCCCCCceEec
Q psy12526         74 QGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+.|  |+-+|.+|+||||.+.
T Consensus        97 ~~~n--lll~Gp~GtGKThLa~  116 (254)
T PRK06526         97 GKEN--VVFLGPPGTGKTHLAI  116 (254)
T ss_pred             cCce--EEEEeCCCCchHHHHH
Confidence            4455  6789999999999765


No 53 
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]
Probab=93.25  E-value=0.059  Score=42.09  Aligned_cols=51  Identities=24%  Similarity=0.346  Sum_probs=32.9

Q ss_pred             CCceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhC-CCcEEEEeecCCCCCCceEec
Q psy12526         34 PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQ-GYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        34 ~~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~-G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ....|+||.-.        ...+++..+.... .+ ...-. -|| -||-||.+|+||||-|.
T Consensus        80 l~~~ytFdnFv--------~g~~N~~A~aa~~-~v-a~~~g~~~n-plfi~G~~GlGKTHLl~  131 (408)
T COG0593          80 LNPKYTFDNFV--------VGPSNRLAYAAAK-AV-AENPGGAYN-PLFIYGGVGLGKTHLLQ  131 (408)
T ss_pred             CCCCCchhhee--------eCCchHHHHHHHH-HH-HhccCCcCC-cEEEECCCCCCHHHHHH
Confidence            45678998866        4456655554432 22 22222 255 68899999999999775


No 54 
>TIGR01420 pilT_fam pilus retraction protein PilT. This model represents the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction. Members of this family may be found in some species that type IV pili but have related structures for DNA uptake and natural transformation.
Probab=92.98  E-value=0.048  Score=41.25  Aligned_cols=28  Identities=21%  Similarity=0.256  Sum_probs=20.3

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+..++.--.+.|+-.|.||||||.||.
T Consensus       113 ~l~~~~~~~~g~ili~G~tGSGKTT~l~  140 (343)
T TIGR01420       113 VLRELAERPRGLILVTGPTGSGKSTTLA  140 (343)
T ss_pred             HHHHHHhhcCcEEEEECCCCCCHHHHHH
Confidence            3444443334678899999999999885


No 55 
>PRK08116 hypothetical protein; Validated
Probab=92.96  E-value=0.076  Score=38.92  Aligned_cols=40  Identities=20%  Similarity=0.357  Sum_probs=26.2

Q ss_pred             CCHHHHHHHHHHHHHHHhhC--CCcEEEEeecCCCCCCceEec
Q psy12526         55 ASQEKVFDALGRDILDNAFQ--GYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~--G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..++..+..+ ...++.+.+  ..|..++-||.+|+||||-+.
T Consensus        91 ~~~~~a~~~a-~~y~~~~~~~~~~~~gl~l~G~~GtGKThLa~  132 (268)
T PRK08116         91 KGSEKAYKIA-RKYVKKFEEMKKENVGLLLWGSVGTGKTYLAA  132 (268)
T ss_pred             hHHHHHHHHH-HHHHHHHHhhccCCceEEEECCCCCCHHHHHH
Confidence            4455555543 455565443  335568899999999999654


No 56 
>PRK05642 DNA replication initiation factor; Validated
Probab=92.95  E-value=0.1  Score=37.28  Aligned_cols=18  Identities=28%  Similarity=0.565  Sum_probs=15.0

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..++-||.+|+||||-+.
T Consensus        46 ~~l~l~G~~G~GKTHLl~   63 (234)
T PRK05642         46 SLIYLWGKDGVGRSHLLQ   63 (234)
T ss_pred             CeEEEECCCCCCHHHHHH
Confidence            457789999999999654


No 57 
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ. Members of this protein family are predicted ATPases associated with plasmid transfer loci in bacteria. This family is most similar to the DotB ATPase of a type-IV secretion-like system of obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii (TIGR02524).
Probab=92.73  E-value=0.057  Score=41.60  Aligned_cols=19  Identities=21%  Similarity=0.230  Sum_probs=16.0

Q ss_pred             cEEEEeecCCCCCCceEec
Q psy12526         77 NACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ++.|+..|.||||||.||.
T Consensus       149 ~GlilI~G~TGSGKTT~l~  167 (372)
T TIGR02525       149 AGLGLICGETGSGKSTLAA  167 (372)
T ss_pred             CCEEEEECCCCCCHHHHHH
Confidence            4567889999999999873


No 58 
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=92.56  E-value=0.069  Score=39.08  Aligned_cols=27  Identities=19%  Similarity=0.251  Sum_probs=19.8

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +..++..-.+.|+-.|.||||||.+|.
T Consensus        72 l~~~~~~~~GlilisG~tGSGKTT~l~   98 (264)
T cd01129          72 FRKLLEKPHGIILVTGPTGSGKTTTLY   98 (264)
T ss_pred             HHHHHhcCCCEEEEECCCCCcHHHHHH
Confidence            344454445567889999999999874


No 59 
>PF00437 T2SE:  Type II/IV secretion system protein;  InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]. These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....
Probab=92.49  E-value=0.046  Score=39.47  Aligned_cols=29  Identities=34%  Similarity=0.526  Sum_probs=19.4

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..++...+.+ .+.|+--|.||||||.+|.
T Consensus       117 ~~~l~~~v~~-~~~ili~G~tGSGKTT~l~  145 (270)
T PF00437_consen  117 AEFLRSAVRG-RGNILISGPTGSGKTTLLN  145 (270)
T ss_dssp             HHHHHHCHHT-TEEEEEEESTTSSHHHHHH
T ss_pred             HHHHhhcccc-ceEEEEECCCccccchHHH
Confidence            3444443333 4567778999999998873


No 60 
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=92.34  E-value=0.16  Score=35.38  Aligned_cols=21  Identities=19%  Similarity=0.442  Sum_probs=17.3

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ......|+-||++|+||||.+
T Consensus        35 ~~~~~~lll~G~~G~GKT~la   55 (226)
T TIGR03420        35 GKGDRFLYLWGESGSGKSHLL   55 (226)
T ss_pred             cCCCCeEEEECCCCCCHHHHH
Confidence            455667889999999999865


No 61 
>PRK12377 putative replication protein; Provisional
Probab=92.27  E-value=0.17  Score=36.84  Aligned_cols=39  Identities=21%  Similarity=0.291  Sum_probs=26.8

Q ss_pred             CCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         55 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..|..++..+ ..++..+..+. ..++-+|.+|+||||.+.
T Consensus        81 ~~~~~a~~~a-~~~a~~~~~~~-~~l~l~G~~GtGKThLa~  119 (248)
T PRK12377         81 DGQRYALSQA-KSIADELMTGC-TNFVFSGKPGTGKNHLAA  119 (248)
T ss_pred             hhHHHHHHHH-HHHHHHHHhcC-CeEEEECCCCCCHHHHHH
Confidence            4566566543 46666665554 357789999999999764


No 62 
>PRK08727 hypothetical protein; Validated
Probab=92.20  E-value=0.057  Score=38.58  Aligned_cols=17  Identities=18%  Similarity=0.284  Sum_probs=14.6

Q ss_pred             EEEeecCCCCCCceEec
Q psy12526         79 CIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm~   95 (103)
                      .|+-||.+|+||||-+.
T Consensus        43 ~l~l~G~~G~GKThL~~   59 (233)
T PRK08727         43 WLYLSGPAGTGKTHLAL   59 (233)
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            48899999999999654


No 63 
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB. Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.
Probab=92.14  E-value=0.072  Score=40.76  Aligned_cols=20  Identities=30%  Similarity=0.458  Sum_probs=17.2

Q ss_pred             CcEEEEeecCCCCCCceEec
Q psy12526         76 YNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        76 ~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      -...|+-.|.||||||.||.
T Consensus       133 ~~glilI~GpTGSGKTTtL~  152 (358)
T TIGR02524       133 QEGIVFITGATGSGKSTLLA  152 (358)
T ss_pred             cCCEEEEECCCCCCHHHHHH
Confidence            46788899999999999874


No 64 
>PRK08181 transposase; Validated
Probab=92.10  E-value=0.18  Score=37.18  Aligned_cols=20  Identities=25%  Similarity=0.516  Sum_probs=15.9

Q ss_pred             CCCcEEEEeecCCCCCCceEec
Q psy12526         74 QGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+.|  |+-||.+|+||||-+.
T Consensus       105 ~~~n--lll~Gp~GtGKTHLa~  124 (269)
T PRK08181        105 KGAN--LLLFGPPGGGKSHLAA  124 (269)
T ss_pred             cCce--EEEEecCCCcHHHHHH
Confidence            4555  6789999999999654


No 65 
>PF00270 DEAD:  DEAD/DEAH box helicase;  InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0008026 ATP-dependent helicase activity; PDB: 3RRM_A 3RRN_A 3PEW_A 2KBE_A 3PEY_A 3FHO_A 2ZJA_A 2ZJ8_A 2ZJ5_A 2ZJ2_A ....
Probab=91.96  E-value=0.079  Score=34.82  Aligned_cols=26  Identities=15%  Similarity=0.266  Sum_probs=18.8

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ++..+++|.+  ++.-+.||+|||....
T Consensus         7 ~~~~i~~~~~--~li~aptGsGKT~~~~   32 (169)
T PF00270_consen    7 AIEAIISGKN--VLISAPTGSGKTLAYI   32 (169)
T ss_dssp             HHHHHHTTSE--EEEECSTTSSHHHHHH
T ss_pred             HHHHHHcCCC--EEEECCCCCccHHHHH
Confidence            3444556666  6789999999998654


No 66 
>PRK14087 dnaA chromosomal replication initiation protein; Provisional
Probab=91.85  E-value=0.1  Score=41.00  Aligned_cols=50  Identities=28%  Similarity=0.420  Sum_probs=29.5

Q ss_pred             eEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEecc
Q psy12526         37 TFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        37 ~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G   96 (103)
                      .|+||.-.        ...+++..|..+ ..+...--..+| -+|-||.+|+||||-|..
T Consensus       111 ~~tFdnFv--------~g~~n~~A~~aa-~~~a~~~~~~~n-pl~i~G~~G~GKTHLl~A  160 (450)
T PRK14087        111 ENTFENFV--------IGSSNEQAFIAV-QTVSKNPGISYN-PLFIYGESGMGKTHLLKA  160 (450)
T ss_pred             ccchhccc--------CCCcHHHHHHHH-HHHHhCcCcccC-ceEEECCCCCcHHHHHHH
Confidence            46777644        233455566443 344332111244 478899999999997753


No 67 
>PRK07952 DNA replication protein DnaC; Validated
Probab=91.69  E-value=0.23  Score=36.13  Aligned_cols=39  Identities=13%  Similarity=0.129  Sum_probs=25.6

Q ss_pred             CCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         55 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..|..++..+. ..++....+.+ .++-+|.+|+||||.+.
T Consensus        79 ~~q~~al~~a~-~~~~~~~~~~~-~~~l~G~~GtGKThLa~  117 (244)
T PRK07952         79 EGQMNALSKAR-QYVEEFDGNIA-SFIFSGKPGTGKNHLAA  117 (244)
T ss_pred             chHHHHHHHHH-HHHHhhccCCc-eEEEECCCCCCHHHHHH
Confidence            35655665543 44555444433 67889999999999654


No 68 
>PRK06835 DNA replication protein DnaC; Validated
Probab=91.38  E-value=0.15  Score=38.60  Aligned_cols=36  Identities=25%  Similarity=0.526  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         58 EKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        58 ~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +.+++.+ ...++.+-... -.|+-||.+|+||||-+.
T Consensus       166 ~~~~~~~-~~f~~~f~~~~-~~Lll~G~~GtGKThLa~  201 (329)
T PRK06835        166 EKILEKC-KNFIENFDKNN-ENLLFYGNTGTGKTFLSN  201 (329)
T ss_pred             HHHHHHH-HHHHHHHhccC-CcEEEECCCCCcHHHHHH
Confidence            3344433 35666655444 458899999999999654


No 69 
>PRK13894 conjugal transfer ATPase TrbB; Provisional
Probab=91.22  E-value=0.12  Score=39.04  Aligned_cols=28  Identities=25%  Similarity=0.335  Sum_probs=18.4

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .++..++.+. ..|+-.|.||||||.+|.
T Consensus       139 ~~L~~~v~~~-~~ilI~G~tGSGKTTll~  166 (319)
T PRK13894        139 EAIIAAVRAH-RNILVIGGTGSGKTTLVN  166 (319)
T ss_pred             HHHHHHHHcC-CeEEEECCCCCCHHHHHH
Confidence            4455555443 345667999999997653


No 70 
>PF01695 IstB_IS21:  IstB-like ATP binding protein;  InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif. They are found associated with IS21 family insertion sequences []. Functionally they have not been characterised, but they may be involved in transposition [].; GO: 0005524 ATP binding; PDB: 3EC2_A 3ECC_A 2W58_A 2QGZ_A.
Probab=90.96  E-value=0.19  Score=34.57  Aligned_cols=16  Identities=25%  Similarity=0.453  Sum_probs=13.5

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      .++-+|++|+||||..
T Consensus        49 ~l~l~G~~G~GKThLa   64 (178)
T PF01695_consen   49 NLILYGPPGTGKTHLA   64 (178)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             EEEEEhhHhHHHHHHH
Confidence            4777999999999954


No 71 
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB. The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.
Probab=90.79  E-value=0.11  Score=38.82  Aligned_cols=28  Identities=32%  Similarity=0.430  Sum_probs=19.5

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .++..++.+ ...|+-.|.||||||.+|.
T Consensus       123 ~~L~~~v~~-~~~ilI~G~tGSGKTTll~  150 (299)
T TIGR02782       123 DVLREAVLA-RKNILVVGGTGSGKTTLAN  150 (299)
T ss_pred             HHHHHHHHc-CCeEEEECCCCCCHHHHHH
Confidence            444455543 3457789999999998763


No 72 
>PRK09183 transposase/IS protein; Provisional
Probab=90.40  E-value=0.18  Score=36.74  Aligned_cols=22  Identities=23%  Similarity=0.170  Sum_probs=15.9

Q ss_pred             hhCCCcEEEEeecCCCCCCceEec
Q psy12526         72 AFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        72 ~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +-.|.|  |+-+|++|+||||-+.
T Consensus        99 i~~~~~--v~l~Gp~GtGKThLa~  120 (259)
T PRK09183         99 IERNEN--IVLLGPSGVGKTHLAI  120 (259)
T ss_pred             hhcCCe--EEEEeCCCCCHHHHHH
Confidence            345655  4469999999999654


No 73 
>PRK08939 primosomal protein DnaI; Reviewed
Probab=90.30  E-value=0.26  Score=36.89  Aligned_cols=39  Identities=26%  Similarity=0.373  Sum_probs=25.8

Q ss_pred             CHHHHHHHHHHHHHHHhhCC-CcEEEEeecCCCCCCceEec
Q psy12526         56 SQEKVFDALGRDILDNAFQG-YNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G-~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+..++..+ ...++....| ..-.|+-||.+|+||||-+.
T Consensus       135 ~~~~~~~~~-~~fi~~~~~~~~~~gl~L~G~~G~GKThLa~  174 (306)
T PRK08939        135 DRLDALMAA-LDFLEAYPPGEKVKGLYLYGDFGVGKSYLLA  174 (306)
T ss_pred             HHHHHHHHH-HHHHHHhhccCCCCeEEEECCCCCCHHHHHH
Confidence            555666643 4566655432 22358889999999999664


No 74 
>PRK12402 replication factor C small subunit 2; Reviewed
Probab=90.10  E-value=0.24  Score=36.41  Aligned_cols=21  Identities=10%  Similarity=0.123  Sum_probs=15.8

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .+-...++-||+.|+|||+++
T Consensus        33 ~~~~~~lll~Gp~GtGKT~la   53 (337)
T PRK12402         33 SPNLPHLLVQGPPGSGKTAAV   53 (337)
T ss_pred             CCCCceEEEECCCCCCHHHHH
Confidence            343235778999999999865


No 75 
>PRK08903 DnaA regulatory inactivator Hda; Validated
Probab=89.94  E-value=0.29  Score=34.35  Aligned_cols=19  Identities=21%  Similarity=0.504  Sum_probs=15.4

Q ss_pred             CcEEEEeecCCCCCCceEe
Q psy12526         76 YNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        76 ~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .+..++-||+.|+||||-+
T Consensus        41 ~~~~~~l~G~~G~GKT~La   59 (227)
T PRK08903         41 ADRFFYLWGEAGSGRSHLL   59 (227)
T ss_pred             CCCeEEEECCCCCCHHHHH
Confidence            3456788999999999854


No 76 
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=89.93  E-value=0.26  Score=42.50  Aligned_cols=36  Identities=19%  Similarity=0.380  Sum_probs=22.9

Q ss_pred             HHHHHHHHHHHHHHhhC--CCcEEEEeecCCCCCCceEe
Q psy12526         58 EKVFDALGRDILDNAFQ--GYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        58 ~~v~~~~~~~lv~~~~~--G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ++=++.+. .+|..++.  +-+.+|+-||.+|+|||.|+
T Consensus       761 EeEIeeLa-sfL~paIkgsgpnnvLYIyG~PGTGKTATV  798 (1164)
T PTZ00112        761 EKEIKEVH-GFLESGIKQSGSNQILYISGMPGTGKTATV  798 (1164)
T ss_pred             HHHHHHHH-HHHHHHHhcCCCCceEEEECCCCCCHHHHH
Confidence            33334443 33444443  44567889999999999875


No 77 
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=89.87  E-value=0.11  Score=35.64  Aligned_cols=27  Identities=26%  Similarity=0.367  Sum_probs=18.5

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      |.+.+-.+.+..++-||+.|+|||+.|
T Consensus        11 l~~~l~~~~~~~~~l~G~rg~GKTsLl   37 (234)
T PF01637_consen   11 LKELLESGPSQHILLYGPRGSGKTSLL   37 (234)
T ss_dssp             HHHCHHH--SSEEEEEESTTSSHHHHH
T ss_pred             HHHHHHhhcCcEEEEEcCCcCCHHHHH
Confidence            333334455678889999999999865


No 78 
>PRK13833 conjugal transfer protein TrbB; Provisional
Probab=89.78  E-value=0.24  Score=37.54  Aligned_cols=24  Identities=29%  Similarity=0.369  Sum_probs=17.2

Q ss_pred             HHHhh-CCCcEEEEeecCCCCCCceEe
Q psy12526         69 LDNAF-QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        69 v~~~~-~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      +..++ .+.|  |+--|.||||||.+|
T Consensus       137 L~~~v~~~~n--ilI~G~tGSGKTTll  161 (323)
T PRK13833        137 IRSAIDSRLN--IVISGGTGSGKTTLA  161 (323)
T ss_pred             HHHHHHcCCe--EEEECCCCCCHHHHH
Confidence            33433 4444  678999999999877


No 79 
>PF00063 Myosin_head:  Myosin head (motor domain);  InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril. Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....
Probab=89.62  E-value=0.22  Score=40.89  Aligned_cols=22  Identities=18%  Similarity=0.155  Sum_probs=19.3

Q ss_pred             hCCCcEEEEeecCCCCCCceEe
Q psy12526         73 FQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ..+-|-||+-.|++|||||.++
T Consensus        81 ~~~~~Q~IiisGeSGsGKTe~~  102 (689)
T PF00063_consen   81 RTRQNQSIIISGESGSGKTETS  102 (689)
T ss_dssp             HHTSEEEEEEEESTTSSHHHHH
T ss_pred             ccccccceeeccccccccccch
Confidence            4578999999999999999863


No 80 
>PF13245 AAA_19:  Part of AAA domain
Probab=89.53  E-value=0.14  Score=30.54  Aligned_cols=16  Identities=19%  Similarity=0.262  Sum_probs=12.8

Q ss_pred             EEeecCCCCCCceEec
Q psy12526         80 IFAYGQTGEKTNYLLN   95 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm~   95 (103)
                      +..-|..|||||+|+.
T Consensus        13 ~vv~g~pGtGKT~~~~   28 (76)
T PF13245_consen   13 FVVQGPPGTGKTTTLA   28 (76)
T ss_pred             EEEECCCCCCHHHHHH
Confidence            3348999999998764


No 81 
>PF01580 FtsK_SpoIIIE:  FtsK/SpoIIIE family;  InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies.The domain contains a putative ATP binding P-loop motif. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification []. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer []. ; GO: 0000166 nucleotide binding, 0003677 DNA binding, 0005524 ATP binding, 0007049 cell cycle, 0007059 chromosome segregation, 0051301 cell division, 0016021 integral to membrane; PDB: 2IUS_E 2IUU_A 2IUT_A.
Probab=89.42  E-value=0.091  Score=36.36  Aligned_cols=17  Identities=29%  Similarity=0.442  Sum_probs=12.0

Q ss_pred             EEEeecCCCCCCceEec
Q psy12526         79 CIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm~   95 (103)
                      -++.+|.+|||||.+|.
T Consensus        40 h~li~G~tgsGKS~~l~   56 (205)
T PF01580_consen   40 HLLIAGATGSGKSTLLR   56 (205)
T ss_dssp             SEEEE--TTSSHHHHHH
T ss_pred             eEEEEcCCCCCccHHHH
Confidence            36789999999998664


No 82 
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=89.21  E-value=0.3  Score=36.92  Aligned_cols=30  Identities=13%  Similarity=0.238  Sum_probs=21.9

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+++..+.--.-+.|+.-|.|||||+.||.
T Consensus       116 Pevlk~la~~kRGLviiVGaTGSGKSTtmA  145 (375)
T COG5008         116 PEVLKDLALAKRGLVIIVGATGSGKSTTMA  145 (375)
T ss_pred             cHHHHHhhcccCceEEEECCCCCCchhhHH
Confidence            355555444556678889999999999874


No 83 
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=89.03  E-value=0.23  Score=34.11  Aligned_cols=27  Identities=37%  Similarity=0.338  Sum_probs=17.6

Q ss_pred             HHHHHhhC-CCcEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAFQ-GYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~~-G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .++...+. |.+  +.--|.||||||.+|.
T Consensus        16 ~~l~~~v~~g~~--i~I~G~tGSGKTTll~   43 (186)
T cd01130          16 AYLWLAVEARKN--ILISGGTGSGKTTLLN   43 (186)
T ss_pred             HHHHHHHhCCCE--EEEECCCCCCHHHHHH
Confidence            34444443 444  5568999999998653


No 84 
>smart00242 MYSc Myosin. Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
Probab=88.93  E-value=0.41  Score=39.57  Aligned_cols=22  Identities=18%  Similarity=0.137  Sum_probs=19.4

Q ss_pred             hCCCcEEEEeecCCCCCCceEe
Q psy12526         73 FQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      -.+.|-||+.-|++|||||.|.
T Consensus        88 ~~~~~QsIiisGESGaGKTe~~  109 (677)
T smart00242       88 NDKENQSIIISGESGAGKTENT  109 (677)
T ss_pred             hcCCCceEEEecCCCCcchHHH
Confidence            3688999999999999999864


No 85 
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=88.82  E-value=0.49  Score=36.72  Aligned_cols=19  Identities=16%  Similarity=0.218  Sum_probs=15.9

Q ss_pred             cEEEEeecCCCCCCceEec
Q psy12526         77 NACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ...|+.+|.||+|||.|+.
T Consensus       174 ~~vi~lvGptGvGKTTT~a  192 (388)
T PRK12723        174 KRVFILVGPTGVGKTTTIA  192 (388)
T ss_pred             CeEEEEECCCCCCHHHHHH
Confidence            3578889999999999863


No 86 
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]
Probab=88.81  E-value=0.29  Score=38.26  Aligned_cols=37  Identities=22%  Similarity=0.195  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHHHhhCC---C-cEEEEeecCCCCCCceEe
Q psy12526         58 EKVFDALGRDILDNAFQG---Y-NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        58 ~~v~~~~~~~lv~~~~~G---~-n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...|.....-++.+..+.   . ..-|.--|+||.|||.|+
T Consensus       180 ~~~~~~~l~~~~~~~~~~~~~~~~~vi~LVGPTGVGKTTTl  220 (407)
T COG1419         180 LRYFSEKLRKLLLSLIENLIVEQKRVIALVGPTGVGKTTTL  220 (407)
T ss_pred             hhhHHHHHHHHHHhhccccccccCcEEEEECCCCCcHHHHH
Confidence            445555555555555544   2 333444599999999986


No 87 
>PF05970 PIF1:  PIF1-like helicase;  InterPro: IPR010285  This entry represents PIF1 helicase and related proteins. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated [, ]. 
Probab=88.69  E-value=0.35  Score=36.86  Aligned_cols=36  Identities=28%  Similarity=0.514  Sum_probs=26.9

Q ss_pred             CCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         55 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ..|+.+|+.++..+..  .+|  ..+|.-|.-|+||||.+
T Consensus         4 ~eQ~~~~~~v~~~~~~--~~~--~~~fv~G~~GtGKs~l~   39 (364)
T PF05970_consen    4 EEQRRVFDTVIEAIEN--EEG--LNFFVTGPAGTGKSFLI   39 (364)
T ss_pred             HHHHHHHHHHHHHHHc--cCC--cEEEEEcCCCCChhHHH
Confidence            5799999988754432  344  45678999999999965


No 88 
>smart00487 DEXDc DEAD-like helicases superfamily.
Probab=88.55  E-value=0.26  Score=32.29  Aligned_cols=17  Identities=12%  Similarity=0.026  Sum_probs=13.3

Q ss_pred             EEEeecCCCCCCceEec
Q psy12526         79 CIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm~   95 (103)
                      .++-.|.+|||||.++.
T Consensus        26 ~~~i~~~~GsGKT~~~~   42 (201)
T smart00487       26 DVILAAPTGSGKTLAAL   42 (201)
T ss_pred             cEEEECCCCCchhHHHH
Confidence            34568899999999765


No 89 
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=88.55  E-value=0.26  Score=35.15  Aligned_cols=23  Identities=17%  Similarity=0.333  Sum_probs=16.5

Q ss_pred             hCCCcEEEEeecCCCCCCceEec
Q psy12526         73 FQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ++--...++-+|+.|+|||+.+.
T Consensus        39 ~~~~~~~~~l~G~~G~GKTtl~~   61 (269)
T TIGR03015        39 LSQREGFILITGEVGAGKTTLIR   61 (269)
T ss_pred             HhcCCCEEEEEcCCCCCHHHHHH
Confidence            33334456779999999998654


No 90 
>PF06048 DUF927:  Domain of unknown function (DUF927);  InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=88.35  E-value=0.45  Score=35.10  Aligned_cols=34  Identities=18%  Similarity=0.199  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         61 FDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        61 ~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +...+.||+ ..+.--+..+--||+|++|||.++.
T Consensus       178 ~~afa~pLL-~~l~~~~~~~hl~G~Ss~GKTt~~~  211 (286)
T PF06048_consen  178 CAAFAAPLL-SLLGVEGFGFHLYGQSSSGKTTALQ  211 (286)
T ss_pred             HHHHHHHHH-HHhCCCceEEEEEeCCCCCHHHHHH
Confidence            344456766 4455556778889999999998654


No 91 
>PRK12422 chromosomal replication initiation protein; Provisional
Probab=88.00  E-value=0.68  Score=36.44  Aligned_cols=51  Identities=16%  Similarity=0.335  Sum_probs=30.8

Q ss_pred             CceEEeceEEecCCCCCCCCCCHHHHHHHHHHHHHHHh--hCC--CcEEEEeecCCCCCCceEec
Q psy12526         35 PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNA--FQG--YNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        35 ~~~F~fd~vf~s~~~~~~~~~~q~~v~~~~~~~lv~~~--~~G--~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ...|+||.-.-        ..+++..|..+ ..+.+..  ..|  +| -++-||.+|+||||-+.
T Consensus       105 ~~~~tFdnFv~--------g~~N~~a~~~a-~~~a~~~~~~~~~~~n-pl~L~G~~G~GKTHLl~  159 (445)
T PRK12422        105 DPLMTFANFLV--------TPENDLPHRIL-QEFTKVSEQGKGFPFN-PIYLFGPEGSGKTHLMQ  159 (445)
T ss_pred             Cccccccceee--------CCcHHHHHHHH-HHHHhccccccCCCCc-eEEEEcCCCCCHHHHHH
Confidence            46688887553        34555555443 3444322  223  45 36779999999999764


No 92 
>PF07693 KAP_NTPase:  KAP family P-loop domain;  InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side [].
Probab=87.99  E-value=0.44  Score=34.93  Aligned_cols=20  Identities=25%  Similarity=0.253  Sum_probs=16.7

Q ss_pred             CCcEEEEeecCCCCCCceEe
Q psy12526         75 GYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .-+.+|.-+|..|||||+-|
T Consensus        18 ~~~~~IgL~G~WGsGKSs~l   37 (325)
T PF07693_consen   18 DDPFVIGLYGEWGSGKSSFL   37 (325)
T ss_pred             CCCeEEEEECCCCCCHHHHH
Confidence            45678888999999999865


No 93 
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=87.86  E-value=0.11  Score=34.62  Aligned_cols=27  Identities=30%  Similarity=0.452  Sum_probs=14.2

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ++.....+-...++-.|..|+|||+.+
T Consensus        15 ~l~~~~~~~~~~~ll~G~~G~GKT~ll   41 (185)
T PF13191_consen   15 LLDAAQSGSPRNLLLTGESGSGKTSLL   41 (185)
T ss_dssp             TTGGTSS-----EEE-B-TTSSHHHHH
T ss_pred             HHHHHHcCCCcEEEEECCCCCCHHHHH
Confidence            333334565677899999999999754


No 94 
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
Probab=87.83  E-value=0.71  Score=38.30  Aligned_cols=21  Identities=19%  Similarity=0.251  Sum_probs=18.9

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .+.|-||+.-|++|||||.|.
T Consensus        89 ~~~~QsIiisGESGaGKTe~~  109 (677)
T cd01383          89 DEVNQSIIISGESGAGKTETA  109 (677)
T ss_pred             cCCCceEEEecCCCCCcchHH
Confidence            588999999999999999863


No 95 
>cd01377 MYSc_type_II Myosin motor domain, type II myosins. Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
Probab=87.82  E-value=0.6  Score=38.78  Aligned_cols=21  Identities=19%  Similarity=0.189  Sum_probs=18.9

Q ss_pred             hCCCcEEEEeecCCCCCCceE
Q psy12526         73 FQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      -.+.|-||+.-|++|||||.+
T Consensus        87 ~~~~~QsIiiSGESGAGKTes  107 (693)
T cd01377          87 QDRENQSILITGESGAGKTEN  107 (693)
T ss_pred             hcCCCceEEEEcCCCCCchHH
Confidence            358999999999999999975


No 96 
>PHA00729 NTP-binding motif containing protein
Probab=87.78  E-value=0.59  Score=33.80  Aligned_cols=30  Identities=10%  Similarity=0.152  Sum_probs=20.7

Q ss_pred             HHHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         65 GRDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        65 ~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ++.+++.+..+--..|+-+|..|+||||-.
T Consensus         5 ~k~~~~~l~~~~f~nIlItG~pGvGKT~LA   34 (226)
T PHA00729          5 AKKIVSAYNNNGFVSAVIFGKQGSGKTTYA   34 (226)
T ss_pred             HHHHHHHHhcCCeEEEEEECCCCCCHHHHH
Confidence            344555555433357889999999999843


No 97 
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
Probab=87.73  E-value=0.66  Score=38.46  Aligned_cols=22  Identities=18%  Similarity=0.285  Sum_probs=19.2

Q ss_pred             hCCCcEEEEeecCCCCCCceEe
Q psy12526         73 FQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      -.+-|-||+.-|++|||||.|.
T Consensus        84 ~~~~~QsIiisGESGaGKTe~~  105 (674)
T cd01384          84 NEGKSQSILVSGESGAGKTETT  105 (674)
T ss_pred             HcCCCceEEEECCCCCCchhHH
Confidence            3588999999999999999863


No 98 
>PF13604 AAA_30:  AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A.
Probab=87.67  E-value=0.22  Score=34.66  Aligned_cols=26  Identities=15%  Similarity=0.180  Sum_probs=16.5

Q ss_pred             HHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         70 DNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        70 ~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..++..-+-.++--|..|+||||+|.
T Consensus        11 ~~~l~~~~~~~~l~G~aGtGKT~~l~   36 (196)
T PF13604_consen   11 RAILTSGDRVSVLQGPAGTGKTTLLK   36 (196)
T ss_dssp             HHHHHCTCSEEEEEESTTSTHHHHHH
T ss_pred             HHHHhcCCeEEEEEECCCCCHHHHHH
Confidence            33443333234458999999999864


No 99 
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional
Probab=87.41  E-value=0.5  Score=36.72  Aligned_cols=23  Identities=22%  Similarity=0.333  Sum_probs=17.6

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+++|.|  ++..++||||||..
T Consensus        35 i~~~l~g~d--vi~~a~TGsGKT~a   57 (460)
T PRK11776         35 LPAILAGKD--VIAQAKTGSGKTAA   57 (460)
T ss_pred             HHHHhcCCC--EEEECCCCCcHHHH
Confidence            445678887  56788999999964


No 100
>cd00124 MYSc Myosin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
Probab=87.37  E-value=0.68  Score=38.28  Aligned_cols=34  Identities=21%  Similarity=0.242  Sum_probs=23.8

Q ss_pred             HHHHHHHHHHHHhh-CCCcEEEEeecCCCCCCceEe
Q psy12526         60 VFDALGRDILDNAF-QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        60 v~~~~~~~lv~~~~-~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ||.-. ..-...++ .+-|-||+.-|++|||||.+.
T Consensus        69 ifavA-~~Ay~~m~~~~~~QsIiisGESGaGKTe~~  103 (679)
T cd00124          69 VFAIA-DRAYRNMLRDRRNQSIIISGESGAGKTENT  103 (679)
T ss_pred             HHHHH-HHHHHHHHhcCCCceEEEecCCCCCchHHH
Confidence            55433 23333433 588999999999999999763


No 101
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
Probab=87.34  E-value=0.69  Score=38.44  Aligned_cols=21  Identities=24%  Similarity=0.411  Sum_probs=18.8

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .+.|-||+.-|++|||||.|.
T Consensus        91 ~~~~QsIiisGESGAGKTet~  111 (692)
T cd01385          91 KKVNQCIVISGESGSGKTEST  111 (692)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            588999999999999999863


No 102
>PRK06921 hypothetical protein; Provisional
Probab=87.32  E-value=0.24  Score=36.30  Aligned_cols=18  Identities=33%  Similarity=0.414  Sum_probs=15.0

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      -.|+-||++|+||||.+.
T Consensus       118 ~~l~l~G~~G~GKThLa~  135 (266)
T PRK06921        118 NSIALLGQPGSGKTHLLT  135 (266)
T ss_pred             CeEEEECCCCCcHHHHHH
Confidence            457789999999999764


No 103
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins. Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
Probab=87.20  E-value=0.79  Score=37.98  Aligned_cols=22  Identities=23%  Similarity=0.342  Sum_probs=19.2

Q ss_pred             hCCCcEEEEeecCCCCCCceEe
Q psy12526         73 FQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      -.+.|-||+.-|++|||||.|.
T Consensus        82 ~~~~~QsIiisGESGaGKTes~  103 (671)
T cd01381          82 REKKNQCIIISGESGAGKTEST  103 (671)
T ss_pred             HcCCCceEEEEcCCCCCeehHH
Confidence            3588999999999999999863


No 104
>PRK13851 type IV secretion system protein VirB11; Provisional
Probab=87.18  E-value=0.42  Score=36.49  Aligned_cols=27  Identities=15%  Similarity=0.267  Sum_probs=18.5

Q ss_pred             HHHHHhh-CCCcEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAF-QGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~-~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .++..+. .+.|  |+.-|.||||||.+|-
T Consensus       153 ~~l~~~v~~~~n--ilI~G~tGSGKTTll~  180 (344)
T PRK13851        153 AFLHACVVGRLT--MLLCGPTGSGKTTMSK  180 (344)
T ss_pred             HHHHHHHHcCCe--EEEECCCCccHHHHHH
Confidence            4444444 3444  6679999999998764


No 105
>cd01378 MYSc_type_I Myosin motor domain, type I myosins. Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
Probab=87.04  E-value=0.79  Score=37.96  Aligned_cols=22  Identities=18%  Similarity=0.363  Sum_probs=19.3

Q ss_pred             hCCCcEEEEeecCCCCCCceEe
Q psy12526         73 FQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      -.+-|-||+.-|++|||||.|.
T Consensus        82 ~~~~~QsIiisGESGaGKTe~~  103 (674)
T cd01378          82 SENENQCVIISGESGAGKTEAA  103 (674)
T ss_pred             HcCCCceEEEEcCCCCCcchHH
Confidence            3588999999999999999863


No 106
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins. Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=86.87  E-value=0.69  Score=38.58  Aligned_cols=22  Identities=14%  Similarity=0.155  Sum_probs=19.3

Q ss_pred             hCCCcEEEEeecCCCCCCceEe
Q psy12526         73 FQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      -.+-|-||+.-|++|||||.|.
T Consensus        87 ~~~~~QsIiisGESGaGKTes~  108 (717)
T cd01382          87 VLKMSQSIIVSGESGAGKTENT  108 (717)
T ss_pred             hcCCCCeEEEecCCCCChhHHH
Confidence            3588999999999999999863


No 107
>PRK13900 type IV secretion system ATPase VirB11; Provisional
Probab=86.82  E-value=0.52  Score=35.69  Aligned_cols=26  Identities=23%  Similarity=0.308  Sum_probs=17.9

Q ss_pred             HHHHHhh-CCCcEEEEeecCCCCCCceEe
Q psy12526         67 DILDNAF-QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        67 ~lv~~~~-~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .++..++ .+.|  |+..|.||||||.+|
T Consensus       151 ~~L~~~v~~~~n--ili~G~tgSGKTTll  177 (332)
T PRK13900        151 EFLEHAVISKKN--IIISGGTSTGKTTFT  177 (332)
T ss_pred             HHHHHHHHcCCc--EEEECCCCCCHHHHH
Confidence            3444444 3444  667999999999876


No 108
>PHA02244 ATPase-like protein
Probab=86.78  E-value=0.96  Score=35.20  Aligned_cols=36  Identities=17%  Similarity=0.182  Sum_probs=22.7

Q ss_pred             CHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         56 SQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      .+...+......+...+-.+.+..|  +|++|+|||+-
T Consensus       100 g~sp~~~~~~~ri~r~l~~~~PVLL--~GppGtGKTtL  135 (383)
T PHA02244        100 ASNPTFHYETADIAKIVNANIPVFL--KGGAGSGKNHI  135 (383)
T ss_pred             CCCHHHHHHHHHHHHHHhcCCCEEE--ECCCCCCHHHH
Confidence            3334444444455555556777554  89999999974


No 109
>cd01380 MYSc_type_V Myosin motor domain, type V myosins. Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
Probab=86.75  E-value=0.76  Score=38.17  Aligned_cols=21  Identities=19%  Similarity=0.230  Sum_probs=18.9

Q ss_pred             hCCCcEEEEeecCCCCCCceE
Q psy12526         73 FQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      -.+.|-||+.-|++|||||.+
T Consensus        82 ~~~~~QsIiiSGESGaGKTes  102 (691)
T cd01380          82 RDEKNQSIIVSGESGAGKTVS  102 (691)
T ss_pred             hcCCCceEEEEcCCCCCchHH
Confidence            368999999999999999975


No 110
>PF06309 Torsin:  Torsin;  InterPro: IPR010448 This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor
Probab=86.49  E-value=1  Score=29.79  Aligned_cols=16  Identities=25%  Similarity=0.681  Sum_probs=13.1

Q ss_pred             EEEEee-cCCCCCCceE
Q psy12526         78 ACIFAY-GQTGEKTNYL   93 (103)
Q Consensus        78 ~ti~aY-GqtgSGKT~T   93 (103)
                      ..|+++ |.||+||+|+
T Consensus        53 pLVlSfHG~tGtGKn~v   69 (127)
T PF06309_consen   53 PLVLSFHGWTGTGKNFV   69 (127)
T ss_pred             CEEEEeecCCCCcHHHH
Confidence            457777 9999999984


No 111
>PRK06547 hypothetical protein; Provisional
Probab=86.35  E-value=0.84  Score=31.29  Aligned_cols=25  Identities=16%  Similarity=0.194  Sum_probs=16.6

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+..+----|.-.|.+|||||+.
T Consensus         7 ~~~~~~~~~~~i~i~G~~GsGKTt~   31 (172)
T PRK06547          7 AARLCGGGMITVLIDGRSGSGKTTL   31 (172)
T ss_pred             HHHhhcCCCEEEEEECCCCCCHHHH
Confidence            3444444444566679999999974


No 112
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
Probab=86.24  E-value=0.95  Score=37.54  Aligned_cols=22  Identities=18%  Similarity=0.303  Sum_probs=19.3

Q ss_pred             hCCCcEEEEeecCCCCCCceEe
Q psy12526         73 FQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      -.+.|-||+.-|++|||||.|.
T Consensus        83 ~~~~~QsIiisGESGaGKTe~~  104 (677)
T cd01387          83 DAKQNQCVIISGESGSGKTEAT  104 (677)
T ss_pred             hcCCCceEEEEcCCCCCeehHH
Confidence            3588999999999999999864


No 113
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=86.19  E-value=1.2  Score=37.92  Aligned_cols=37  Identities=14%  Similarity=0.256  Sum_probs=28.8

Q ss_pred             HHHHHHH-HHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         58 EKVFDAL-GRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        58 ~~v~~~~-~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..-|+.. +..+++.+-+|.+=.++++ .||+|||+|.+
T Consensus       166 ~RyyQ~~AI~rv~Eaf~~g~~raLlvM-ATGTGKTrTAi  203 (875)
T COG4096         166 PRYYQIIAIRRVIEAFSKGQNRALLVM-ATGTGKTRTAI  203 (875)
T ss_pred             chHHHHHHHHHHHHHHhcCCceEEEEE-ecCCCcceeHH
Confidence            3344443 4788899999999977777 89999999964


No 114
>PTZ00424 helicase 45; Provisional
Probab=86.07  E-value=0.63  Score=35.17  Aligned_cols=26  Identities=15%  Similarity=0.307  Sum_probs=19.3

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ..+..+++|.|..  ..++||||||.+.
T Consensus        57 ~ai~~i~~~~d~i--i~apTGsGKT~~~   82 (401)
T PTZ00424         57 RGIKPILDGYDTI--GQAQSGTGKTATF   82 (401)
T ss_pred             HHHHHHhCCCCEE--EECCCCChHHHHH
Confidence            3455678888854  5789999999653


No 115
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family. Members of this family are assumed to differ from each other in DNA site specificity.
Probab=85.58  E-value=0.65  Score=38.26  Aligned_cols=30  Identities=7%  Similarity=0.152  Sum_probs=19.8

Q ss_pred             HHHHHHHhhC-----CCcEEEEeecCCCCCCceEec
Q psy12526         65 GRDILDNAFQ-----GYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        65 ~~~lv~~~~~-----G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +..+++.+..     |.+..| -.-.||||||+||.
T Consensus       247 v~~~~~~~~~~~~~~~~~~gl-i~~~TGsGKT~t~~  281 (667)
T TIGR00348       247 VKKIVESITRKTWGKDERGGL-IWHTQGSGKTLTML  281 (667)
T ss_pred             HHHHHHHHHhcccCCCCceeE-EEEecCCCccHHHH
Confidence            3455666555     344444 35599999999996


No 116
>TIGR03499 FlhF flagellar biosynthetic protein FlhF.
Probab=85.53  E-value=0.29  Score=36.09  Aligned_cols=17  Identities=29%  Similarity=0.257  Sum_probs=13.5

Q ss_pred             EEEeecCCCCCCceEec
Q psy12526         79 CIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm~   95 (103)
                      .|.-.|.||+|||+|+.
T Consensus       196 vi~~vGptGvGKTTt~~  212 (282)
T TIGR03499       196 VIALVGPTGVGKTTTLA  212 (282)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            45556999999999864


No 117
>PHA02653 RNA helicase NPH-II; Provisional
Probab=85.34  E-value=0.84  Score=37.87  Aligned_cols=33  Identities=18%  Similarity=0.093  Sum_probs=22.1

Q ss_pred             CCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         55 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +-|.++=+.    ++..+++|.+  |+..|+||||||.-
T Consensus       163 ~~~~~iQ~q----il~~i~~gkd--vIv~A~TGSGKTtq  195 (675)
T PHA02653        163 SLQPDVQLK----IFEAWISRKP--VVLTGGTGVGKTSQ  195 (675)
T ss_pred             chhHHHHHH----HHHHHHhCCC--EEEECCCCCCchhH
Confidence            445544443    3455667765  56899999999964


No 118
>PRK13764 ATPase; Provisional
Probab=85.23  E-value=0.38  Score=39.40  Aligned_cols=18  Identities=17%  Similarity=0.254  Sum_probs=15.2

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..|+..|.||||||+++.
T Consensus       258 ~~ILIsG~TGSGKTTll~  275 (602)
T PRK13764        258 EGILIAGAPGAGKSTFAQ  275 (602)
T ss_pred             CEEEEECCCCCCHHHHHH
Confidence            348899999999999874


No 119
>PF02562 PhoH:  PhoH-like protein;  InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [].; GO: 0005524 ATP binding; PDB: 3B85_A.
Probab=84.95  E-value=0.6  Score=33.21  Aligned_cols=17  Identities=24%  Similarity=0.528  Sum_probs=11.8

Q ss_pred             cEEEEeecCCCCCCceE
Q psy12526         77 NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~T   93 (103)
                      +-.+++.|..|||||+.
T Consensus        19 ~~~v~~~G~AGTGKT~L   35 (205)
T PF02562_consen   19 NDLVIVNGPAGTGKTFL   35 (205)
T ss_dssp             -SEEEEE--TTSSTTHH
T ss_pred             CCeEEEECCCCCcHHHH
Confidence            33688999999999984


No 120
>PF00580 UvrD-helicase:  UvrD/REP helicase N-terminal domain;  InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA. THe family includes both Rep and UvrD helcases. The Rep family helicases are composed of four structural domains []. The Rep proteins function as dimers.; GO: 0003677 DNA binding, 0004003 ATP-dependent DNA helicase activity, 0005524 ATP binding; PDB: 1UAA_B 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A 1QHG_A 1PJR_A ....
Probab=84.80  E-value=0.24  Score=35.59  Aligned_cols=20  Identities=10%  Similarity=0.071  Sum_probs=14.9

Q ss_pred             CcEEEEeecCCCCCCceEec
Q psy12526         76 YNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        76 ~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+..++.-|-.|||||+||.
T Consensus        12 ~~~~~lV~a~AGSGKT~~l~   31 (315)
T PF00580_consen   12 TEGPLLVNAGAGSGKTTTLL   31 (315)
T ss_dssp             -SSEEEEEE-TTSSHHHHHH
T ss_pred             CCCCEEEEeCCCCCchHHHH
Confidence            45566777889999999986


No 121
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional
Probab=84.69  E-value=0.88  Score=35.51  Aligned_cols=23  Identities=22%  Similarity=0.329  Sum_probs=18.0

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+++|.|  +++-.+||||||.+
T Consensus        32 i~~il~g~d--vlv~apTGsGKTla   54 (456)
T PRK10590         32 IPAVLEGRD--LMASAQTGTGKTAG   54 (456)
T ss_pred             HHHHhCCCC--EEEECCCCCcHHHH
Confidence            455678887  56788999999975


No 122
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional
Probab=84.57  E-value=0.82  Score=35.18  Aligned_cols=23  Identities=17%  Similarity=0.329  Sum_probs=18.2

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+++|-|  +++.++||+|||..
T Consensus        32 i~~~~~g~d--~l~~apTGsGKT~~   54 (434)
T PRK11192         32 IPPALDGRD--VLGSAPTGTGKTAA   54 (434)
T ss_pred             HHHHhCCCC--EEEECCCCChHHHH
Confidence            455677877  77889999999975


No 123
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional
Probab=84.53  E-value=0.53  Score=41.15  Aligned_cols=30  Identities=10%  Similarity=0.051  Sum_probs=20.2

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceEecc
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G   96 (103)
                      ..+++.+.+|....+ ..-.||||||+||..
T Consensus       423 ~ai~~a~~~g~r~~L-l~maTGSGKT~tai~  452 (1123)
T PRK11448        423 QAVEKAIVEGQREIL-LAMATGTGKTRTAIA  452 (1123)
T ss_pred             HHHHHHHHhccCCeE-EEeCCCCCHHHHHHH
Confidence            344455556665444 458999999999864


No 124
>cd00268 DEADc DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif (motif II). This domain contains the ATP- binding region.
Probab=84.52  E-value=0.99  Score=30.69  Aligned_cols=22  Identities=18%  Similarity=0.273  Sum_probs=16.3

Q ss_pred             HHhhCCCcEEEEeecCCCCCCceE
Q psy12526         70 DNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        70 ~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+++|.|  ++..++||+|||.+
T Consensus        31 ~~~~~~~~--~li~~~TG~GKT~~   52 (203)
T cd00268          31 PPLLSGRD--VIGQAQTGSGKTAA   52 (203)
T ss_pred             HHHhcCCc--EEEECCCCCcHHHH
Confidence            44455777  46689999999975


No 125
>PF06414 Zeta_toxin:  Zeta toxin;  InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [, ].; GO: 0005524 ATP binding, 0016301 kinase activity; PDB: 2P5T_H 1GVN_B 3Q8X_D.
Probab=84.49  E-value=0.36  Score=33.43  Aligned_cols=19  Identities=26%  Similarity=0.267  Sum_probs=13.8

Q ss_pred             CcEEEEeecCCCCCCceEe
Q psy12526         76 YNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        76 ~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .-..++..|+.|||||+.+
T Consensus        14 ~P~~~i~aG~~GsGKSt~~   32 (199)
T PF06414_consen   14 KPTLIIIAGQPGSGKSTLA   32 (199)
T ss_dssp             S-EEEEEES-TTSTTHHHH
T ss_pred             CCEEEEEeCCCCCCHHHHH
Confidence            3456888999999998754


No 126
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional
Probab=84.20  E-value=0.83  Score=35.12  Aligned_cols=23  Identities=22%  Similarity=0.242  Sum_probs=17.4

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+++|.|.  ++-++||||||.+
T Consensus        39 ip~il~g~dv--i~~ApTGsGKTla   61 (423)
T PRK04837         39 LPLTLAGRDV--AGQAQTGTGKTMA   61 (423)
T ss_pred             HHHHhCCCcE--EEECCCCchHHHH
Confidence            4456888874  5567999999964


No 127
>KOG0989|consensus
Probab=84.09  E-value=0.94  Score=34.59  Aligned_cols=29  Identities=21%  Similarity=0.246  Sum_probs=18.6

Q ss_pred             HHHHHhhCC-CcEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAFQG-YNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~~G-~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .++..++.+ .---.+-||+.|+|||.|..
T Consensus        46 ~~L~~a~~~~~lp~~LFyGPpGTGKTStal   75 (346)
T KOG0989|consen   46 QVLKNALLRRILPHYLFYGPPGTGKTSTAL   75 (346)
T ss_pred             HHHHHHHhhcCCceEEeeCCCCCcHhHHHH
Confidence            334444443 22335779999999998853


No 128
>PRK00440 rfc replication factor C small subunit; Reviewed
Probab=83.59  E-value=0.92  Score=33.01  Aligned_cols=21  Identities=10%  Similarity=0.074  Sum_probs=15.5

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .+...-++-||+.|+|||+.+
T Consensus        35 ~~~~~~~ll~G~~G~GKt~~~   55 (319)
T PRK00440         35 EKNMPHLLFAGPPGTGKTTAA   55 (319)
T ss_pred             CCCCCeEEEECCCCCCHHHHH
Confidence            344334678999999999754


No 129
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]
Probab=83.45  E-value=0.64  Score=35.75  Aligned_cols=27  Identities=30%  Similarity=0.288  Sum_probs=19.3

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .++..+.++. +.|+-.|=||||||.++
T Consensus       164 ~~L~~av~~r-~NILisGGTGSGKTTlL  190 (355)
T COG4962         164 KFLRRAVGIR-CNILISGGTGSGKTTLL  190 (355)
T ss_pred             HHHHHHHhhc-eeEEEeCCCCCCHHHHH
Confidence            3444455544 66888999999999864


No 130
>PRK04328 hypothetical protein; Provisional
Probab=83.21  E-value=1.1  Score=32.35  Aligned_cols=26  Identities=15%  Similarity=0.258  Sum_probs=20.8

Q ss_pred             HHHHHhhCC---CcEEEEeecCCCCCCce
Q psy12526         67 DILDNAFQG---YNACIFAYGQTGEKTNY   92 (103)
Q Consensus        67 ~lv~~~~~G---~n~ti~aYGqtgSGKT~   92 (103)
                      +-++.++.|   ....++-+|..|+|||-
T Consensus        10 ~~LD~lL~GGip~gs~ili~G~pGsGKT~   38 (249)
T PRK04328         10 PGMDEILYGGIPERNVVLLSGGPGTGKSI   38 (249)
T ss_pred             hhHHHHhcCCCcCCcEEEEEcCCCCCHHH
Confidence            456777775   47888999999999964


No 131
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=82.99  E-value=0.48  Score=32.35  Aligned_cols=25  Identities=16%  Similarity=0.223  Sum_probs=15.2

Q ss_pred             HHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         70 DNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        70 ~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..++.--. ..+..|+-|+|||+|+.
T Consensus        11 ~~~~~~~~-~~~i~GpPGTGKT~~l~   35 (236)
T PF13086_consen   11 QSALSSNG-ITLIQGPPGTGKTTTLA   35 (236)
T ss_dssp             HHHCTSSE--EEEE-STTSSHHHHHH
T ss_pred             HHHHcCCC-CEEEECCCCCChHHHHH
Confidence            44443333 34568999999998764


No 132
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the 
Probab=82.94  E-value=1.4  Score=37.21  Aligned_cols=21  Identities=14%  Similarity=0.195  Sum_probs=18.9

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .+.|-||+.-|++|||||.|.
T Consensus        83 ~~~~QsIiiSGESGAGKTe~t  103 (767)
T cd01386          83 TRRDQSIIFLGRSGAGKTTSC  103 (767)
T ss_pred             cCCCceEEEecCCCCCcHHHH
Confidence            588999999999999999763


No 133
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN. Members of this family are the GvpN protein associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy. This family belongs to a larger family of ATPases (pfam07728).
Probab=82.83  E-value=1.5  Score=31.80  Aligned_cols=29  Identities=21%  Similarity=0.245  Sum_probs=19.5

Q ss_pred             HHHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         63 ALGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        63 ~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      .+.+.++..+..|.+..  -+|.+|+|||..
T Consensus         9 ~l~~~~l~~l~~g~~vL--L~G~~GtGKT~l   37 (262)
T TIGR02640         9 RVTSRALRYLKSGYPVH--LRGPAGTGKTTL   37 (262)
T ss_pred             HHHHHHHHHHhcCCeEE--EEcCCCCCHHHH
Confidence            33344555666676654  489999999863


No 134
>COG1201 Lhr Lhr-like helicases [General function prediction only]
Probab=82.46  E-value=1.3  Score=37.65  Aligned_cols=23  Identities=26%  Similarity=0.302  Sum_probs=18.3

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+.+|.|+.|.|  +||||||-+
T Consensus        31 ~~~i~~G~nvLiiA--PTGsGKTeA   53 (814)
T COG1201          31 IPEIHSGENVLIIA--PTGSGKTEA   53 (814)
T ss_pred             HHHHhCCCceEEEc--CCCCChHHH
Confidence            45568999987754  999999864


No 135
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional
Probab=82.39  E-value=1.1  Score=35.09  Aligned_cols=25  Identities=24%  Similarity=0.255  Sum_probs=19.1

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+..+++|.|..+  -.+||||||..
T Consensus       116 ~ai~~~~~G~dvi~--~apTGSGKTla  140 (475)
T PRK01297        116 QVLGYTLAGHDAIG--RAQTGTGKTAA  140 (475)
T ss_pred             HHHHHHhCCCCEEE--ECCCCChHHHH
Confidence            45667889988654  55999999954


No 136
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional
Probab=82.35  E-value=1.1  Score=36.74  Aligned_cols=23  Identities=17%  Similarity=0.375  Sum_probs=17.8

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+++|.+  |++.++||||||.+
T Consensus        37 i~~ll~g~d--vl~~ApTGsGKT~a   59 (629)
T PRK11634         37 IPHLLNGRD--VLGMAQTGSGKTAA   59 (629)
T ss_pred             HHHHHcCCC--EEEEcCCCCcHHHH
Confidence            455677876  66788999999965


No 137
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=82.19  E-value=0.48  Score=36.62  Aligned_cols=18  Identities=17%  Similarity=0.115  Sum_probs=14.7

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..+.-.|.||+|||+|+.
T Consensus       138 ~ii~lvGptGvGKTTtia  155 (374)
T PRK14722        138 GVFALMGPTGVGKTTTTA  155 (374)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            456678999999999864


No 138
>PRK10536 hypothetical protein; Provisional
Probab=82.07  E-value=0.95  Score=33.48  Aligned_cols=17  Identities=29%  Similarity=0.522  Sum_probs=14.4

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      .-++..|..|+||||..
T Consensus        75 ~lV~i~G~aGTGKT~La   91 (262)
T PRK10536         75 QLIFATGEAGCGKTWIS   91 (262)
T ss_pred             CeEEEECCCCCCHHHHH
Confidence            37889999999999853


No 139
>TIGR02237 recomb_radB DNA repair and recombination protein RadB. This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
Probab=82.01  E-value=0.98  Score=31.13  Aligned_cols=17  Identities=18%  Similarity=0.352  Sum_probs=14.2

Q ss_pred             cEEEEeecCCCCCCceE
Q psy12526         77 NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~T   93 (103)
                      ...+.-+|.+|||||.-
T Consensus        12 g~i~~i~G~~GsGKT~l   28 (209)
T TIGR02237        12 GTITQIYGPPGSGKTNI   28 (209)
T ss_pred             CeEEEEECCCCCCHHHH
Confidence            56778899999999853


No 140
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
Probab=81.96  E-value=1.3  Score=30.98  Aligned_cols=27  Identities=22%  Similarity=0.356  Sum_probs=20.4

Q ss_pred             HHHHHhhCC---CcEEEEeecCCCCCCceE
Q psy12526         67 DILDNAFQG---YNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        67 ~lv~~~~~G---~n~ti~aYGqtgSGKT~T   93 (103)
                      +-++.++.|   ....+.-+|..|||||.-
T Consensus         6 ~~lD~~l~GGi~~g~i~~i~G~~GsGKT~l   35 (235)
T cd01123           6 KALDELLGGGIETGSITEIFGEFGSGKTQL   35 (235)
T ss_pred             hhhHhhccCCCCCCeEEEEECCCCCCHHHH
Confidence            446777775   356778899999999864


No 141
>PF10923 DUF2791:  P-loop Domain of unknown function (DUF2791);  InterPro: IPR021228  This is a family of proteins found in archaea and bacteria. Some of the proteins in this family are annotated as being methyl-accepting chemotaxis proteins and ATP/GTP binding proteins. 
Probab=81.73  E-value=1.4  Score=34.61  Aligned_cols=38  Identities=32%  Similarity=0.558  Sum_probs=28.4

Q ss_pred             CHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         56 SQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ..+..-+.+... ++.+-+|-...-|..|.-||||||.+
T Consensus        29 Gr~~e~~~l~~~-l~~v~~G~s~~kfi~G~YGsGKTf~l   66 (416)
T PF10923_consen   29 GREREIEALDRD-LDRVADGGSSFKFIRGEYGSGKTFFL   66 (416)
T ss_pred             chHHHHHHHHHH-HHHHhCCCCeEEEEEeCCCCcHHHHH
Confidence            444444444443 57788998888999999999999964


No 142
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit. RuvA specifically binds Holliday junctions as a sandwich of two tetramers and maintains the configuration of the junction. It forms a complex with two hexameric rings of RuvB, the subunit that contains helicase activity. The complex drives ATP-dependent branch migration of the Holliday junction recombination intermediate. The endonuclease RuvC resolves junctions.
Probab=81.34  E-value=1.6  Score=31.79  Aligned_cols=41  Identities=27%  Similarity=0.306  Sum_probs=25.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhC--CCcEEEEeecCCCCCCceEe
Q psy12526         53 NFASQEKVFDALGRDILDNAFQ--GYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~--G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ....|+++-+.+. .++.....  +....++-||+.|+|||+..
T Consensus         5 ~~iG~~~~~~~l~-~~l~~~~~~~~~~~~~ll~Gp~G~GKT~la   47 (305)
T TIGR00635         5 EFIGQEKVKEQLQ-LFIEAAKMRQEALDHLLLYGPPGLGKTTLA   47 (305)
T ss_pred             HHcCHHHHHHHHH-HHHHHHHhcCCCCCeEEEECCCCCCHHHHH
Confidence            4567777776643 34443222  22223667999999999854


No 143
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional
Probab=81.24  E-value=1.8  Score=34.53  Aligned_cols=29  Identities=17%  Similarity=0.166  Sum_probs=19.8

Q ss_pred             HHHHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         64 LGRDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        64 ~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ....++..+..+-|..+  ||..|+|||+..
T Consensus       183 ~le~l~~~L~~~~~iil--~GppGtGKT~lA  211 (459)
T PRK11331        183 TIETILKRLTIKKNIIL--QGPPGVGKTFVA  211 (459)
T ss_pred             HHHHHHHHHhcCCCEEE--ECCCCCCHHHHH
Confidence            33455555556666544  999999999754


No 144
>PLN03025 replication factor C subunit; Provisional
Probab=81.22  E-value=1.3  Score=32.88  Aligned_cols=17  Identities=12%  Similarity=0.143  Sum_probs=13.6

Q ss_pred             EEEeecCCCCCCceEec
Q psy12526         79 CIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm~   95 (103)
                      -++-||+.|+|||++..
T Consensus        36 ~lll~Gp~G~GKTtla~   52 (319)
T PLN03025         36 NLILSGPPGTGKTTSIL   52 (319)
T ss_pred             eEEEECCCCCCHHHHHH
Confidence            35669999999998654


No 145
>TIGR02881 spore_V_K stage V sporulation protein K. Members of this protein family are the stage V sporulation protein K (SpoVK), a close homolog of the Rubisco expression protein CbbX (TIGR02880) and a members of the ATPase family associated with various cellular activities (pfam00004). Members are strictly limited to bacterial endospore-forming species, but are not universal in this group and are missing from the Clostridium group.
Probab=81.07  E-value=0.56  Score=33.85  Aligned_cols=17  Identities=12%  Similarity=0.173  Sum_probs=13.9

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      ..++-||+.|+|||++.
T Consensus        43 ~~vll~GppGtGKTtlA   59 (261)
T TIGR02881        43 LHMIFKGNPGTGKTTVA   59 (261)
T ss_pred             ceEEEEcCCCCCHHHHH
Confidence            44677999999999864


No 146
>cd01379 MYSc_type_III Myosin motor domain, type III myosins. Myosin III has been shown to play a role in  the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
Probab=81.03  E-value=1.6  Score=36.11  Aligned_cols=21  Identities=19%  Similarity=0.351  Sum_probs=18.5

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .+.|-||+.-|++|||||.|+
T Consensus        83 ~~~~QsIiisGESGsGKTet~  103 (653)
T cd01379          83 YNQDQCIVISGESGSGKTESA  103 (653)
T ss_pred             cCCCceEEEecCCCCCchHHH
Confidence            478899999999999999864


No 147
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]
Probab=81.00  E-value=0.61  Score=35.21  Aligned_cols=22  Identities=14%  Similarity=0.150  Sum_probs=17.0

Q ss_pred             hhCCCcEEEEeecCCCCCCceE
Q psy12526         72 AFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        72 ~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +-+.---.|+-||.+|+|||++
T Consensus       146 Fg~WAPknVLFyGppGTGKTm~  167 (368)
T COG1223         146 FGDWAPKNVLFYGPPGTGKTMM  167 (368)
T ss_pred             hcccCcceeEEECCCCccHHHH
Confidence            4455566788999999999864


No 148
>KOG0335|consensus
Probab=80.84  E-value=0.79  Score=36.63  Aligned_cols=21  Identities=24%  Similarity=0.273  Sum_probs=15.5

Q ss_pred             hCCCcEEEEeecCCCCCCceEec
Q psy12526         73 FQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+|..  ++|.+|||||||+--+
T Consensus       109 ~~Grd--l~acAqTGsGKT~aFL  129 (482)
T KOG0335|consen  109 SGGRD--LMACAQTGSGKTAAFL  129 (482)
T ss_pred             ecCCc--eEEEccCCCcchHHHH
Confidence            44444  4899999999998543


No 149
>KOG2543|consensus
Probab=80.57  E-value=0.54  Score=36.86  Aligned_cols=18  Identities=28%  Similarity=0.704  Sum_probs=14.6

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      -.-|+-||.+||||||++
T Consensus        30 PS~~~iyG~sgTGKT~~~   47 (438)
T KOG2543|consen   30 PSIVHIYGHSGTGKTYLV   47 (438)
T ss_pred             ceeEEEeccCCCchhHHH
Confidence            344588999999999975


No 150
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=80.02  E-value=3.3  Score=29.23  Aligned_cols=36  Identities=19%  Similarity=0.148  Sum_probs=21.9

Q ss_pred             HHHHHHHHHHHHHHhhC-CCcEEEEeecCCCCCCceE
Q psy12526         58 EKVFDALGRDILDNAFQ-GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        58 ~~v~~~~~~~lv~~~~~-G~n~ti~aYGqtgSGKT~T   93 (103)
                      +.+|..++..|....-. +..-.|---|.+|||||+.
T Consensus        13 ~~~~~~l~~~~~~~~~~~~~~~iigi~G~~GsGKTTl   49 (229)
T PRK09270         13 EAVHKPLLRRLAALQAEPQRRTIVGIAGPPGAGKSTL   49 (229)
T ss_pred             HHHHHHHHHHHHHHHhcCCCCEEEEEECCCCCCHHHH
Confidence            45666666555444433 3333444459999999974


No 151
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional
Probab=79.99  E-value=1.5  Score=35.45  Aligned_cols=23  Identities=26%  Similarity=0.294  Sum_probs=18.2

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      |..+++|.|  |++-.+||||||.+
T Consensus        40 ip~~l~G~D--vi~~ApTGSGKTla   62 (572)
T PRK04537         40 LPVALPGGD--VAGQAQTGTGKTLA   62 (572)
T ss_pred             HHHHhCCCC--EEEEcCCCCcHHHH
Confidence            456789988  45688999999965


No 152
>PF10236 DAP3:  Mitochondrial ribosomal death-associated protein 3;  InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry represents a family of conserved proteins which were originally described as death-associated-protein-3 (DAP-3). The proteins carry a P-loop DNA-binding motif, and induce apoptosis []. DAP3 has been shown to be a pro-apoptotic factor in the mitochondrial matrix [] and to be crucial for mitochondrial biogenesis and so has also been designated as MRP-S29 (mitochondrial ribosomal protein subunit 29). 
Probab=79.92  E-value=1.4  Score=32.94  Aligned_cols=24  Identities=21%  Similarity=0.195  Sum_probs=19.1

Q ss_pred             hhCCCcEEEEeecCCCCCCceEec
Q psy12526         72 AFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        72 ~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ....-+..++-||+.|||||.+|.
T Consensus        18 ~~~~~~~r~vL~G~~GsGKS~~L~   41 (309)
T PF10236_consen   18 DKSSKNNRYVLTGERGSGKSVLLA   41 (309)
T ss_pred             cccCCceEEEEECCCCCCHHHHHH
Confidence            344567778899999999998764


No 153
>TIGR02688 conserved hypothetical protein TIGR02688. Members of this family are uncharacterized proteins sporadically distributed in bacteria and archaea, about 470 amino acids in length. Several members of this family appear in public databases with annotation as ATP-dependent protease La, despite the lack of similarity to families TIGR00763 (ATP-dependent protease La) or pfam02190 (ATP-dependent protease La (LON) domain). This protein is repeatedly found downstream of another uncharacterized protein of about 880 amino acids in length, described by model TIGR02687.
Probab=79.77  E-value=2.9  Score=33.21  Aligned_cols=27  Identities=26%  Similarity=0.410  Sum_probs=19.4

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .++.-+-.++|.++  .|++|+||||.-.
T Consensus       201 rl~~fve~~~Nli~--lGp~GTGKThla~  227 (449)
T TIGR02688       201 RLLPLVEPNYNLIE--LGPKGTGKSYIYN  227 (449)
T ss_pred             hhHHHHhcCCcEEE--ECCCCCCHHHHHH
Confidence            44444557788664  8999999998644


No 154
>KOG3859|consensus
Probab=79.68  E-value=0.88  Score=34.60  Aligned_cols=24  Identities=29%  Similarity=0.439  Sum_probs=20.4

Q ss_pred             HhhCCCcEEEEeecCCCCCCceEe
Q psy12526         71 NAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        71 ~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ++-+||.--|++-|.||-||+.-|
T Consensus        36 sv~~GF~FNilCvGETg~GKsTLm   59 (406)
T KOG3859|consen   36 SVSQGFCFNILCVGETGLGKSTLM   59 (406)
T ss_pred             HHhcCceEEEEEeccCCccHHHHH
Confidence            456799999999999999998643


No 155
>PTZ00014 myosin-A; Provisional
Probab=79.65  E-value=2.2  Score=36.23  Aligned_cols=20  Identities=15%  Similarity=0.180  Sum_probs=18.1

Q ss_pred             CCCcEEEEeecCCCCCCceE
Q psy12526         74 QGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~T   93 (103)
                      .+.|-||+.-|++|||||.+
T Consensus       180 ~~~~QsIiiSGESGAGKTe~  199 (821)
T PTZ00014        180 VKKSQTIIVSGESGAGKTEA  199 (821)
T ss_pred             cCCCceEEEEcCCCCCchHH
Confidence            58899999999999999964


No 156
>PHA02544 44 clamp loader, small subunit; Provisional
Probab=79.58  E-value=1.4  Score=32.32  Aligned_cols=18  Identities=6%  Similarity=0.065  Sum_probs=14.6

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...++-||+.|+|||+.+
T Consensus        43 ~~~lll~G~~G~GKT~la   60 (316)
T PHA02544         43 PNMLLHSPSPGTGKTTVA   60 (316)
T ss_pred             CeEEEeeCcCCCCHHHHH
Confidence            456667999999999865


No 157
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=79.55  E-value=1.9  Score=33.87  Aligned_cols=23  Identities=17%  Similarity=0.316  Sum_probs=16.9

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+++|.++  ++-.+||||||.+
T Consensus        20 i~~~l~g~dv--lv~apTGsGKTl~   42 (470)
T TIGR00614        20 INAVLLGRDC--FVVMPTGGGKSLC   42 (470)
T ss_pred             HHHHHcCCCE--EEEcCCCCcHhHH
Confidence            3456778874  5568999999964


No 158
>PRK06067 flagellar accessory protein FlaH; Validated
Probab=79.34  E-value=1.7  Score=30.63  Aligned_cols=26  Identities=23%  Similarity=0.376  Sum_probs=19.4

Q ss_pred             HHHHHhhC-CC--cEEEEeecCCCCCCce
Q psy12526         67 DILDNAFQ-GY--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        67 ~lv~~~~~-G~--n~ti~aYGqtgSGKT~   92 (103)
                      +-++.++. |+  ...++.+|.+|+|||+
T Consensus        12 ~~LD~~l~gG~~~g~~~~i~G~~GsGKt~   40 (234)
T PRK06067         12 EELDRKLGGGIPFPSLILIEGDHGTGKSV   40 (234)
T ss_pred             HHHHHhhCCCCcCCcEEEEECCCCCChHH
Confidence            45667665 43  5677888999999976


No 159
>PRK05580 primosome assembly protein PriA; Validated
Probab=79.23  E-value=1.4  Score=36.52  Aligned_cols=34  Identities=21%  Similarity=0.296  Sum_probs=21.2

Q ss_pred             CCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         54 FASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        54 ~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...|++.++.+...    .  ++ ..++.+|.||||||...
T Consensus       146 t~~Q~~ai~~i~~~----~--~~-~~~Ll~~~TGSGKT~v~  179 (679)
T PRK05580        146 NPEQAAAVEAIRAA----A--GF-SPFLLDGVTGSGKTEVY  179 (679)
T ss_pred             CHHHHHHHHHHHhc----c--CC-CcEEEECCCCChHHHHH
Confidence            44566555554321    1  23 34788999999999653


No 160
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family. Members of this protein family resemble the widely distributed ATP-dependent protease La, also called Lon and LonA. It resembles even more closely LonB, which is a LonA paralog found in genomes if and only if the species is capable of endospore formation (as in Bacillus subtilis, Clostridium tetani, and select other members of the Firmicutes) and expressed specifically in the forespore compartment. Members of this family are restricted to a subset of spore-forming species, and are very likely to participate in the program of endospore formation. We propose the designation LonC.
Probab=79.18  E-value=1.7  Score=35.56  Aligned_cols=27  Identities=19%  Similarity=0.303  Sum_probs=20.0

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ++..+...+...++-||++|+|||+..
T Consensus       166 l~~~ia~~~~~~vlL~Gp~GtGKTTLA  192 (615)
T TIGR02903       166 LLAKVASPFPQHIILYGPPGVGKTTAA  192 (615)
T ss_pred             HHHHHhcCCCCeEEEECCCCCCHHHHH
Confidence            344455567777888999999999754


No 161
>TIGR00631 uvrb excinuclease ABC, B subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University)
Probab=79.17  E-value=1.1  Score=36.92  Aligned_cols=39  Identities=18%  Similarity=0.261  Sum_probs=26.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEecc
Q psy12526         53 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~G   96 (103)
                      |.-.|..-+..+    ++.+-+|-...+ .+|.||||||+||..
T Consensus        10 ~~~~Q~~ai~~l----~~~~~~~~~~~~-l~Gvtgs~kt~~~a~   48 (655)
T TIGR00631        10 PAGDQPKAIAKL----VEGLTDGEKHQT-LLGVTGSGKTFTMAN   48 (655)
T ss_pred             CChHHHHHHHHH----HHhhhcCCCcEE-EECCCCcHHHHHHHH
Confidence            677887666654    445455532222 689999999999853


No 162
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional
Probab=79.14  E-value=2.1  Score=34.05  Aligned_cols=24  Identities=17%  Similarity=0.282  Sum_probs=18.3

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      .+..+++|.|  +++-.+||||||..
T Consensus       151 aip~il~g~d--viv~ApTGSGKTla  174 (518)
T PLN00206        151 AIPAALSGRS--LLVSADTGSGKTAS  174 (518)
T ss_pred             HHHHHhcCCC--EEEEecCCCCccHH
Confidence            3556678877  56788999999953


No 163
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=79.10  E-value=0.47  Score=35.51  Aligned_cols=13  Identities=23%  Similarity=0.388  Sum_probs=11.3

Q ss_pred             ecCCCCCCceEec
Q psy12526         83 YGQTGEKTNYLLN   95 (103)
Q Consensus        83 YGqtgSGKT~Tm~   95 (103)
                      -|.+|||||.||-
T Consensus        33 iGpSGsGKTTtLk   45 (309)
T COG1125          33 IGPSGSGKTTTLK   45 (309)
T ss_pred             ECCCCCcHHHHHH
Confidence            5999999999873


No 164
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional
Probab=78.81  E-value=1.8  Score=35.16  Aligned_cols=23  Identities=17%  Similarity=0.299  Sum_probs=16.6

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+++|.++.+  -.+||+|||-+
T Consensus        34 i~~il~g~dvlv--~apTGsGKTl~   56 (607)
T PRK11057         34 IDAVLSGRDCLV--VMPTGGGKSLC   56 (607)
T ss_pred             HHHHHcCCCEEE--EcCCCchHHHH
Confidence            345567887654  57999999863


No 165
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
Probab=78.44  E-value=2.4  Score=29.61  Aligned_cols=27  Identities=22%  Similarity=0.519  Sum_probs=20.0

Q ss_pred             HHHHHhhC-CC--cEEEEeecCCCCCCceE
Q psy12526         67 DILDNAFQ-GY--NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        67 ~lv~~~~~-G~--n~ti~aYGqtgSGKT~T   93 (103)
                      +-++.++. |+  ...++-+|..|+|||..
T Consensus        10 ~~lD~~l~GGi~~g~i~~i~G~~GsGKT~l   39 (225)
T PRK09361         10 KMLDELLGGGFERGTITQIYGPPGSGKTNI   39 (225)
T ss_pred             HHHHHHhcCCCCCCeEEEEECCCCCCHHHH
Confidence            45677775 43  45678899999999864


No 166
>PF02367 UPF0079:  Uncharacterised P-loop hydrolase UPF0079;  InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop. They are probably essential to bacteria as members are found in all genomes so far sequenced and no equivalent genes have been found in the archaea and eukaryotes, suggesting the protein may be involved in cell wall biosynthesis. The sequence of YjeE, from Haemophilus influenzae, has been determined to 1.7-A resolution. The protein has a nucleotide-binding fold with a four-stranded parallel beta-sheet flanked by antiparallel beta-strands on each side. The topology of the beta-sheet is unique among P-loop proteins and has features of different families of enzymes. ADP has been shown to bind to the P-loop in the presence of Mg2+ and ATPase activity has been confirmed by kinetic measurements [].; PDB: 1HTW_A 1FL9_A.
Probab=78.43  E-value=2.6  Score=27.56  Aligned_cols=17  Identities=18%  Similarity=0.331  Sum_probs=14.1

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      ..|+=+|.-|+|||+-.
T Consensus        16 ~vi~L~GdLGaGKTtf~   32 (123)
T PF02367_consen   16 DVILLSGDLGAGKTTFV   32 (123)
T ss_dssp             EEEEEEESTTSSHHHHH
T ss_pred             CEEEEECCCCCCHHHHH
Confidence            56788999999999744


No 167
>TIGR01242 26Sp45 26S proteasome subunit P45 family. Many proteins may score above the trusted cutoff because an internal
Probab=78.34  E-value=0.75  Score=34.85  Aligned_cols=17  Identities=24%  Similarity=0.483  Sum_probs=14.1

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      -.|+-||+.|+|||+.+
T Consensus       157 ~gvLL~GppGtGKT~la  173 (364)
T TIGR01242       157 KGVLLYGPPGTGKTLLA  173 (364)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            34788999999999754


No 168
>KOG2373|consensus
Probab=78.21  E-value=3  Score=32.79  Aligned_cols=28  Identities=21%  Similarity=0.450  Sum_probs=20.2

Q ss_pred             HHHHHhhCCC---cEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAFQGY---NACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~~G~---n~ti~aYGqtgSGKT~Tm~   95 (103)
                      |.+...+.|.   .-||| -|.||||||.-|.
T Consensus       261 pvLNk~LkGhR~GElTvl-TGpTGsGKTTFls  291 (514)
T KOG2373|consen  261 PVLNKYLKGHRPGELTVL-TGPTGSGKTTFLS  291 (514)
T ss_pred             hHHHHHhccCCCCceEEE-ecCCCCCceeEeh
Confidence            6667777776   34554 4999999998654


No 169
>KOG0926|consensus
Probab=77.77  E-value=1.4  Score=37.79  Aligned_cols=18  Identities=22%  Similarity=0.414  Sum_probs=14.6

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      |-.+..+|+||||||.-+
T Consensus       271 n~vvIIcGeTGsGKTTQv  288 (1172)
T KOG0926|consen  271 NPVVIICGETGSGKTTQV  288 (1172)
T ss_pred             CCeEEEecCCCCCccccc
Confidence            455678999999999755


No 170
>PRK00771 signal recognition particle protein Srp54; Provisional
Probab=77.73  E-value=4  Score=32.24  Aligned_cols=18  Identities=17%  Similarity=0.161  Sum_probs=15.0

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...|+-+|.+|+|||.|.
T Consensus        95 p~vI~lvG~~GsGKTTta  112 (437)
T PRK00771         95 PQTIMLVGLQGSGKTTTA  112 (437)
T ss_pred             CeEEEEECCCCCcHHHHH
Confidence            456778899999999875


No 171
>PF03215 Rad17:  Rad17 cell cycle checkpoint protein
Probab=77.47  E-value=1.5  Score=35.35  Aligned_cols=29  Identities=21%  Similarity=0.377  Sum_probs=20.0

Q ss_pred             HHHHHHhhCCCc--EEEEeecCCCCCCceEe
Q psy12526         66 RDILDNAFQGYN--ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        66 ~~lv~~~~~G~n--~ti~aYGqtgSGKT~Tm   94 (103)
                      +..++..+.+..  --++-+|++|+|||.|+
T Consensus        32 ~~wl~~~~~~~~~~~iLlLtGP~G~GKtttv   62 (519)
T PF03215_consen   32 RSWLEEMFSGSSPKRILLLTGPSGCGKTTTV   62 (519)
T ss_pred             HHHHHHHhccCCCcceEEEECCCCCCHHHHH
Confidence            445555554443  35677999999999876


No 172
>TIGR02746 TraC-F-type type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.
Probab=77.30  E-value=0.74  Score=38.24  Aligned_cols=18  Identities=17%  Similarity=0.388  Sum_probs=14.3

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      .-++..|.||||||++|.
T Consensus       431 ~n~~I~G~tGsGKS~~~~  448 (797)
T TIGR02746       431 YNIAVVGGSGAGKSFFMQ  448 (797)
T ss_pred             cceEEEcCCCCCHHHHHH
Confidence            345679999999999873


No 173
>PF12774 AAA_6:  Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A.
Probab=77.29  E-value=1.7  Score=31.27  Aligned_cols=14  Identities=14%  Similarity=0.228  Sum_probs=12.2

Q ss_pred             eecCCCCCCceEec
Q psy12526         82 AYGQTGEKTNYLLN   95 (103)
Q Consensus        82 aYGqtgSGKT~Tm~   95 (103)
                      .+|++|+|||.|+-
T Consensus        37 ~~GpagtGKtetik   50 (231)
T PF12774_consen   37 LSGPAGTGKTETIK   50 (231)
T ss_dssp             EESSTTSSHHHHHH
T ss_pred             CcCCCCCCchhHHH
Confidence            59999999998863


No 174
>PF12775 AAA_7:  P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=77.21  E-value=1.9  Score=31.74  Aligned_cols=27  Identities=19%  Similarity=0.358  Sum_probs=18.3

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +++.++.. +--++-.|++|+|||-.+.
T Consensus        25 ll~~l~~~-~~pvLl~G~~GtGKT~li~   51 (272)
T PF12775_consen   25 LLDLLLSN-GRPVLLVGPSGTGKTSLIQ   51 (272)
T ss_dssp             HHHHHHHC-TEEEEEESSTTSSHHHHHH
T ss_pred             HHHHHHHc-CCcEEEECCCCCchhHHHH
Confidence            34444432 4566789999999997653


No 175
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=77.19  E-value=0.87  Score=35.65  Aligned_cols=17  Identities=24%  Similarity=0.239  Sum_probs=13.6

Q ss_pred             EEEeecCCCCCCceEec
Q psy12526         79 CIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm~   95 (103)
                      .++-.|.+|+|||+|+.
T Consensus       223 ~i~~vGptGvGKTTt~~  239 (424)
T PRK05703        223 VVALVGPTGVGKTTTLA  239 (424)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            45556999999999864


No 176
>PRK14974 cell division protein FtsY; Provisional
Probab=76.85  E-value=4.1  Score=31.04  Aligned_cols=18  Identities=17%  Similarity=0.207  Sum_probs=14.9

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...|.-.|.+|+|||.|+
T Consensus       140 ~~vi~~~G~~GvGKTTti  157 (336)
T PRK14974        140 PVVIVFVGVNGTGKTTTI  157 (336)
T ss_pred             CeEEEEEcCCCCCHHHHH
Confidence            356778899999999875


No 177
>cd01127 TrwB Bacterial conjugation protein TrwB,  ATP binding domain. TrwB is a homohexamer encoded by conjugative plasmids in Gram-negative bacteria. TrwB also has an all alpha domain which has been hypothesized to be responsible for DNA binding. TrwB is a component of Type IV secretion and is responsible for the horizontal transfer of DNA between bacteria.
Probab=76.78  E-value=0.81  Score=35.38  Aligned_cols=17  Identities=24%  Similarity=0.296  Sum_probs=14.0

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      --++.+|.||||||..|
T Consensus        43 ~h~~i~g~tGsGKt~~i   59 (410)
T cd01127          43 AHTMIIGTTGTGKTTQI   59 (410)
T ss_pred             ccEEEEcCCCCCHHHHH
Confidence            35678999999999865


No 178
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=76.62  E-value=1.4  Score=25.55  Aligned_cols=13  Identities=15%  Similarity=0.268  Sum_probs=10.6

Q ss_pred             EEeecCCCCCCce
Q psy12526         80 IFAYGQTGEKTNY   92 (103)
Q Consensus        80 i~aYGqtgSGKT~   92 (103)
                      .+-.|.+|||||.
T Consensus        26 tli~G~nGsGKST   38 (62)
T PF13555_consen   26 TLITGPNGSGKST   38 (62)
T ss_pred             EEEECCCCCCHHH
Confidence            4458999999985


No 179
>TIGR01618 phage_P_loop phage nucleotide-binding protein. This model represents an uncharacterized family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of this protein is unknown.
Probab=76.16  E-value=1.2  Score=32.05  Aligned_cols=20  Identities=15%  Similarity=0.281  Sum_probs=16.1

Q ss_pred             cEEEEeecCCCCCCceEecc
Q psy12526         77 NACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm~G   96 (103)
                      ...++-||..|+|||+....
T Consensus        12 ~~~~liyG~~G~GKtt~a~~   31 (220)
T TIGR01618        12 PNMYLIYGKPGTGKTSTIKY   31 (220)
T ss_pred             CcEEEEECCCCCCHHHHHHh
Confidence            34588999999999987643


No 180
>PF02456 Adeno_IVa2:  Adenovirus IVa2 protein;  InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging []. During the course of lytic infection, the adenovirus major late promoter (MLP) is induced to high levels after replication of viral DNA has started. IVa2 is a transcriptional activator of the major late promoter [].; GO: 0019083 viral transcription
Probab=76.15  E-value=1.2  Score=34.16  Aligned_cols=15  Identities=40%  Similarity=0.565  Sum_probs=11.9

Q ss_pred             EEeecCCCCCCceEe
Q psy12526         80 IFAYGQTGEKTNYLL   94 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm   94 (103)
                      ...||+|||||++-+
T Consensus        90 ~~VYGPTG~GKSqLl  104 (369)
T PF02456_consen   90 GVVYGPTGSGKSQLL  104 (369)
T ss_pred             EEEECCCCCCHHHHH
Confidence            356999999998743


No 181
>PF13476 AAA_23:  AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A.
Probab=76.07  E-value=0.96  Score=30.25  Aligned_cols=16  Identities=25%  Similarity=0.445  Sum_probs=12.5

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      ...-||.+|+|||..|
T Consensus        21 ~~vi~G~Ng~GKStil   36 (202)
T PF13476_consen   21 LNVIYGPNGSGKSTIL   36 (202)
T ss_dssp             EEEEEESTTSSHHHHH
T ss_pred             cEEEECCCCCCHHHHH
Confidence            4456999999999754


No 182
>CHL00081 chlI Mg-protoporyphyrin IX chelatase
Probab=75.99  E-value=2  Score=33.02  Aligned_cols=36  Identities=19%  Similarity=0.210  Sum_probs=22.4

Q ss_pred             CHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         56 SQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .|+++=..+    +..+.+-.-+-|+-.|.+|+|||+.+-
T Consensus        21 Gq~~~k~al----~~~~~~p~~~~vli~G~~GtGKs~~ar   56 (350)
T CHL00081         21 GQEEMKLAL----ILNVIDPKIGGVMIMGDRGTGKSTTIR   56 (350)
T ss_pred             ChHHHHHHH----HHhccCCCCCeEEEEcCCCCCHHHHHH
Confidence            565544333    444444222357799999999998653


No 183
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=75.64  E-value=3.1  Score=32.94  Aligned_cols=18  Identities=28%  Similarity=0.237  Sum_probs=14.7

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..|.-.|++|+|||.|+.
T Consensus       242 ~vI~LVGptGvGKTTTia  259 (436)
T PRK11889        242 QTIALIGPTGVGKTTTLA  259 (436)
T ss_pred             cEEEEECCCCCcHHHHHH
Confidence            456778999999998864


No 184
>PTZ00110 helicase; Provisional
Probab=75.57  E-value=2.5  Score=33.99  Aligned_cols=23  Identities=17%  Similarity=0.252  Sum_probs=17.9

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+++|.+.  ++-.+||||||.+
T Consensus       161 ip~~l~G~dv--I~~ApTGSGKTla  183 (545)
T PTZ00110        161 WPIALSGRDM--IGIAETGSGKTLA  183 (545)
T ss_pred             HHHHhcCCCE--EEEeCCCChHHHH
Confidence            4567889875  4678999999975


No 185
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]
Probab=75.54  E-value=2.1  Score=33.18  Aligned_cols=25  Identities=24%  Similarity=0.348  Sum_probs=20.9

Q ss_pred             hCCCcEEEEeecCCCCCCce---EeccC
Q psy12526         73 FQGYNACIFAYGQTGEKTNY---LLNGN   97 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~---Tm~G~   97 (103)
                      -.|+.-+|+..|+.|+|||.   ||+|.
T Consensus        19 k~Gi~f~im~~G~sG~GKttfiNtL~~~   46 (373)
T COG5019          19 KKGIDFTIMVVGESGLGKTTFINTLFGT   46 (373)
T ss_pred             hcCCceEEEEecCCCCchhHHHHhhhHh
Confidence            46999999999999999986   55554


No 186
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed
Probab=75.52  E-value=1.7  Score=36.47  Aligned_cols=21  Identities=19%  Similarity=0.295  Sum_probs=16.0

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .+--..++-||+.|+|||+..
T Consensus        49 ~~~~~slLL~GPpGtGKTTLA   69 (725)
T PRK13341         49 ADRVGSLILYGPPGVGKTTLA   69 (725)
T ss_pred             cCCCceEEEECCCCCCHHHHH
Confidence            344446778999999999864


No 187
>PF05496 RuvB_N:  Holliday junction DNA helicase ruvB N-terminus;  InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair. Branch migration is catalysed by the RuvB protein that is targeted to the Holliday junction by the structure specific RuvA protein []. This group of sequences contain this signature which is located in the N-terminal region of the proteins.; GO: 0009378 four-way junction helicase activity, 0006281 DNA repair, 0006310 DNA recombination; PDB: 1IQP_B 3PFI_B 1IXR_C 1HQC_B 1IXS_B.
Probab=75.51  E-value=5.8  Score=28.91  Aligned_cols=39  Identities=21%  Similarity=0.269  Sum_probs=26.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCC--CcEEEEeecCCCCCCce
Q psy12526         53 NFASQEKVFDALGRDILDNAFQG--YNACIFAYGQTGEKTNY   92 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G--~n~ti~aYGqtgSGKT~   92 (103)
                      ....|+.+-... ..+++.+...  .--.++-||+.|.|||.
T Consensus        25 efiGQ~~l~~~l-~i~i~aa~~r~~~l~h~lf~GPPG~GKTT   65 (233)
T PF05496_consen   25 EFIGQEHLKGNL-KILIRAAKKRGEALDHMLFYGPPGLGKTT   65 (233)
T ss_dssp             CS-S-HHHHHHH-HHHHHHHHCTTS---EEEEESSTTSSHHH
T ss_pred             HccCcHHHHhhh-HHHHHHHHhcCCCcceEEEECCCccchhH
Confidence            678999998775 5677776542  23357789999999985


No 188
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11. The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.
Probab=75.38  E-value=2.2  Score=31.69  Aligned_cols=28  Identities=25%  Similarity=0.329  Sum_probs=18.4

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ..++..++.+- ..++--|.||||||..|
T Consensus       134 ~~~l~~~v~~~-~~ili~G~tGsGKTTll  161 (308)
T TIGR02788       134 KEFLRLAIASR-KNIIISGGTGSGKTTFL  161 (308)
T ss_pred             HHHHHHHhhCC-CEEEEECCCCCCHHHHH
Confidence            34555555432 34556899999999854


No 189
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase. Members of this protein family comprise a distinct clade of putative ATPase associated with an integral membrane complex likely to act in pilus formation, secretion, or conjugal transfer. The association of most members with a nearby gene for a DEAH-box helicase suggests a role in conjugal transfer.
Probab=75.28  E-value=1.5  Score=33.32  Aligned_cols=29  Identities=21%  Similarity=0.303  Sum_probs=20.6

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..++..++.+ ...|+--|.||||||..|.
T Consensus       168 ~~~L~~~v~~-~~~ili~G~tGsGKTTll~  196 (340)
T TIGR03819       168 ARLLRAIVAA-RLAFLISGGTGSGKTTLLS  196 (340)
T ss_pred             HHHHHHHHhC-CCeEEEECCCCCCHHHHHH
Confidence            4556665654 3567789999999987553


No 190
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type. subtype of CRISPR/Cas locus, found in several species of Cyanobacteria and several archaeal species. It contains helicase motifs and appears to represent the Cas3 protein of the Cyano subtype of CRISPR/Cas system.
Probab=75.25  E-value=2.7  Score=31.86  Aligned_cols=25  Identities=16%  Similarity=0.158  Sum_probs=19.1

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ++.+.++-+..++.-..||||||..
T Consensus         6 ~~~~~~~~~~~~~i~apTGsGKT~~   30 (357)
T TIGR03158         6 FEALQSKDADIIFNTAPTGAGKTLA   30 (357)
T ss_pred             HHHHHcCCCCEEEEECCCCCCHHHH
Confidence            3455677766677889999999974


No 191
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=75.20  E-value=1.4  Score=34.12  Aligned_cols=15  Identities=27%  Similarity=0.414  Sum_probs=12.5

Q ss_pred             EEEEeecCCCCCCce
Q psy12526         78 ACIFAYGQTGEKTNY   92 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~   92 (103)
                      +-|+--|+||||||+
T Consensus        98 SNILLiGPTGsGKTl  112 (408)
T COG1219          98 SNILLIGPTGSGKTL  112 (408)
T ss_pred             ccEEEECCCCCcHHH
Confidence            346779999999986


No 192
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]
Probab=75.17  E-value=2.5  Score=33.77  Aligned_cols=24  Identities=17%  Similarity=0.271  Sum_probs=18.2

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      ..+..+++|.+  |++..+||||||.
T Consensus        58 ~~IP~~l~g~D--vi~~A~TGsGKT~   81 (513)
T COG0513          58 AAIPLILAGRD--VLGQAQTGTGKTA   81 (513)
T ss_pred             HHHHHHhCCCC--EEEECCCCChHHH
Confidence            34556688865  6688999999975


No 193
>PF05673 DUF815:  Protein of unknown function (DUF815);  InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function.
Probab=75.06  E-value=2.5  Score=31.04  Aligned_cols=25  Identities=24%  Similarity=0.489  Sum_probs=18.4

Q ss_pred             HHhhCCCcEE-EEeecCCCCCCceEe
Q psy12526         70 DNAFQGYNAC-IFAYGQTGEKTNYLL   94 (103)
Q Consensus        70 ~~~~~G~n~t-i~aYGqtgSGKT~Tm   94 (103)
                      ..+++|..+- ++-||..|+|||.++
T Consensus        44 ~~Fl~G~pannvLL~G~rGtGKSSlV   69 (249)
T PF05673_consen   44 EQFLQGLPANNVLLWGARGTGKSSLV   69 (249)
T ss_pred             HHHHcCCCCcceEEecCCCCCHHHHH
Confidence            4567776432 566999999998764


No 194
>PRK10917 ATP-dependent DNA helicase RecG; Provisional
Probab=75.05  E-value=3.4  Score=34.18  Aligned_cols=37  Identities=11%  Similarity=0.065  Sum_probs=23.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         53 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ....|+.+...+..    ..-.+...-++..|+||||||-.
T Consensus       262 lt~~Q~~ai~~I~~----d~~~~~~~~~Ll~~~TGSGKT~v  298 (681)
T PRK10917        262 LTGAQKRVVAEILA----DLASPKPMNRLLQGDVGSGKTVV  298 (681)
T ss_pred             CCHHHHHHHHHHHH----hhhccCCceEEEECCCCCcHHHH
Confidence            34456655555443    33334444678899999999964


No 195
>KOG0953|consensus
Probab=74.75  E-value=1.5  Score=36.01  Aligned_cols=16  Identities=25%  Similarity=0.335  Sum_probs=13.8

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      -||.-|+|.|||||.-
T Consensus       193 Ii~H~GPTNSGKTy~A  208 (700)
T KOG0953|consen  193 IIMHVGPTNSGKTYRA  208 (700)
T ss_pred             EEEEeCCCCCchhHHH
Confidence            3899999999999953


No 196
>PF00931 NB-ARC:  NB-ARC domain;  InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []. This domain has been structurally characterised in the human protein apoptotic protease-activating factor 1 (Apaf-1) []. It contains the three-layered alpha-beta fold and subsequent short alpha-helical region characteristic of the AAA+ ATPase domain superfamily. While this domain is thought to bind and hyrolyse ATP, only ADP binding has been experimentally verified. It is proposed that binding and hydrolysis of ATP by this domain induces conformational changes the the overall protein, leading to formation of the apoptosome.; GO: 0043531 ADP binding; PDB: 3IZA_E 1Z6T_D 3SFZ_A 3SHF_A 1VT4_M 3IZ8_G 3LQR_A 2A5Y_C 3LQQ_A.
Probab=74.64  E-value=4.7  Score=28.81  Aligned_cols=29  Identities=14%  Similarity=0.045  Sum_probs=20.6

Q ss_pred             HHHHHHHhhC--CCcEEEEeecCCCCCCceE
Q psy12526         65 GRDILDNAFQ--GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        65 ~~~lv~~~~~--G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+.+.+.+  .-...|.-+|..|.|||..
T Consensus         5 ~~~l~~~L~~~~~~~~~v~I~G~~G~GKT~L   35 (287)
T PF00931_consen    5 IEKLKDWLLDNSNEVRVVAIVGMGGIGKTTL   35 (287)
T ss_dssp             HHHHHHHHHTTTTSSEEEEEEESTTSSHHHH
T ss_pred             HHHHHHHhhCCCCCeEEEEEEcCCcCCccee
Confidence            3445555555  5566788899999999863


No 197
>TIGR03744 traC_PFL_4706 conjugative transfer ATPase, PFL_4706 family. Members of this protein family are predicted ATP-binding proteins apparently associated with DNA conjugal transfer. Members are found both in plasmids and in bacterial chromosomal regions that appear to derive from integrative elements such as conjugative transposons. More distant homologs, outside the scope of this family, include type IV secretion/conjugal transfer proteins such as TraC, VirB4 and TrsE. The granularity of this protein family definition is chosen so as to represent one distinctive clade and act as a marker through which to define and recognize the class of mobile element it serves.
Probab=74.51  E-value=0.96  Score=38.53  Aligned_cols=18  Identities=33%  Similarity=0.460  Sum_probs=15.0

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      |.-.+..|.||||||++|
T Consensus       475 n~n~~I~G~TGSGKS~l~  492 (893)
T TIGR03744       475 NAHLLILGPTGAGKSATL  492 (893)
T ss_pred             cccEEEECCCCCCHHHHH
Confidence            555677999999999876


No 198
>TIGR02902 spore_lonB ATP-dependent protease LonB. Members of this protein are LonB, a paralog of the ATP-dependent protease La (LonA, TIGR00763). LonB proteins are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore, during sporulation, under control of sigma(F). The lonB gene, despite location immediately upstream of lonA, was shown to be monocistronic. LonB appears able to act on sigma(H) for post-translation control, but lonB mutation did not produce an obvious sporulation defect under the conditions tested. Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and this model selects only one per species as the protein that corresponds to LonB in B. subtilis.
Probab=74.25  E-value=3.6  Score=33.11  Aligned_cols=24  Identities=13%  Similarity=0.133  Sum_probs=17.5

Q ss_pred             HHhhCCCcEEEEeecCCCCCCceE
Q psy12526         70 DNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        70 ~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..++.....-|+-||++|+|||+.
T Consensus        79 ~al~~~~~~~vLi~Ge~GtGKt~l  102 (531)
T TIGR02902        79 AALCGPNPQHVIIYGPPGVGKTAA  102 (531)
T ss_pred             HHHhCCCCceEEEECCCCCCHHHH
Confidence            334555556678899999999764


No 199
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed
Probab=74.23  E-value=1.3  Score=33.00  Aligned_cols=40  Identities=28%  Similarity=0.329  Sum_probs=23.6

Q ss_pred             CCCHHHHHHHHHHHHHHHhhC--CCcEEEEeecCCCCCCceEe
Q psy12526         54 FASQEKVFDALGRDILDNAFQ--GYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        54 ~~~q~~v~~~~~~~lv~~~~~--G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...|+++-+.+. .++.....  .-...++-||..|+|||+.+
T Consensus        27 ~vG~~~~~~~l~-~~l~~~~~~~~~~~~~ll~GppG~GKT~la   68 (328)
T PRK00080         27 FIGQEKVKENLK-IFIEAAKKRGEALDHVLLYGPPGLGKTTLA   68 (328)
T ss_pred             hcCcHHHHHHHH-HHHHHHHhcCCCCCcEEEECCCCccHHHHH
Confidence            446666655543 33443322  22235677999999999854


No 200
>cd01394 radB RadB. The archaeal protein radB shares similarity radA, the archaeal functional homologue to the bacterial RecA. The precise function of radB is unclear.
Probab=74.18  E-value=3.8  Score=28.40  Aligned_cols=27  Identities=22%  Similarity=0.378  Sum_probs=19.5

Q ss_pred             HHHHHhhC-CC--cEEEEeecCCCCCCceE
Q psy12526         67 DILDNAFQ-GY--NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        67 ~lv~~~~~-G~--n~ti~aYGqtgSGKT~T   93 (103)
                      +-++.++. |+  ...+..+|..|||||..
T Consensus         6 ~~LD~~l~GGi~~g~i~~i~G~~GsGKT~l   35 (218)
T cd01394           6 KGLDELLGGGVERGTVTQVYGPPGTGKTNI   35 (218)
T ss_pred             hHHHHHhcCCccCCeEEEEECCCCCCHHHH
Confidence            34567775 44  34577899999999864


No 201
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=74.13  E-value=0.82  Score=32.19  Aligned_cols=13  Identities=15%  Similarity=0.383  Sum_probs=11.1

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|++|||||.+|
T Consensus        30 ivGpNGaGKSTll   42 (212)
T cd03274          30 IVGPNGSGKSNVI   42 (212)
T ss_pred             EECCCCCCHHHHH
Confidence            4699999999876


No 202
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=74.12  E-value=1.1  Score=35.77  Aligned_cols=18  Identities=17%  Similarity=0.115  Sum_probs=14.1

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..+.-.|.||+|||.|+.
T Consensus       257 ~Vi~LvGpnGvGKTTTia  274 (484)
T PRK06995        257 GVFALMGPTGVGKTTTTA  274 (484)
T ss_pred             cEEEEECCCCccHHHHHH
Confidence            345566999999999864


No 203
>PRK04195 replication factor C large subunit; Provisional
Probab=73.93  E-value=3.2  Score=32.73  Aligned_cols=29  Identities=21%  Similarity=0.464  Sum_probs=19.9

Q ss_pred             HHHHHHhhCCC-cEEEEeecCCCCCCceEe
Q psy12526         66 RDILDNAFQGY-NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        66 ~~lv~~~~~G~-n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...+....+|. .-.++-||+.|+|||+..
T Consensus        27 ~~~l~~~~~g~~~~~lLL~GppG~GKTtla   56 (482)
T PRK04195         27 REWIESWLKGKPKKALLLYGPPGVGKTSLA   56 (482)
T ss_pred             HHHHHHHhcCCCCCeEEEECCCCCCHHHHH
Confidence            34445544554 446788999999999754


No 204
>PRK06696 uridine kinase; Validated
Probab=73.87  E-value=6.2  Score=27.70  Aligned_cols=34  Identities=15%  Similarity=0.090  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         58 EKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        58 ~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      .++.+.++..++. ...+...-|.--|.+|||||+
T Consensus         4 ~~~~~~la~~~~~-~~~~~~~iI~I~G~sgsGKST   37 (223)
T PRK06696          4 KQLIKELAEHILT-LNLTRPLRVAIDGITASGKTT   37 (223)
T ss_pred             HHHHHHHHHHHHH-hCCCCceEEEEECCCCCCHHH
Confidence            4455555544332 223445566777999999987


No 205
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=73.86  E-value=1  Score=33.41  Aligned_cols=12  Identities=33%  Similarity=0.531  Sum_probs=10.5

Q ss_pred             ecCCCCCCceEe
Q psy12526         83 YGQTGEKTNYLL   94 (103)
Q Consensus        83 YGqtgSGKT~Tm   94 (103)
                      .|.+|+|||.+|
T Consensus        37 lG~NGAGKTTll   48 (293)
T COG1131          37 LGPNGAGKTTLL   48 (293)
T ss_pred             ECCCCCCHHHHH
Confidence            499999999865


No 206
>PRK01172 ski2-like helicase; Provisional
Probab=73.83  E-value=2.8  Score=34.39  Aligned_cols=22  Identities=14%  Similarity=0.188  Sum_probs=16.0

Q ss_pred             HHhhCCCcEEEEeecCCCCCCceE
Q psy12526         70 DNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        70 ~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+++|-|  ++.-++||||||..
T Consensus        32 ~~l~~~~n--vlv~apTGSGKTl~   53 (674)
T PRK01172         32 EQLRKGEN--VIVSVPTAAGKTLI   53 (674)
T ss_pred             HHHhcCCc--EEEECCCCchHHHH
Confidence            34466776  45678999999963


No 207
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=73.71  E-value=1  Score=33.85  Aligned_cols=27  Identities=22%  Similarity=0.123  Sum_probs=19.1

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      -|...+-.+.|  |+-.|.||||||..|.
T Consensus       135 yL~~~ie~~~s--iii~G~t~sGKTt~ln  161 (312)
T COG0630         135 YLWLAIEARKS--IIICGGTASGKTTLLN  161 (312)
T ss_pred             HHHHHHHcCCc--EEEECCCCCCHHHHHH
Confidence            34444555554  6779999999998763


No 208
>PRK13342 recombination factor protein RarA; Reviewed
Probab=73.70  E-value=2.8  Score=32.35  Aligned_cols=40  Identities=18%  Similarity=0.304  Sum_probs=23.0

Q ss_pred             CCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         54 FASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        54 ~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...|+.+... ...+...+-.+.-..++-||+.|+|||+..
T Consensus        14 ~vGq~~~v~~-~~~L~~~i~~~~~~~ilL~GppGtGKTtLA   53 (413)
T PRK13342         14 VVGQEHLLGP-GKPLRRMIEAGRLSSMILWGPPGTGKTTLA   53 (413)
T ss_pred             hcCcHHHhCc-chHHHHHHHcCCCceEEEECCCCCCHHHHH
Confidence            3455555433 122333333444446666999999999754


No 209
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=73.57  E-value=4.7  Score=30.35  Aligned_cols=18  Identities=17%  Similarity=0.233  Sum_probs=13.9

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      -.|.-.|.+|+|||.|+.
T Consensus       115 ~vi~lvGpnGsGKTTt~~  132 (318)
T PRK10416        115 FVILVVGVNGVGKTTTIG  132 (318)
T ss_pred             eEEEEECCCCCcHHHHHH
Confidence            355566999999998753


No 210
>TIGR01389 recQ ATP-dependent DNA helicase RecQ. The ATP-dependent DNA helicase RecQ of E. coli is about 600 residues long. This model represents bacterial proteins with a high degree of similarity in domain architecture and in primary sequence to E. coli RecQ. The model excludes eukaryotic and archaeal proteins with RecQ-like regions, as well as more distantly related bacterial helicases related to RecQ.
Probab=73.24  E-value=3.3  Score=33.39  Aligned_cols=23  Identities=13%  Similarity=0.271  Sum_probs=17.0

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..+++|.|+  ++-.+||+|||..
T Consensus        22 i~~il~g~dv--lv~~PTG~GKTl~   44 (591)
T TIGR01389        22 ISHVLDGRDV--LVVMPTGGGKSLC   44 (591)
T ss_pred             HHHHHcCCCE--EEEcCCCccHhHH
Confidence            4455788874  5567999999875


No 211
>cd01393 recA_like RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57.  Archaea have the RecA-like homologs radA and radB.
Probab=72.92  E-value=4.1  Score=28.25  Aligned_cols=28  Identities=21%  Similarity=0.319  Sum_probs=19.9

Q ss_pred             HHHHHhhC-CC--cEEEEeecCCCCCCceEe
Q psy12526         67 DILDNAFQ-GY--NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        67 ~lv~~~~~-G~--n~ti~aYGqtgSGKT~Tm   94 (103)
                      +-++.++. |+  ...+.-+|.+|+|||..+
T Consensus         6 ~~lD~~l~GG~~~g~v~~I~G~~GsGKT~l~   36 (226)
T cd01393           6 KALDELLGGGIPTGRITEIFGEFGSGKTQLC   36 (226)
T ss_pred             HHHHHHhCCCCcCCcEEEEeCCCCCChhHHH
Confidence            45677775 43  445677999999998744


No 212
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family. Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.
Probab=72.90  E-value=3.8  Score=29.10  Aligned_cols=26  Identities=15%  Similarity=0.321  Sum_probs=19.1

Q ss_pred             HHHHHhhC-CC--cEEEEeecCCCCCCce
Q psy12526         67 DILDNAFQ-GY--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        67 ~lv~~~~~-G~--n~ti~aYGqtgSGKT~   92 (103)
                      +-++.++. |+  ..+++-+|..|+|||.
T Consensus         8 ~~LD~~l~GG~~~gs~~lI~G~pGsGKT~   36 (237)
T TIGR03877         8 PGMDEILHGGIPERNVVLLSGGPGTGKSI   36 (237)
T ss_pred             HhHHHHhcCCCcCCeEEEEEcCCCCCHHH
Confidence            34566554 44  5778899999999975


No 213
>TIGR00643 recG ATP-dependent DNA helicase RecG.
Probab=72.85  E-value=3.9  Score=33.45  Aligned_cols=37  Identities=11%  Similarity=0.107  Sum_probs=22.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         53 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ....|+.+...+..    ..-.....-++.-|.||||||..
T Consensus       236 lt~~Q~~ai~~I~~----~~~~~~~~~~Ll~g~TGSGKT~v  272 (630)
T TIGR00643       236 LTRAQKRVVKEILQ----DLKSDVPMNRLLQGDVGSGKTLV  272 (630)
T ss_pred             CCHHHHHHHHHHHH----HhccCCCccEEEECCCCCcHHHH
Confidence            34456655555443    32233334467899999999974


No 214
>PRK03992 proteasome-activating nucleotidase; Provisional
Probab=72.81  E-value=1.7  Score=33.47  Aligned_cols=16  Identities=25%  Similarity=0.538  Sum_probs=13.5

Q ss_pred             EEEEeecCCCCCCceE
Q psy12526         78 ACIFAYGQTGEKTNYL   93 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~T   93 (103)
                      ..|+-||+.|+|||+.
T Consensus       166 ~gvLL~GppGtGKT~l  181 (389)
T PRK03992        166 KGVLLYGPPGTGKTLL  181 (389)
T ss_pred             CceEEECCCCCChHHH
Confidence            4578899999999975


No 215
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family. This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
Probab=72.55  E-value=3.2  Score=30.08  Aligned_cols=16  Identities=13%  Similarity=0.094  Sum_probs=13.8

Q ss_pred             cEEEEeecCCCCCCce
Q psy12526         77 NACIFAYGQTGEKTNY   92 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~   92 (103)
                      ..+++-+|.+|+|||.
T Consensus        36 gs~~lI~G~pGtGKT~   51 (259)
T TIGR03878        36 YSVINITGVSDTGKSL   51 (259)
T ss_pred             CcEEEEEcCCCCCHHH
Confidence            5678889999999985


No 216
>PHA01747 putative ATP-dependent protease
Probab=72.21  E-value=3  Score=32.73  Aligned_cols=29  Identities=7%  Similarity=0.107  Sum_probs=21.9

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .|+++....+-|.-++=.|+-|+||||+-
T Consensus       179 iPlVE~~~~~~NyNliELgPRGTGKS~~f  207 (425)
T PHA01747        179 LPLFTSPVSKRPVHIIELSNRGTGKTTTF  207 (425)
T ss_pred             hhheeccCCCCCeeEEEecCCCCChhhHH
Confidence            36666545566777788999999999964


No 217
>PRK13767 ATP-dependent helicase; Provisional
Probab=71.99  E-value=3.4  Score=35.19  Aligned_cols=22  Identities=23%  Similarity=0.212  Sum_probs=16.6

Q ss_pred             HHhhCCCcEEEEeecCCCCCCceE
Q psy12526         70 DNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        70 ~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+++|.|+.|  -.+||||||..
T Consensus        42 ~~il~g~nvli--~APTGSGKTla   63 (876)
T PRK13767         42 PLIHEGKNVLI--SSPTGSGKTLA   63 (876)
T ss_pred             HHHHcCCCEEE--ECCCCCcHHHH
Confidence            34578888655  67999999974


No 218
>KOG0340|consensus
Probab=71.84  E-value=2.7  Score=32.85  Aligned_cols=27  Identities=11%  Similarity=0.273  Sum_probs=21.3

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .+|..+|+|-+|  +....||||||.-.-
T Consensus        36 ~cIpkILeGrdc--ig~AkTGsGKT~AFa   62 (442)
T KOG0340|consen   36 ACIPKILEGRDC--IGCAKTGSGKTAAFA   62 (442)
T ss_pred             hhhHHHhccccc--ccccccCCCcchhhh
Confidence            457788999986  467899999997543


No 219
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family. Members of this protein family are archaeal single-domain KaiC_related proteins, homologous to the Cyanobacterial circadian clock cycle protein KaiC, an autokinase/autophosphorylase that has two copies of the domain.
Probab=71.80  E-value=3.8  Score=28.63  Aligned_cols=28  Identities=18%  Similarity=0.318  Sum_probs=19.6

Q ss_pred             HHHHHhhC-CC--cEEEEeecCCCCCCceEe
Q psy12526         67 DILDNAFQ-GY--NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        67 ~lv~~~~~-G~--n~ti~aYGqtgSGKT~Tm   94 (103)
                      +-++.++. |+  ...++-+|.+|+|||...
T Consensus         7 ~~LD~~l~GGi~~G~~~~i~G~~G~GKT~l~   37 (229)
T TIGR03881         7 EGLDKLLEGGIPRGFFVAVTGEPGTGKTIFC   37 (229)
T ss_pred             hhHHHhhcCCCcCCeEEEEECCCCCChHHHH
Confidence            34566653 44  566778999999998743


No 220
>PRK13531 regulatory ATPase RavA; Provisional
Probab=71.52  E-value=3.8  Score=32.99  Aligned_cols=28  Identities=25%  Similarity=0.307  Sum_probs=19.8

Q ss_pred             HHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         64 LGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        64 ~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      .++-++..++.|-+  |+-+|..|+|||+.
T Consensus        28 vI~lll~aalag~h--VLL~GpPGTGKT~L   55 (498)
T PRK13531         28 AIRLCLLAALSGES--VFLLGPPGIAKSLI   55 (498)
T ss_pred             HHHHHHHHHccCCC--EEEECCCChhHHHH
Confidence            34445566676766  45699999999874


No 221
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional
Probab=71.30  E-value=4.7  Score=31.93  Aligned_cols=18  Identities=22%  Similarity=0.372  Sum_probs=14.2

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..++..|.+|+|||.|+.
T Consensus       224 ~vi~lvGptGvGKTTtaa  241 (432)
T PRK12724        224 KVVFFVGPTGSGKTTSIA  241 (432)
T ss_pred             eEEEEECCCCCCHHHHHH
Confidence            456677999999998753


No 222
>PF00158 Sigma54_activat:  Sigma-54 interaction domain;  InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor. These have a conserved domain of about 230 residues involved in the ATP-dependent [, ] interaction with sigma-54. About half of the proteins in which this domain is found (algB, dcdT, flbD, hoxA, hupR1, hydG, ntrC, pgtA and pilR) belong to signal transduction two-component systems [] and possess a domain that can be phosphorylated by a sensor-kinase protein in their N-terminal section. Almost all of these proteins possess a helix-turn-helix DNA-binding domain in their C-terminal section. The domain which interacts with the sigma-54 factor has an ATPase activity. This may be required to promote a conformational change necessary for the interaction []. The domain contains an atypical ATP-binding motif A (P-loop) as well as a form of motif B. The two ATP-binding motifs are located in the N-terminal section of the domain.; GO: 0005524 ATP binding, 0008134 transcription factor binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 1NY6_K 3M0E_G 1NY5_A 1OJL_A 3DZD_B 2C9C_A 2C98_A 2C96_A 2BJV_A 2C99_A ....
Probab=71.29  E-value=2.2  Score=29.09  Aligned_cols=19  Identities=16%  Similarity=0.279  Sum_probs=15.5

Q ss_pred             CCCcEEEEeecCCCCCCce
Q psy12526         74 QGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~   92 (103)
                      .-++..|+-+|++|+||+.
T Consensus        19 a~~~~pVlI~GE~GtGK~~   37 (168)
T PF00158_consen   19 ASSDLPVLITGETGTGKEL   37 (168)
T ss_dssp             TTSTS-EEEECSTTSSHHH
T ss_pred             hCCCCCEEEEcCCCCcHHH
Confidence            4677889999999999975


No 223
>PRK10865 protein disaggregation chaperone; Provisional
Probab=71.24  E-value=4  Score=34.78  Aligned_cols=38  Identities=18%  Similarity=0.308  Sum_probs=22.8

Q ss_pred             CHHHHHHHHHHHHHHHhhCCCc------EEEEeecCCCCCCceEe
Q psy12526         56 SQEKVFDALGRDILDNAFQGYN------ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~n------~ti~aYGqtgSGKT~Tm   94 (103)
                      .|...-..+... |..+..|..      +.++-.|++|+|||++.
T Consensus       572 GQ~~ai~~l~~~-i~~~~~gl~~~~~p~~~~Lf~Gp~G~GKT~lA  615 (857)
T PRK10865        572 GQNEAVEAVSNA-IRRSRAGLSDPNRPIGSFLFLGPTGVGKTELC  615 (857)
T ss_pred             CCHHHHHHHHHH-HHHHHhcccCCCCCCceEEEECCCCCCHHHHH
Confidence            455454444433 333333332      56778899999999854


No 224
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=71.08  E-value=2.5  Score=31.02  Aligned_cols=29  Identities=21%  Similarity=0.430  Sum_probs=21.5

Q ss_pred             HhhCCCcEEE------EeecCCCCCCc---eEeccCCC
Q psy12526         71 NAFQGYNACI------FAYGQTGEKTN---YLLNGNGP   99 (103)
Q Consensus        71 ~~~~G~n~ti------~aYGqtgSGKT---~Tm~G~~~   99 (103)
                      .+++|.|-+|      --.|++||||+   ||++|.+.
T Consensus        18 eILkgvnL~v~~GEvhaiMGPNGsGKSTLa~~i~G~p~   55 (251)
T COG0396          18 EILKGVNLTVKEGEVHAIMGPNGSGKSTLAYTIMGHPK   55 (251)
T ss_pred             hhhcCcceeEcCCcEEEEECCCCCCHHHHHHHHhCCCC
Confidence            4677888776      34799999996   57888653


No 225
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=70.62  E-value=1.7  Score=27.86  Aligned_cols=16  Identities=19%  Similarity=0.270  Sum_probs=12.2

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      .+.-.|++|||||..+
T Consensus        17 ~v~I~GpSGsGKSTLl   32 (107)
T cd00820          17 GVLITGDSGIGKTELA   32 (107)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            3445799999999754


No 226
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]
Probab=70.32  E-value=3.7  Score=29.44  Aligned_cols=24  Identities=21%  Similarity=0.447  Sum_probs=17.1

Q ss_pred             HHHhhCC-C--cEEEEeecCCCCCCce
Q psy12526         69 LDNAFQG-Y--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        69 v~~~~~G-~--n~ti~aYGqtgSGKT~   92 (103)
                      ++.++.| +  +..++.+|..|||||-
T Consensus        12 lD~~l~GG~p~g~~~lI~G~pGsGKT~   38 (260)
T COG0467          12 LDEILGGGLPRGSVVLITGPPGTGKTI   38 (260)
T ss_pred             hHHHhcCCCcCCcEEEEEcCCCCcHHH
Confidence            4445543 2  5678889999999974


No 227
>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).
Probab=70.25  E-value=1.5  Score=36.29  Aligned_cols=18  Identities=28%  Similarity=0.431  Sum_probs=15.0

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      |.-++..|.||||||++|
T Consensus       434 ~~n~~I~G~tGsGKS~~~  451 (785)
T TIGR00929       434 LGHTLIFGPTGSGKTTLL  451 (785)
T ss_pred             CceEEEECCCCCCHHHHH
Confidence            555677999999999876


No 228
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional
Probab=69.99  E-value=5.2  Score=33.99  Aligned_cols=27  Identities=15%  Similarity=0.180  Sum_probs=18.9

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ..+++.+.++-+  |+..|+||||||..+
T Consensus        11 ~~i~~~l~~~~~--vvv~A~TGSGKTt~~   37 (812)
T PRK11664         11 PELLTALKTAPQ--VLLKAPTGAGKSTWL   37 (812)
T ss_pred             HHHHHHHHhCCC--EEEEcCCCCCHHHHH
Confidence            456666655444  567999999999643


No 229
>CHL00181 cbbX CbbX; Provisional
Probab=69.89  E-value=2  Score=31.80  Aligned_cols=14  Identities=14%  Similarity=0.199  Sum_probs=12.0

Q ss_pred             EEeecCCCCCCceE
Q psy12526         80 IFAYGQTGEKTNYL   93 (103)
Q Consensus        80 i~aYGqtgSGKT~T   93 (103)
                      ++-+|.+|+|||+.
T Consensus        62 ill~G~pGtGKT~l   75 (287)
T CHL00181         62 MSFTGSPGTGKTTV   75 (287)
T ss_pred             EEEECCCCCCHHHH
Confidence            56699999999974


No 230
>TIGR02236 recomb_radA DNA repair and recombination protein RadA. This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
Probab=69.85  E-value=4.9  Score=29.65  Aligned_cols=27  Identities=22%  Similarity=0.322  Sum_probs=19.3

Q ss_pred             HHHHHhhCCC---cEEEEeecCCCCCCceE
Q psy12526         67 DILDNAFQGY---NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        67 ~lv~~~~~G~---n~ti~aYGqtgSGKT~T   93 (103)
                      +-++.++.|-   ...+.-||..|+|||.-
T Consensus        82 ~~lD~~l~GGi~~g~i~ei~G~~g~GKT~l  111 (310)
T TIGR02236        82 KELDELLGGGIETQAITEVFGEFGSGKTQI  111 (310)
T ss_pred             HHHHHHhcCCCCCCeEEEEECCCCCCHHHH
Confidence            4456666642   45667899999999863


No 231
>PF10412 TrwB_AAD_bind:  Type IV secretion-system coupling protein DNA-binding domain;  InterPro: IPR019476  The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein. It is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells []. This protein forms hexamers from six structurally very similar protomers []. This hexamer contains a central channel running from the cytosolic pole (formed by the all-alpha domains) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB all-alpha domain appears to be the DNA-binding domain of the structure. ; PDB: 1E9S_D 1E9R_F 1GKI_B 1GL7_G 1GL6_A.
Probab=69.77  E-value=1.2  Score=34.21  Aligned_cols=16  Identities=25%  Similarity=0.416  Sum_probs=12.0

Q ss_pred             EEeecCCCCCCceEec
Q psy12526         80 IFAYGQTGEKTNYLLN   95 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm~   95 (103)
                      ++..|.+|||||..|.
T Consensus        18 ~li~G~~GsGKT~~i~   33 (386)
T PF10412_consen   18 ILIIGATGSGKTQAIR   33 (386)
T ss_dssp             EEEEE-TTSSHHHHHH
T ss_pred             EEEECCCCCCHHHHHH
Confidence            5679999999997553


No 232
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional
Probab=69.72  E-value=5.2  Score=31.48  Aligned_cols=36  Identities=14%  Similarity=0.236  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHHHhhC----CCcEEEEeecCCCCCCceE
Q psy12526         58 EKVFDALGRDILDNAFQ----GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        58 ~~v~~~~~~~lv~~~~~----G~n~ti~aYGqtgSGKT~T   93 (103)
                      ....+.++..+...++.    -.---|+-||..|.|||+.
T Consensus       125 p~f~dk~~~hi~kn~l~~~~ik~PlgllL~GPPGcGKTll  164 (413)
T PLN00020        125 PAFMDKVAVHIAKNFLALPNIKVPLILGIWGGKGQGKSFQ  164 (413)
T ss_pred             HHHHHHHHHHHHhhhhhccCCCCCeEEEeeCCCCCCHHHH
Confidence            44555555566666553    2223466799999999874


No 233
>PF06745 KaiC:  KaiC;  InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical. More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria [].  The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....
Probab=69.30  E-value=2.2  Score=29.84  Aligned_cols=24  Identities=21%  Similarity=0.419  Sum_probs=18.0

Q ss_pred             HHHhhC-CC--cEEEEeecCCCCCCce
Q psy12526         69 LDNAFQ-GY--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        69 v~~~~~-G~--n~ti~aYGqtgSGKT~   92 (103)
                      ++.++. |+  +..++..|.+|||||.
T Consensus         8 LD~~l~GGip~gs~~li~G~~GsGKT~   34 (226)
T PF06745_consen    8 LDELLGGGIPKGSVVLISGPPGSGKTT   34 (226)
T ss_dssp             HHHHTTTSEETTSEEEEEESTTSSHHH
T ss_pred             HHHhhcCCCCCCcEEEEEeCCCCCcHH
Confidence            455563 33  6788899999999974


No 234
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional
Probab=69.28  E-value=1  Score=38.98  Aligned_cols=14  Identities=21%  Similarity=0.328  Sum_probs=11.5

Q ss_pred             ecCCCCCCceEecc
Q psy12526         83 YGQTGEKTNYLLNG   96 (103)
Q Consensus        83 YGqtgSGKT~Tm~G   96 (103)
                      -=+||+||||||.+
T Consensus        65 ~M~TGtGKT~~~~~   78 (986)
T PRK15483         65 KMETGTGKTYVYTR   78 (986)
T ss_pred             EeCCCCCHHHHHHH
Confidence            34899999998765


No 235
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX. Proteins in this family are now designated CbbX. Some previously were CfxQ (carbon fixation Q). Its gene is often found immmediately downstream of the Rubisco large and small chain genes, and it is suggested to be necessary for Rubisco expression. CbbX has been shown to be necessary for photoautotrophic growth. This protein belongs to the larger family of pfam00004, ATPase family Associated with various cellular Activities. Within that larger family, members of this family are most closely related to the stage V sporulation protein K, or SpoVK, in endospore-forming bacteria such as Bacillus subtilis.
Probab=69.27  E-value=2.1  Score=31.59  Aligned_cols=16  Identities=13%  Similarity=0.133  Sum_probs=13.2

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      -|+-+|.+|+|||+..
T Consensus        60 ~vll~G~pGTGKT~lA   75 (284)
T TIGR02880        60 HMSFTGNPGTGKTTVA   75 (284)
T ss_pred             eEEEEcCCCCCHHHHH
Confidence            4677999999999854


No 236
>KOG1547|consensus
Probab=69.27  E-value=8.5  Score=28.84  Aligned_cols=30  Identities=17%  Similarity=0.292  Sum_probs=21.8

Q ss_pred             HHHHHHHHHh-hCCCcEEEEeecCCCCCCce
Q psy12526         63 ALGRDILDNA-FQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        63 ~~~~~lv~~~-~~G~n~ti~aYGqtgSGKT~   92 (103)
                      .+...+=..+ -.||.--|+.-||+|.||+.
T Consensus        31 tI~~Qm~~k~mk~GF~FNIMVVgqSglgkst   61 (336)
T KOG1547|consen   31 TIIEQMRKKTMKTGFDFNIMVVGQSGLGKST   61 (336)
T ss_pred             HHHHHHHHHHHhccCceEEEEEecCCCCchh
Confidence            3333333333 46999999999999999975


No 237
>PF14532 Sigma54_activ_2:  Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H.
Probab=69.01  E-value=1.9  Score=27.91  Aligned_cols=19  Identities=16%  Similarity=0.301  Sum_probs=14.4

Q ss_pred             CCcEEEEeecCCCCCCceE
Q psy12526         75 GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+.-|+-+|+.||||++.
T Consensus        19 ~~~~pvli~GE~GtGK~~~   37 (138)
T PF14532_consen   19 KSSSPVLITGEPGTGKSLL   37 (138)
T ss_dssp             CSSS-EEEECCTTSSHHHH
T ss_pred             CCCCcEEEEcCCCCCHHHH
Confidence            4556677899999999874


No 238
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=68.98  E-value=1.1  Score=34.39  Aligned_cols=13  Identities=31%  Similarity=0.447  Sum_probs=11.3

Q ss_pred             ecCCCCCCceEec
Q psy12526         83 YGQTGEKTNYLLN   95 (103)
Q Consensus        83 YGqtgSGKT~Tm~   95 (103)
                      .|++|||||.+|.
T Consensus        37 LGPSGcGKTTlLR   49 (352)
T COG3842          37 LGPSGCGKTTLLR   49 (352)
T ss_pred             ECCCCCCHHHHHH
Confidence            6999999998764


No 239
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.
Probab=68.97  E-value=2.2  Score=33.78  Aligned_cols=16  Identities=19%  Similarity=0.337  Sum_probs=13.6

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      .++-||+.|+|||+.+
T Consensus        90 giLL~GppGtGKT~la  105 (495)
T TIGR01241        90 GVLLVGPPGTGKTLLA  105 (495)
T ss_pred             cEEEECCCCCCHHHHH
Confidence            4778999999999864


No 240
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=68.93  E-value=2  Score=36.29  Aligned_cols=18  Identities=17%  Similarity=0.132  Sum_probs=14.5

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..|.-.|.||+|||.|+.
T Consensus       186 ~Vi~lVGpnGvGKTTTia  203 (767)
T PRK14723        186 GVLALVGPTGVGKTTTTA  203 (767)
T ss_pred             eEEEEECCCCCcHHHHHH
Confidence            456667999999999863


No 241
>PHA02624 large T antigen; Provisional
Probab=68.87  E-value=5.3  Score=33.18  Aligned_cols=27  Identities=19%  Similarity=0.164  Sum_probs=20.3

Q ss_pred             HHHHHhhCCCcE--EEEeecCCCCCCceE
Q psy12526         67 DILDNAFQGYNA--CIFAYGQTGEKTNYL   93 (103)
Q Consensus        67 ~lv~~~~~G~n~--ti~aYGqtgSGKT~T   93 (103)
                      .+++.++.|..-  |++-||+-|||||+-
T Consensus       419 ~~lk~~l~giPKk~~il~~GPpnTGKTtf  447 (647)
T PHA02624        419 DILKLIVENVPKRRYWLFKGPVNSGKTTL  447 (647)
T ss_pred             HHHHHHHhcCCCCeEEEEECCCCCCHHHH
Confidence            345566666644  889999999999873


No 242
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=68.84  E-value=1.8  Score=33.98  Aligned_cols=18  Identities=17%  Similarity=0.075  Sum_probs=14.6

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..|.-.|.||+|||.|+-
T Consensus       192 ~vi~lvGpnG~GKTTtla  209 (420)
T PRK14721        192 GVYALIGPTGVGKTTTTA  209 (420)
T ss_pred             cEEEEECCCCCCHHHHHH
Confidence            456667999999999883


No 243
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=68.80  E-value=1.8  Score=33.92  Aligned_cols=17  Identities=35%  Similarity=0.253  Sum_probs=13.9

Q ss_pred             EEEeecCCCCCCceEec
Q psy12526         79 CIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm~   95 (103)
                      .|.-.|++|+|||+|+.
T Consensus       208 ii~lvGptGvGKTTt~a  224 (407)
T PRK12726        208 IISLIGQTGVGKTTTLV  224 (407)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            45677999999998864


No 244
>PRK09401 reverse gyrase; Reviewed
Probab=68.77  E-value=4.5  Score=35.73  Aligned_cols=23  Identities=17%  Similarity=0.124  Sum_probs=17.6

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      .+..+++|.|..+  ..+||||||.
T Consensus        88 ~i~~il~g~dv~i--~ApTGsGKT~  110 (1176)
T PRK09401         88 WAKRLLLGESFAI--IAPTGVGKTT  110 (1176)
T ss_pred             HHHHHHCCCcEEE--EcCCCCCHHH
Confidence            4456788987655  5699999995


No 245
>TIGR00376 DNA helicase, putative. The gene product may represent a DNA helicase. Eukaryotic members of this family have been characterized as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterized as helicases.
Probab=68.75  E-value=3.2  Score=34.17  Aligned_cols=16  Identities=19%  Similarity=0.235  Sum_probs=13.9

Q ss_pred             EEeecCCCCCCceEec
Q psy12526         80 IFAYGQTGEKTNYLLN   95 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm~   95 (103)
                      ++-.|..|+|||+|+.
T Consensus       176 ~lI~GpPGTGKT~t~~  191 (637)
T TIGR00376       176 FLIHGPPGTGKTRTLV  191 (637)
T ss_pred             EEEEcCCCCCHHHHHH
Confidence            4589999999999875


No 246
>TIGR00602 rad24 checkpoint protein rad24. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=68.75  E-value=2.7  Score=34.73  Aligned_cols=16  Identities=13%  Similarity=0.252  Sum_probs=13.5

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      .++-||++|+|||.++
T Consensus       112 illL~GP~GsGKTTl~  127 (637)
T TIGR00602       112 ILLITGPSGCGKSTTI  127 (637)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3677999999999865


No 247
>KOG0354|consensus
Probab=68.46  E-value=4.8  Score=33.98  Aligned_cols=24  Identities=25%  Similarity=0.465  Sum_probs=18.9

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      .++..+| |.|+-|  .-+||+|||+-
T Consensus        69 eivq~AL-gkNtii--~lPTG~GKTfI   92 (746)
T KOG0354|consen   69 ELVQPAL-GKNTII--ALPTGSGKTFI   92 (746)
T ss_pred             HHhHHhh-cCCeEE--EeecCCCccch
Confidence            5678888 999654  55999999973


No 248
>PF11406 Tachystatin_A:  Antimicrobial peptide tachystatin A;  InterPro: IPR022717  Tachystatin A contains a cysteine-stabilised triple-stranded beta-sheet and shows features common to membrane-interactive peptides. Tachystatin A is thought to have an antimicrobial activity similar to defensins.Tachystatin A is also a chitin-binding peptide []. ; PDB: 1CIX_A.
Probab=68.25  E-value=1.1  Score=23.56  Aligned_cols=16  Identities=31%  Similarity=0.679  Sum_probs=8.3

Q ss_pred             HhhCCCcEEEEeecCC
Q psy12526         71 NAFQGYNACIFAYGQT   86 (103)
Q Consensus        71 ~~~~G~n~ti~aYGqt   86 (103)
                      .-++||||.|.+||..
T Consensus         4 cqlqgfncvvrsyglp   19 (44)
T PF11406_consen    4 CQLQGFNCVVRSYGLP   19 (44)
T ss_dssp             ---TTEEE-S--TTS-
T ss_pred             ceecccceEEEccCCC
Confidence            3478999999999864


No 249
>PF02534 T4SS-DNA_transf:  Type IV secretory system Conjugative DNA transfer;  InterPro: IPR003688 This entry represents TraG proteins and their homologues. These proteins contain a P-loop and walker-B site for nucleotide binding. TraG is essential for DNA transfer in bacterial conjugation. These proteins are thought to mediate interactions between the DNA-processing (Dtr) and the mating pair formation (Mpf) systems [, ].; GO: 0009291 unidirectional conjugation, 0016020 membrane
Probab=67.88  E-value=5  Score=31.20  Aligned_cols=18  Identities=17%  Similarity=0.276  Sum_probs=15.1

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      .-++..|.||||||.++.
T Consensus        45 ~h~lvig~tgSGKt~~~v   62 (469)
T PF02534_consen   45 THVLVIGPTGSGKTTSFV   62 (469)
T ss_pred             eEEEEEeCCCCCccceee
Confidence            557889999999998764


No 250
>PRK09302 circadian clock protein KaiC; Reviewed
Probab=67.85  E-value=4.7  Score=31.97  Aligned_cols=26  Identities=15%  Similarity=0.276  Sum_probs=20.2

Q ss_pred             HHHHHhhC-CC--cEEEEeecCCCCCCce
Q psy12526         67 DILDNAFQ-GY--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        67 ~lv~~~~~-G~--n~ti~aYGqtgSGKT~   92 (103)
                      +-++.++. |+  ...++-+|.+|+|||.
T Consensus        18 ~~LD~~l~GG~p~Gs~~li~G~pGsGKT~   46 (509)
T PRK09302         18 EGFDDITHGGLPKGRPTLVSGTAGTGKTL   46 (509)
T ss_pred             hhHHHhhcCCCCCCcEEEEEeCCCCCHHH
Confidence            45677776 44  6788899999999975


No 251
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional
Probab=67.67  E-value=2.4  Score=32.90  Aligned_cols=18  Identities=22%  Similarity=0.433  Sum_probs=14.4

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      .-.|+-||..|+|||+..
T Consensus       179 pkgvLL~GppGTGKT~LA  196 (398)
T PTZ00454        179 PRGVLLYGPPGTGKTMLA  196 (398)
T ss_pred             CceEEEECCCCCCHHHHH
Confidence            346788999999999753


No 252
>PF01293 PEPCK_ATP:  Phosphoenolpyruvate carboxykinase The Prosite pattern is specific to the ATP binding region;  InterPro: IPR001272  Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate. The ATP-utilising (4.1.1.49 from EC) and GTP-utilising (4.1.1.32 from EC) enzymes form two divergent subfamilies, which have little sequence similarity but which retain conserved active site residues. ATP-utilising PEPCKs are monomers or oligomers of identical subunits found in certain bacteria, yeast, trypanosomatids, and plants, while GTP-utilising PEPCKs are mainly monomers found in animals and some bacteria []. Both require divalent cations for activity, such as magnesium or manganese. One cation interacts with the enzyme at metal binding site 1 to elicit activation, while the second cation interacts at metal binding site 2 to serve as a metal-nucleotide substrate. In bacteria, fungi and plants, PEPCK is involved in the glyoxylate bypass, an alternative to the tricarboxylic acid cycle.  PEPCK helps to regulate blood glucose levels. The rate of gluconeogenesis can be controlled through transcriptional regulation of the PEPCK gene by cAMP (the mediator of glucagon and catecholamines), glucocorticoids and insulin. In general, PEPCK expression is induced by glucagon, catecholamines and glucocorticoids during periods of fasting and in response to stress, but is inhibited by (glucose-induced) insulin upon feeding []. With type II diabetes, this regulation system can fail, resulting in increased gluconeogenesis that in turn raises glucose levels []. PEPCK consists of an N-terminal and a catalytic C-terminal domain, with the active site and metal ions located in a cleft between them. Both domains have an alpha/beta topology that is partly similar to one another [, ]. Substrate binding causes PEPCK to undergo a conformational change, which accelerates catalysis by forcing bulk solvent molecules out of the active site []. PCK uses an alpha/beta/alpha motif for nucleotide binding, this motif differing from other kinase domains. GTP-utilising PEPCK has a PEP-binding domain and two kinase motifs to bind GTP and magnesium. This entry represents ATP-utilising phosphoenolpyruvate carboxykinase enzymes.; GO: 0004612 phosphoenolpyruvate carboxykinase (ATP) activity, 0005524 ATP binding, 0006094 gluconeogenesis; PDB: 2PY7_X 2OLR_A 1AYL_A 1K3D_A 1OEN_A 1AQ2_A 1OS1_A 2OLQ_A 1K3C_A 2PXZ_X ....
Probab=67.50  E-value=2.6  Score=33.60  Aligned_cols=21  Identities=19%  Similarity=0.333  Sum_probs=16.7

Q ss_pred             EEEeecCCCCCCce-------EeccCCC
Q psy12526         79 CIFAYGQTGEKTNY-------LLNGNGP   99 (103)
Q Consensus        79 ti~aYGqtgSGKT~-------Tm~G~~~   99 (103)
                      +.+.+|.+|||||.       .|+|+++
T Consensus       212 ~alfFGLSGTGKTTLs~d~~r~ligDDe  239 (466)
T PF01293_consen  212 TALFFGLSGTGKTTLSADPERELIGDDE  239 (466)
T ss_dssp             EEEEEESTTSSHHHHHSBTTSEEEESSE
T ss_pred             eEEEEecCCCCccccccCCcceEEeCce
Confidence            46789999999995       6777664


No 253
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional
Probab=67.49  E-value=1.7  Score=34.26  Aligned_cols=16  Identities=25%  Similarity=0.501  Sum_probs=13.0

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      .|+-||.+|+|||...
T Consensus       219 gVLL~GPPGTGKT~LA  234 (438)
T PTZ00361        219 GVILYGPPGTGKTLLA  234 (438)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4667999999998754


No 254
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]
Probab=67.41  E-value=4.5  Score=32.97  Aligned_cols=19  Identities=11%  Similarity=0.345  Sum_probs=17.3

Q ss_pred             hhCCCcEEEEeecCCCCCC
Q psy12526         72 AFQGYNACIFAYGQTGEKT   90 (103)
Q Consensus        72 ~~~G~n~ti~aYGqtgSGK   90 (103)
                      -....+++|+-.|+||+||
T Consensus       263 r~A~tdstVLi~GESGTGK  281 (560)
T COG3829         263 RIAKTDSTVLILGESGTGK  281 (560)
T ss_pred             hhcCCCCcEEEecCCCccH
Confidence            3678899999999999999


No 255
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB. This model represents HrpB, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria, but also in a few species of other lineages. The member from Rhizobium meliloti has been designated HelO. HrpB is typically about 800 residues in length, while its paralog HrpA (TIGR01967), also uncharacterized, is about 1300 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing.
Probab=67.12  E-value=5.1  Score=34.08  Aligned_cols=26  Identities=8%  Similarity=0.032  Sum_probs=17.2

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+++.+.+  |..++..|+||||||..
T Consensus         8 ~~i~~~l~~--~~~vIi~a~TGSGKTT~   33 (819)
T TIGR01970         8 PALRDALAA--HPQVVLEAPPGAGKSTA   33 (819)
T ss_pred             HHHHHHHHc--CCcEEEECCCCCCHHHH
Confidence            344444433  33566899999999863


No 256
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3. cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.
Probab=67.08  E-value=3.1  Score=33.52  Aligned_cols=26  Identities=19%  Similarity=0.469  Sum_probs=18.0

Q ss_pred             HHhhCCCcEE------EEeecCCCCCCceEec
Q psy12526         70 DNAFQGYNAC------IFAYGQTGEKTNYLLN   95 (103)
Q Consensus        70 ~~~~~G~n~t------i~aYGqtgSGKT~Tm~   95 (103)
                      ..++++.+..      |+-.|.+|||||+.|-
T Consensus        19 ~~vL~~Vsl~i~~GEiv~L~G~SGsGKSTLLr   50 (504)
T TIGR03238        19 ERILVKFNKELPSSSLLFLCGSSGDGKSEILA   50 (504)
T ss_pred             HHHHhCCceeecCCCEEEEECCCCCCHHHHHh
Confidence            3455554433      4668999999998765


No 257
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=67.05  E-value=3.2  Score=30.04  Aligned_cols=14  Identities=14%  Similarity=0.304  Sum_probs=11.9

Q ss_pred             EEEeecCCCCCCce
Q psy12526         79 CIFAYGQTGEKTNY   92 (103)
Q Consensus        79 ti~aYGqtgSGKT~   92 (103)
                      .+...|.+|||||.
T Consensus        32 ~~~i~G~nGsGKST   45 (235)
T COG1122          32 RVLLIGPNGSGKST   45 (235)
T ss_pred             EEEEECCCCCCHHH
Confidence            45679999999986


No 258
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1. This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis.
Probab=66.83  E-value=7.3  Score=29.28  Aligned_cols=26  Identities=15%  Similarity=0.178  Sum_probs=19.7

Q ss_pred             HHHHHhhCC-C--cEEEEeecCCCCCCce
Q psy12526         67 DILDNAFQG-Y--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        67 ~lv~~~~~G-~--n~ti~aYGqtgSGKT~   92 (103)
                      +-++.+|.| +  ...+.-||+.|||||.
T Consensus        83 ~~LD~lLgGGi~~G~iteI~G~~GsGKTq  111 (313)
T TIGR02238        83 QALDGILGGGIESMSITEVFGEFRCGKTQ  111 (313)
T ss_pred             HHHHHHhCCCCcCCeEEEEECCCCCCcCH
Confidence            557777775 3  3556789999999986


No 259
>KOG0924|consensus
Probab=66.65  E-value=3.6  Score=34.91  Aligned_cols=20  Identities=25%  Similarity=0.315  Sum_probs=16.2

Q ss_pred             CCcEEEEeecCCCCCCceEe
Q psy12526         75 GYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      +-|-+|..-|+||||||.-+
T Consensus       369 r~n~vvvivgETGSGKTTQl  388 (1042)
T KOG0924|consen  369 RENQVVVIVGETGSGKTTQL  388 (1042)
T ss_pred             hhCcEEEEEecCCCCchhhh
Confidence            34677889999999999754


No 260
>TIGR00064 ftsY signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.
Probab=66.64  E-value=2.3  Score=31.25  Aligned_cols=17  Identities=18%  Similarity=0.231  Sum_probs=13.0

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      -+|.-.|.+|+|||.|.
T Consensus        73 ~vi~l~G~~G~GKTTt~   89 (272)
T TIGR00064        73 NVILFVGVNGVGKTTTI   89 (272)
T ss_pred             eEEEEECCCCCcHHHHH
Confidence            34545599999999875


No 261
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=66.61  E-value=8.1  Score=32.65  Aligned_cols=37  Identities=22%  Similarity=0.292  Sum_probs=23.4

Q ss_pred             CHHHHHHHHHHHHHHHhhCCC------cEEEEeecCCCCCCceE
Q psy12526         56 SQEKVFDALGRDILDNAFQGY------NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~------n~ti~aYGqtgSGKT~T   93 (103)
                      .|.+.-+.+.. .|.....|.      .+.++-+|++|+|||+.
T Consensus       462 GQ~~ai~~l~~-~i~~~~~gl~~~~kp~~~~Lf~GP~GvGKT~l  504 (758)
T PRK11034        462 GQDKAIEALTE-AIKMSRAGLGHEHKPVGSFLFAGPTGVGKTEV  504 (758)
T ss_pred             CcHHHHHHHHH-HHHHHhccccCCCCCcceEEEECCCCCCHHHH
Confidence            45555544443 334444444      35788999999999974


No 262
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=66.58  E-value=3.4  Score=28.82  Aligned_cols=16  Identities=19%  Similarity=0.368  Sum_probs=13.1

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      ++.-+|++|+|||..+
T Consensus        24 ~~~i~G~NGsGKTTLl   39 (204)
T cd03240          24 LTLIVGQNGAGKTTII   39 (204)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            5667999999999754


No 263
>TIGR02655 circ_KaiC circadian clock protein KaiC. Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (Pfam model pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor.
Probab=66.36  E-value=5.5  Score=31.56  Aligned_cols=26  Identities=15%  Similarity=0.321  Sum_probs=20.2

Q ss_pred             HHHHHhhC-CC--cEEEEeecCCCCCCce
Q psy12526         67 DILDNAFQ-GY--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        67 ~lv~~~~~-G~--n~ti~aYGqtgSGKT~   92 (103)
                      +-++.++. |+  +.+++-.|.+|+|||.
T Consensus         8 ~gLD~il~GGlp~g~~~Li~G~pGsGKT~   36 (484)
T TIGR02655         8 EGFDDISHGGLPIGRSTLVSGTSGTGKTL   36 (484)
T ss_pred             hhHHHhcCCCCCCCeEEEEEcCCCCCHHH
Confidence            44677776 43  6788999999999974


No 264
>KOG0987|consensus
Probab=66.13  E-value=7.2  Score=31.51  Aligned_cols=35  Identities=29%  Similarity=0.510  Sum_probs=24.7

Q ss_pred             CCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         54 FASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        54 ~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ...|+.||+ ..   +..+.+..-..+| ||.-|+||||-
T Consensus       119 ~~eqk~v~d-~~---~~~v~~~~g~~ff-~g~~gtgKt~l  153 (540)
T KOG0987|consen  119 TPEQKRVYD-AI---LEAVENNLGGVFF-YGFGGTGKTYL  153 (540)
T ss_pred             CHHHHHHHH-HH---HHHHhccccceee-eccCCccceee
Confidence            458888998 33   2344444555667 99999999984


No 265
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=65.41  E-value=8  Score=32.26  Aligned_cols=37  Identities=22%  Similarity=0.311  Sum_probs=22.9

Q ss_pred             CHHHHHHHHHHHHHHHhhCCC------cEEEEeecCCCCCCceE
Q psy12526         56 SQEKVFDALGRDILDNAFQGY------NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~------n~ti~aYGqtgSGKT~T   93 (103)
                      .|++.-+.+... +.....|.      .+.++-+|++|+|||+.
T Consensus       458 GQ~~ai~~l~~~-i~~~~~g~~~~~~p~~~~lf~Gp~GvGKT~l  500 (731)
T TIGR02639       458 GQDEAIDSLVSS-IKRSRAGLGNPNKPVGSFLFTGPTGVGKTEL  500 (731)
T ss_pred             CcHHHHHHHHHH-HHHHhcCCCCCCCCceeEEEECCCCccHHHH
Confidence            455555554433 33334444      34678899999999964


No 266
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=65.34  E-value=2.3  Score=29.63  Aligned_cols=16  Identities=25%  Similarity=0.428  Sum_probs=12.1

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      .+.-.|++|||||..|
T Consensus        30 ~~~i~G~NGsGKSTll   45 (213)
T cd03279          30 LFLICGPTGAGKSTIL   45 (213)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3445899999998744


No 267
>TIGR02012 tigrfam_recA protein RecA. This model describes orthologs of the recA protein. RecA promotes hybridization of homolgous regions of DNA. A segment of ssDNA can be hybridized to another ssDNA region, or to a dsDNA region. ATP is hydrolyzed in the process. Part of the SOS respones, it is regulated by LexA via autocatalytic cleavage.
Probab=65.33  E-value=6.7  Score=29.77  Aligned_cols=28  Identities=29%  Similarity=0.287  Sum_probs=20.9

Q ss_pred             HHHHHHhhC--CC--cEEEEeecCCCCCCceE
Q psy12526         66 RDILDNAFQ--GY--NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        66 ~~lv~~~~~--G~--n~ti~aYGqtgSGKT~T   93 (103)
                      -+-++.+|.  |+  ...+.-||+.|||||.-
T Consensus        40 i~~LD~~Lg~GGlp~G~iteI~G~~GsGKTtL   71 (321)
T TIGR02012        40 SLSLDLALGVGGLPRGRIIEIYGPESSGKTTL   71 (321)
T ss_pred             CHHHHHHhcCCCCcCCeEEEEECCCCCCHHHH
Confidence            356777775  66  34678999999999863


No 268
>PRK13721 conjugal transfer ATP-binding protein TraC; Provisional
Probab=65.01  E-value=2.1  Score=36.19  Aligned_cols=15  Identities=20%  Similarity=0.375  Sum_probs=12.8

Q ss_pred             EEeecCCCCCCceEe
Q psy12526         80 IFAYGQTGEKTNYLL   94 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm   94 (103)
                      .+..|.||||||++|
T Consensus       452 ~~I~G~sGsGKS~l~  466 (844)
T PRK13721        452 MAVCGTSGAGKTGLI  466 (844)
T ss_pred             EEEEcCCCCCHHHHH
Confidence            556899999999876


No 269
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional
Probab=64.99  E-value=3.1  Score=32.56  Aligned_cols=16  Identities=31%  Similarity=0.472  Sum_probs=13.6

Q ss_pred             EEEEeecCCCCCCceE
Q psy12526         78 ACIFAYGQTGEKTNYL   93 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~T   93 (103)
                      ..|+-+|++|+|||+.
T Consensus       109 ~~iLl~Gp~GtGKT~l  124 (412)
T PRK05342        109 SNILLIGPTGSGKTLL  124 (412)
T ss_pred             ceEEEEcCCCCCHHHH
Confidence            5688899999999863


No 270
>PRK04301 radA DNA repair and recombination protein RadA; Validated
Probab=64.97  E-value=7.2  Score=28.99  Aligned_cols=27  Identities=22%  Similarity=0.351  Sum_probs=19.0

Q ss_pred             HHHHHhhCC-C--cEEEEeecCCCCCCceE
Q psy12526         67 DILDNAFQG-Y--NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        67 ~lv~~~~~G-~--n~ti~aYGqtgSGKT~T   93 (103)
                      +-++.++.| +  ...+.-+|..|+|||..
T Consensus        89 ~~lD~~l~GGi~~g~vtei~G~~GsGKT~l  118 (317)
T PRK04301         89 KELDELLGGGIETQSITEFYGEFGSGKTQI  118 (317)
T ss_pred             HHHHHHhcCCccCCcEEEEECCCCCCHhHH
Confidence            445556654 2  55677899999999863


No 271
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family. This model represents a rather narrowly distributed archaeal protein family in which members have a single copy of the KaiC domain. This stands in contrast to the circadian clock protein KaiC itself, with two copies of the domain. Members are expected to have weak ATPase activity, by homology to the autokinase/autophosphorylase KaiC itself.
Probab=64.93  E-value=6.4  Score=27.43  Aligned_cols=24  Identities=25%  Similarity=0.490  Sum_probs=17.3

Q ss_pred             HHHhhC-CC--cEEEEeecCCCCCCce
Q psy12526         69 LDNAFQ-GY--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        69 v~~~~~-G~--n~ti~aYGqtgSGKT~   92 (103)
                      ++.++. |+  ...++-+|.+|+|||.
T Consensus         5 LD~~l~gGi~~g~~~li~G~~G~GKt~   31 (224)
T TIGR03880         5 LDEMLGGGFPEGHVIVVIGEYGTGKTT   31 (224)
T ss_pred             hHHHhcCCCCCCeEEEEECCCCCCHHH
Confidence            456664 43  5566779999999976


No 272
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. Members of this family show up near CRISPR repeats in Acidithiobacillus ferrooxidans ATCC 23270, Azoarcus sp. EbN1, and Rhodoferax ferrireducens DSM 15236. In the latter two species, the CRISPR/cas locus is found on a plasmid. This family is one of several characteristic of a type of CRISPR-associated (cas) gene cluster we designate Aferr after A. ferrooxidans, where it is both chromosomal and the only type of cas gene cluster found. The gene is designated csf4 (CRISPR/cas Subtype as in A. ferrooxidans protein 1), as it lies farthest (fourth closest) from the repeats in the A. ferrooxidans genome.
Probab=64.87  E-value=6.6  Score=32.56  Aligned_cols=32  Identities=13%  Similarity=-0.049  Sum_probs=21.3

Q ss_pred             CHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         56 SQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      .|.++++.+..-+    -++  ..+++-..||+|||+.
T Consensus         1 ~Q~~~~~~i~~al----~~~--~~lliEA~TGtGKTlA   32 (636)
T TIGR03117         1 EQALFYLNCLTSL----RQK--RIGMLEASTGVGKTLA   32 (636)
T ss_pred             CHHHHHHHHHHHH----hcC--CeEEEEcCCCCcHHHH
Confidence            3777776654332    333  4577899999999963


No 273
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Members of this protein family are homologs of ClpB, an ATPase associated with chaperone-related functions. These ClpB homologs, designated ClpV1, are a key component of the bacterial pathogenicity-associated type VI secretion system.
Probab=64.68  E-value=10  Score=32.36  Aligned_cols=37  Identities=16%  Similarity=0.324  Sum_probs=22.9

Q ss_pred             CHHHHHHHHHHHHHHHhhCCCc------EEEEeecCCCCCCceE
Q psy12526         56 SQEKVFDALGRDILDNAFQGYN------ACIFAYGQTGEKTNYL   93 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~n------~ti~aYGqtgSGKT~T   93 (103)
                      .|.+.-+.++.- +..+..|.+      ++++-.|++|+|||+.
T Consensus       570 GQ~~Av~~v~~~-i~~~~~gl~~~~~p~~~~lf~Gp~GvGKT~l  612 (852)
T TIGR03345       570 GQDHALEAIAER-IRTARAGLEDPRKPLGVFLLVGPSGVGKTET  612 (852)
T ss_pred             ChHHHHHHHHHH-HHHHhcCCCCCCCCceEEEEECCCCCCHHHH
Confidence            454444444433 333444543      5688889999999974


No 274
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=64.56  E-value=2.7  Score=30.52  Aligned_cols=38  Identities=18%  Similarity=0.209  Sum_probs=23.2

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         53 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +.++|....+... .+-+.  .-....|+..|.+|+||+.+
T Consensus        10 ~~~~~~~~~~~~~-~~~~~--~~~~~~IllvG~tGvGKSSl   47 (249)
T cd01853          10 PDAAQTKALELEA-KGKEE--LDFSLTILVLGKTGVGKSST   47 (249)
T ss_pred             cHHHHHHHHHHHH-Hhhhh--ccCCeEEEEECCCCCcHHHH
Confidence            3455655544433 32222  23456788899999999875


No 275
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional
Probab=64.34  E-value=6.4  Score=29.93  Aligned_cols=36  Identities=14%  Similarity=0.202  Sum_probs=21.7

Q ss_pred             CCHHHHHHHHHHHHHHHhhCC-CcEEEEeecCCCCCCceEe
Q psy12526         55 ASQEKVFDALGRDILDNAFQG-YNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~G-~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ..|+.+-..+    ...+..| ..-.++-||+.|+|||.++
T Consensus        19 iGq~~~~~~l----~~~~~~~~~~h~~L~~Gp~G~GKTtla   55 (363)
T PRK14961         19 IGQKHIVTAI----SNGLSLGRIHHAWLLSGTRGVGKTTIA   55 (363)
T ss_pred             cChHHHHHHH----HHHHHcCCCCeEEEEecCCCCCHHHHH
Confidence            3565544432    2333333 3446788999999999754


No 276
>KOG0780|consensus
Probab=64.32  E-value=7.4  Score=30.87  Aligned_cols=38  Identities=29%  Similarity=0.378  Sum_probs=26.9

Q ss_pred             HHHHHHHHHHHHHHH------hhCCCcEEEEeecCCCCCCceEec
Q psy12526         57 QEKVFDALGRDILDN------AFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        57 q~~v~~~~~~~lv~~------~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      |..||++++ .|++.      .-.|-...|+--|-.|||||.|+.
T Consensus        76 ~~~vf~eL~-kl~dp~~~~~~~~K~kpsVimfVGLqG~GKTTtc~  119 (483)
T KOG0780|consen   76 QKAVFDELV-KLLDPGKSALQPKKGKPSVIMFVGLQGSGKTTTCT  119 (483)
T ss_pred             HHHHHHHHH-HHhCCCCcccccccCCCcEEEEEeccCCCcceeHH
Confidence            677888776 34443      124566777888999999999863


No 277
>PRK10867 signal recognition particle protein; Provisional
Probab=64.08  E-value=12  Score=29.61  Aligned_cols=18  Identities=17%  Similarity=0.191  Sum_probs=14.5

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...|+..|.+|||||.|.
T Consensus       100 p~vI~~vG~~GsGKTTta  117 (433)
T PRK10867        100 PTVIMMVGLQGAGKTTTA  117 (433)
T ss_pred             CEEEEEECCCCCcHHHHH
Confidence            356777799999999875


No 278
>PF02463 SMC_N:  RecF/RecN/SMC N terminal domain;  InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []. The domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.; PDB: 3HTK_A 1W1W_C 2WD5_A 3L51_A 1XEW_Y 3KTA_B 3NWC_B 1XEX_A 1GXL_C 1GXK_A ....
Probab=63.99  E-value=3.6  Score=28.50  Aligned_cols=13  Identities=15%  Similarity=0.197  Sum_probs=10.7

Q ss_pred             EEeecCCCCCCce
Q psy12526         80 IFAYGQTGEKTNY   92 (103)
Q Consensus        80 i~aYGqtgSGKT~   92 (103)
                      ..-+|++|||||-
T Consensus        27 ~~i~G~NGsGKS~   39 (220)
T PF02463_consen   27 NVIVGPNGSGKSN   39 (220)
T ss_dssp             EEEEESTTSSHHH
T ss_pred             EEEEcCCCCCHHH
Confidence            3468999999985


No 279
>PF13166 AAA_13:  AAA domain
Probab=63.83  E-value=3.2  Score=33.99  Aligned_cols=12  Identities=25%  Similarity=0.623  Sum_probs=10.5

Q ss_pred             EeecCCCCCCce
Q psy12526         81 FAYGQTGEKTNY   92 (103)
Q Consensus        81 ~aYGqtgSGKT~   92 (103)
                      +-||.+|||||.
T Consensus        20 ~IYG~NGsGKSt   31 (712)
T PF13166_consen   20 LIYGRNGSGKST   31 (712)
T ss_pred             EEECCCCCCHHH
Confidence            579999999974


No 280
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=63.80  E-value=2.6  Score=29.70  Aligned_cols=13  Identities=15%  Similarity=0.434  Sum_probs=11.0

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|++|||||..|
T Consensus        28 i~GpNGsGKStll   40 (243)
T cd03272          28 VVGRNGSGKSNFF   40 (243)
T ss_pred             EECCCCCCHHHHH
Confidence            5799999999764


No 281
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=63.78  E-value=6.3  Score=33.20  Aligned_cols=32  Identities=19%  Similarity=0.266  Sum_probs=20.3

Q ss_pred             CCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         55 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      ..|...++.+.    .++ .|++ +.+-+|-||||||-
T Consensus       201 ~~Q~~a~~~i~----~~~-~~~~-~~Ll~GvTGSGKTE  232 (730)
T COG1198         201 QEQQAAVEAIL----SSL-GGFA-PFLLDGVTGSGKTE  232 (730)
T ss_pred             HHHHHHHHHHH----Hhc-cccc-ceeEeCCCCCcHHH
Confidence            45555555443    333 4555 55679999999984


No 282
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=63.59  E-value=7  Score=26.28  Aligned_cols=26  Identities=19%  Similarity=0.217  Sum_probs=20.1

Q ss_pred             HHHHhhC-CCcEEEEeecCCCCCCceE
Q psy12526         68 ILDNAFQ-GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        68 lv~~~~~-G~n~ti~aYGqtgSGKT~T   93 (103)
                      ++..+.. .-...|+-.|..|||||.-
T Consensus         4 ~~~~~~~~~~~~~ililGl~~sGKTtl   30 (175)
T PF00025_consen    4 VLSKLKSKKKEIKILILGLDGSGKTTL   30 (175)
T ss_dssp             HHHHCTTTTSEEEEEEEESTTSSHHHH
T ss_pred             HHHHhcccCcEEEEEEECCCccchHHH
Confidence            4555554 6678899999999999863


No 283
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional
Probab=63.46  E-value=3.8  Score=36.61  Aligned_cols=30  Identities=23%  Similarity=0.368  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         60 VFDALGRDILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        60 v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      ||..- ..++.. +++. -.++..|+||||||.
T Consensus        75 i~~~r-~~Il~a-i~~~-~VviI~GeTGSGKTT  104 (1294)
T PRK11131         75 VSQKK-QDILEA-IRDH-QVVIVAGETGSGKTT  104 (1294)
T ss_pred             HHHHH-HHHHHH-HHhC-CeEEEECCCCCCHHH
Confidence            44432 234433 4443 356788999999997


No 284
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=63.14  E-value=1.7  Score=33.23  Aligned_cols=12  Identities=33%  Similarity=0.487  Sum_probs=10.7

Q ss_pred             ecCCCCCCceEe
Q psy12526         83 YGQTGEKTNYLL   94 (103)
Q Consensus        83 YGqtgSGKT~Tm   94 (103)
                      .|++|+|||.+|
T Consensus        35 lGPSGcGKSTlL   46 (338)
T COG3839          35 LGPSGCGKSTLL   46 (338)
T ss_pred             ECCCCCCHHHHH
Confidence            699999999875


No 285
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=63.08  E-value=13  Score=28.71  Aligned_cols=36  Identities=17%  Similarity=0.289  Sum_probs=22.3

Q ss_pred             CHHHHHHHHHHHHHHHhhCC---CcEEEEeecCCCCCCce
Q psy12526         56 SQEKVFDALGRDILDNAFQG---YNACIFAYGQTGEKTNY   92 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G---~n~ti~aYGqtgSGKT~   92 (103)
                      .+++.-+.++.- +..+..|   -+--+.-.|+.|+|||.
T Consensus        55 G~~~~i~~lv~~-l~~~a~g~~~~r~il~L~GPPGsGKSt   93 (361)
T smart00763       55 GMEEAIERFVNY-FKSAAQGLEERKQILYLLGPVGGGKSS   93 (361)
T ss_pred             CcHHHHHHHHHH-HHHHHhcCCCCCcEEEEECCCCCCHHH
Confidence            345556666643 3343343   34556778999999985


No 286
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=62.95  E-value=4.7  Score=29.47  Aligned_cols=12  Identities=25%  Similarity=0.423  Sum_probs=10.0

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      -.|++|||||.-
T Consensus        33 iiGpSGSGKSTl   44 (240)
T COG1126          33 IIGPSGSGKSTL   44 (240)
T ss_pred             EECCCCCCHHHH
Confidence            479999999863


No 287
>PRK13873 conjugal transfer ATPase TrbE; Provisional
Probab=62.66  E-value=2.5  Score=35.59  Aligned_cols=15  Identities=33%  Similarity=0.505  Sum_probs=12.6

Q ss_pred             EEeecCCCCCCceEe
Q psy12526         80 IFAYGQTGEKTNYLL   94 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm   94 (103)
                      .+..|.||||||+.|
T Consensus       444 ~~I~G~tGsGKS~l~  458 (811)
T PRK13873        444 TLVVGPTGAGKSVLL  458 (811)
T ss_pred             EEEECCCCCCHHHHH
Confidence            456999999999876


No 288
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau. This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis.
Probab=62.59  E-value=8.4  Score=28.54  Aligned_cols=36  Identities=17%  Similarity=0.241  Sum_probs=22.4

Q ss_pred             CCHHHHHHHHHHHHHHHhhCCC-cEEEEeecCCCCCCceEe
Q psy12526         55 ASQEKVFDALGRDILDNAFQGY-NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~G~-n~ti~aYGqtgSGKT~Tm   94 (103)
                      ..|+.+.+.+.    ..+-.|. .-.++-||+.|+|||.+.
T Consensus        17 ig~~~~~~~l~----~~~~~~~~~~~~Ll~G~~G~GKt~~a   53 (355)
T TIGR02397        17 IGQEHIVQTLK----NAIKNGRIAHAYLFSGPRGTGKTSIA   53 (355)
T ss_pred             cCcHHHHHHHH----HHHHcCCCCeEEEEECCCCCCHHHHH
Confidence            35555554433    3333443 446788999999998654


No 289
>KOG2655|consensus
Probab=62.56  E-value=6.4  Score=30.55  Aligned_cols=21  Identities=14%  Similarity=0.389  Sum_probs=19.0

Q ss_pred             hhCCCcEEEEeecCCCCCCce
Q psy12526         72 AFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        72 ~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      +-.|+.-+++.-|++|+|||.
T Consensus        16 ~KkG~~ftlmvvG~sGlGKsT   36 (366)
T KOG2655|consen   16 VKKGFDFTLMVVGESGLGKST   36 (366)
T ss_pred             HhcCCceEEEEecCCCccHHH
Confidence            468999999999999999975


No 290
>PRK13880 conjugal transfer coupling protein TraG; Provisional
Probab=62.29  E-value=5.7  Score=32.78  Aligned_cols=18  Identities=17%  Similarity=0.185  Sum_probs=15.2

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      .-++.+|.||||||..+.
T Consensus       176 ~HvlviapTgSGKgvg~V  193 (636)
T PRK13880        176 EHVLTYAPTRSGKGVGLV  193 (636)
T ss_pred             ceEEEEecCCCCCceEEE
Confidence            447899999999999765


No 291
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage.  When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task.  This CD represents the nucleotide binding domain of RecF.  RecF  belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=62.28  E-value=3.1  Score=30.20  Aligned_cols=13  Identities=23%  Similarity=0.381  Sum_probs=10.6

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -+|++|||||.-|
T Consensus        26 i~G~NGsGKS~ll   38 (270)
T cd03242          26 LVGENAQGKTNLL   38 (270)
T ss_pred             EECCCCCCHHHHH
Confidence            5899999998643


No 292
>KOG0745|consensus
Probab=61.97  E-value=4.1  Score=32.79  Aligned_cols=18  Identities=22%  Similarity=0.438  Sum_probs=13.4

Q ss_pred             hCCCcEEEEeecCCCCCCce
Q psy12526         73 FQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~   92 (103)
                      |+--|  |+-.|+||||||.
T Consensus       224 LeKSN--vLllGPtGsGKTl  241 (564)
T KOG0745|consen  224 LEKSN--VLLLGPTGSGKTL  241 (564)
T ss_pred             eeccc--EEEECCCCCchhH
Confidence            34444  5679999999986


No 293
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional
Probab=61.62  E-value=8.3  Score=29.04  Aligned_cols=28  Identities=11%  Similarity=0.129  Sum_probs=18.6

Q ss_pred             HHHHHhhCCC-cEEEEeecCCCCCCceEe
Q psy12526         67 DILDNAFQGY-NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        67 ~lv~~~~~G~-n~ti~aYGqtgSGKT~Tm   94 (103)
                      .+...+-+|. .-.++-||+.|+|||+..
T Consensus        28 ~l~~~i~~~~~~~~~L~~G~~G~GKt~~a   56 (367)
T PRK14970         28 TLLNAIENNHLAQALLFCGPRGVGKTTCA   56 (367)
T ss_pred             HHHHHHHcCCCCeEEEEECCCCCCHHHHH
Confidence            3334444553 446778999999999754


No 294
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=61.43  E-value=4.3  Score=33.74  Aligned_cols=17  Identities=24%  Similarity=0.483  Sum_probs=13.9

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      -.|+-||..|+|||+.+
T Consensus       213 ~giLL~GppGtGKT~la  229 (733)
T TIGR01243       213 KGVLLYGPPGTGKTLLA  229 (733)
T ss_pred             ceEEEECCCCCChHHHH
Confidence            35788999999999753


No 295
>PRK08533 flagellar accessory protein FlaH; Reviewed
Probab=61.36  E-value=4.3  Score=28.90  Aligned_cols=17  Identities=18%  Similarity=0.264  Sum_probs=14.2

Q ss_pred             cEEEEeecCCCCCCceE
Q psy12526         77 NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~T   93 (103)
                      +..++-+|++|+|||..
T Consensus        24 g~~~~i~G~~G~GKTtl   40 (230)
T PRK08533         24 GSLILIEGDESTGKSIL   40 (230)
T ss_pred             CcEEEEECCCCCCHHHH
Confidence            34778899999999976


No 296
>cd00983 recA RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange.
Probab=61.35  E-value=9.2  Score=29.10  Aligned_cols=27  Identities=30%  Similarity=0.347  Sum_probs=20.6

Q ss_pred             HHHHHHhhC--CC--cEEEEeecCCCCCCce
Q psy12526         66 RDILDNAFQ--GY--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        66 ~~lv~~~~~--G~--n~ti~aYGqtgSGKT~   92 (103)
                      -+-++.+|.  |+  ...+.-||+.|||||.
T Consensus        40 i~~LD~~Lg~GGlp~G~iteI~Gp~GsGKTt   70 (325)
T cd00983          40 SLSLDIALGIGGYPKGRIIEIYGPESSGKTT   70 (325)
T ss_pred             CHHHHHHhcCCCccCCeEEEEECCCCCCHHH
Confidence            466777776  54  4467799999999985


No 297
>KOG1803|consensus
Probab=61.16  E-value=3.6  Score=33.99  Aligned_cols=15  Identities=20%  Similarity=0.206  Sum_probs=12.7

Q ss_pred             EeecCCCCCCceEec
Q psy12526         81 FAYGQTGEKTNYLLN   95 (103)
Q Consensus        81 ~aYGqtgSGKT~Tm~   95 (103)
                      .--|+.|+|||||+.
T Consensus       205 ~I~GPPGTGKT~Tlv  219 (649)
T KOG1803|consen  205 IIHGPPGTGKTRTLV  219 (649)
T ss_pred             EeeCCCCCCceeeHH
Confidence            457999999999973


No 298
>TIGR01425 SRP54_euk signal recognition particle protein SRP54. This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model.
Probab=61.15  E-value=6.9  Score=30.92  Aligned_cols=18  Identities=17%  Similarity=0.172  Sum_probs=14.7

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...|+-.|.+|+|||.|.
T Consensus       100 ~~vi~lvG~~GvGKTTta  117 (429)
T TIGR01425       100 QNVIMFVGLQGSGKTTTC  117 (429)
T ss_pred             CeEEEEECCCCCCHHHHH
Confidence            356777899999999875


No 299
>smart00489 DEXDc3 DEAD-like helicases superfamily.
Probab=61.13  E-value=7.4  Score=28.75  Aligned_cols=37  Identities=16%  Similarity=0.051  Sum_probs=23.7

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         53 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +...|.++-+.+    .+.+.+|-+  ++.=.+||+|||.+.+
T Consensus         9 ~r~~Q~~~m~~v----~~~~~~~~~--~~~eapTGtGKTl~~L   45 (289)
T smart00489        9 PYPIQYEFMEEL----KRVLDRGKI--GILESPTGTGKTLSLL   45 (289)
T ss_pred             CCHHHHHHHHHH----HHHHHcCCc--EEEECCCCcchhHHHH
Confidence            345776555444    345556655  4456799999997654


No 300
>smart00488 DEXDc2 DEAD-like helicases superfamily.
Probab=61.13  E-value=7.4  Score=28.75  Aligned_cols=37  Identities=16%  Similarity=0.051  Sum_probs=23.7

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         53 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +...|.++-+.+    .+.+.+|-+  ++.=.+||+|||.+.+
T Consensus         9 ~r~~Q~~~m~~v----~~~~~~~~~--~~~eapTGtGKTl~~L   45 (289)
T smart00488        9 PYPIQYEFMEEL----KRVLDRGKI--GILESPTGTGKTLSLL   45 (289)
T ss_pred             CCHHHHHHHHHH----HHHHHcCCc--EEEECCCCcchhHHHH
Confidence            345776555444    345556655  4456799999997654


No 301
>TIGR01054 rgy reverse gyrase. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA.
Probab=60.83  E-value=7.7  Score=34.35  Aligned_cols=25  Identities=12%  Similarity=0.094  Sum_probs=18.9

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+..++.|.+..  +-++||||||..
T Consensus        85 ~~i~~il~G~d~v--i~ApTGsGKT~f  109 (1171)
T TIGR01054        85 MWAKRVLRGDSFA--IIAPTGVGKTTF  109 (1171)
T ss_pred             HHHHHHhCCCeEE--EECCCCCCHHHH
Confidence            3456678998755  567999999963


No 302
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=60.73  E-value=4.4  Score=29.32  Aligned_cols=13  Identities=23%  Similarity=0.322  Sum_probs=10.6

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .-.|++|||||.-
T Consensus        35 aI~GpSGSGKSTL   47 (226)
T COG1136          35 AIVGPSGSGKSTL   47 (226)
T ss_pred             EEECCCCCCHHHH
Confidence            4479999999863


No 303
>PRK13891 conjugal transfer protein TrbE; Provisional
Probab=60.61  E-value=2.9  Score=35.50  Aligned_cols=16  Identities=31%  Similarity=0.524  Sum_probs=13.5

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      -.+..|.||||||+.|
T Consensus       490 h~~I~G~tGsGKS~l~  505 (852)
T PRK13891        490 HTFMFGPTGAGKSTHL  505 (852)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            3578999999999876


No 304
>PRK09354 recA recombinase A; Provisional
Probab=60.58  E-value=9.5  Score=29.33  Aligned_cols=27  Identities=22%  Similarity=0.252  Sum_probs=20.6

Q ss_pred             HHHHHHhhC--CC--cEEEEeecCCCCCCce
Q psy12526         66 RDILDNAFQ--GY--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        66 ~~lv~~~~~--G~--n~ti~aYGqtgSGKT~   92 (103)
                      -+-++.+|.  |+  ...+.-||+.|||||.
T Consensus        45 i~~LD~~LG~GGip~G~IteI~G~~GsGKTt   75 (349)
T PRK09354         45 SLALDIALGIGGLPRGRIVEIYGPESSGKTT   75 (349)
T ss_pred             cHHHHHHhcCCCCcCCeEEEEECCCCCCHHH
Confidence            466777777  44  4467789999999986


No 305
>PRK11784 tRNA 2-selenouridine synthase; Provisional
Probab=60.57  E-value=5.2  Score=30.58  Aligned_cols=32  Identities=25%  Similarity=0.292  Sum_probs=18.9

Q ss_pred             HHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         63 ALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        63 ~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..+.+.++.+....+- +.-.|.||||||..|.
T Consensus       128 ~~~~~~~~~~~~~~~~-ivl~G~TGsGKT~iL~  159 (345)
T PRK11784        128 RFVIDTLEEAPAQFPL-VVLGGNTGSGKTELLQ  159 (345)
T ss_pred             HhhHHHHhhhcccCce-EecCCCCcccHHHHHH
Confidence            3333444443334443 3367899999998664


No 306
>TIGR00580 mfd transcription-repair coupling factor (mfd). All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transacribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). This family is closely related to the RecG and UvrB families.
Probab=60.51  E-value=9.2  Score=33.06  Aligned_cols=21  Identities=10%  Similarity=-0.017  Sum_probs=14.9

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .+...-++..|+||||||-..
T Consensus       469 ~~~~~d~Ll~adTGsGKT~va  489 (926)
T TIGR00580       469 SPRPMDRLVCGDVGFGKTEVA  489 (926)
T ss_pred             ccCcCCEEEECCCCccHHHHH
Confidence            333344678999999999643


No 307
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional
Probab=60.49  E-value=9.6  Score=29.16  Aligned_cols=27  Identities=19%  Similarity=0.261  Sum_probs=20.0

Q ss_pred             HHHHHHhhCC-C--cEEEEeecCCCCCCce
Q psy12526         66 RDILDNAFQG-Y--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        66 ~~lv~~~~~G-~--n~ti~aYGqtgSGKT~   92 (103)
                      -+-++.+|.| +  .....-||..|||||.
T Consensus       112 ~~~LD~lLgGGi~~G~ItEI~G~~GsGKTq  141 (344)
T PLN03187        112 SQALDELLGGGIETRCITEAFGEFRSGKTQ  141 (344)
T ss_pred             cHhHHhhcCCCCCCCeEEEEecCCCCChhH
Confidence            3557777774 2  4456789999999986


No 308
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional
Probab=60.42  E-value=7  Score=32.24  Aligned_cols=19  Identities=16%  Similarity=0.426  Sum_probs=15.3

Q ss_pred             CCcEEEEeecCCCCCCceE
Q psy12526         75 GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+..|+-.|++|+||++.
T Consensus       397 ~~~~pVLI~GE~GTGK~~l  415 (686)
T PRK15429        397 QSDSTVLILGETGTGKELI  415 (686)
T ss_pred             CCCCCEEEECCCCcCHHHH
Confidence            4466788899999999863


No 309
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase. A conserved gene neighborhood widely spread in the Actinobacteria contains this uncharacterized DEAH-box family helicase encoded convergently towards an operon of genes for protein homologous to type II secretion and pilus formation proteins. The context suggests that this helicase may play a role in conjugal transfer of DNA.
Probab=60.40  E-value=8  Score=32.45  Aligned_cols=24  Identities=13%  Similarity=0.094  Sum_probs=18.1

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      .+..+++|.|..+  --+||||||..
T Consensus        44 ai~~il~G~nvvv--~apTGSGKTla   67 (742)
T TIGR03817        44 AAELAHAGRHVVV--ATGTASGKSLA   67 (742)
T ss_pred             HHHHHHCCCCEEE--ECCCCCcHHHH
Confidence            3456789999654  56899999863


No 310
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=60.10  E-value=4.2  Score=31.89  Aligned_cols=16  Identities=31%  Similarity=0.472  Sum_probs=13.8

Q ss_pred             EEEEeecCCCCCCceE
Q psy12526         78 ACIFAYGQTGEKTNYL   93 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~T   93 (103)
                      ..|+-+|+||+|||..
T Consensus       117 ~~iLL~GP~GsGKT~l  132 (413)
T TIGR00382       117 SNILLIGPTGSGKTLL  132 (413)
T ss_pred             ceEEEECCCCcCHHHH
Confidence            4688999999999874


No 311
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=59.77  E-value=5.4  Score=30.64  Aligned_cols=20  Identities=15%  Similarity=0.096  Sum_probs=16.7

Q ss_pred             CCcEEEEeecCCCCCCceEe
Q psy12526         75 GYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      +.-..|+--|-+|+|||.|+
T Consensus       137 ~~p~Vil~vGVNG~GKTTTI  156 (340)
T COG0552         137 KKPFVILFVGVNGVGKTTTI  156 (340)
T ss_pred             CCcEEEEEEecCCCchHhHH
Confidence            34567888899999999986


No 312
>TIGR03689 pup_AAA proteasome ATPase. In the Actinobacteria, as shown for Mycobacterium tuberculosis, some proteins are modified by ligation between an epsilon-amino group of a lysine side chain and the C-terminal carboxylate of the ubiquitin-like protein Pup. This modification leads to protein degradation by the archaeal-like proteasome found in the Actinobacteria. Members of this protein family belong to the AAA family of ATPases and tend to be clustered with the genes for Pup, the Pup ligase PafA, and structural components of the proteasome. This protein forms hexameric rings with ATPase activity.
Probab=59.73  E-value=4.1  Score=32.87  Aligned_cols=15  Identities=20%  Similarity=0.492  Sum_probs=12.6

Q ss_pred             EEEeecCCCCCCceE
Q psy12526         79 CIFAYGQTGEKTNYL   93 (103)
Q Consensus        79 ti~aYGqtgSGKT~T   93 (103)
                      .|+-||+.|+|||..
T Consensus       218 GILLyGPPGTGKT~L  232 (512)
T TIGR03689       218 GVLLYGPPGCGKTLI  232 (512)
T ss_pred             ceEEECCCCCcHHHH
Confidence            367799999999964


No 313
>KOG0922|consensus
Probab=59.63  E-value=6.1  Score=32.90  Aligned_cols=18  Identities=22%  Similarity=0.438  Sum_probs=13.5

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      |-.+..-|.||||||.-+
T Consensus        66 nqvlIviGeTGsGKSTQi   83 (674)
T KOG0922|consen   66 NQVLIVIGETGSGKSTQI   83 (674)
T ss_pred             CCEEEEEcCCCCCccccH
Confidence            445557899999998643


No 314
>TIGR00150 HI0065_YjeE ATPase, YjeE family. Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.
Probab=59.58  E-value=11  Score=24.91  Aligned_cols=29  Identities=17%  Similarity=0.315  Sum_probs=18.0

Q ss_pred             HHHHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         64 LGRDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        64 ~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      +++.+...+..|  ..|+-.|..|+|||.-+
T Consensus        11 l~~~l~~~l~~~--~~i~l~G~lGaGKTtl~   39 (133)
T TIGR00150        11 FGKAFAKPLDFG--TVVLLKGDLGAGKTTLV   39 (133)
T ss_pred             HHHHHHHhCCCC--CEEEEEcCCCCCHHHHH
Confidence            344444333333  35677999999998744


No 315
>CHL00195 ycf46 Ycf46; Provisional
Probab=59.47  E-value=3.4  Score=33.07  Aligned_cols=16  Identities=13%  Similarity=0.204  Sum_probs=13.7

Q ss_pred             EEEEeecCCCCCCceE
Q psy12526         78 ACIFAYGQTGEKTNYL   93 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~T   93 (103)
                      -.|+-||..|+|||.+
T Consensus       260 kGILL~GPpGTGKTll  275 (489)
T CHL00195        260 RGLLLVGIQGTGKSLT  275 (489)
T ss_pred             ceEEEECCCCCcHHHH
Confidence            4588999999999864


No 316
>KOG0729|consensus
Probab=59.36  E-value=5.5  Score=30.37  Aligned_cols=37  Identities=16%  Similarity=0.259  Sum_probs=21.5

Q ss_pred             CHHHHHHHHH-HHHHHH---hhCCCc--EEEEeecCCCCCCce
Q psy12526         56 SQEKVFDALG-RDILDN---AFQGYN--ACIFAYGQTGEKTNY   92 (103)
Q Consensus        56 ~q~~v~~~~~-~~lv~~---~~~G~n--~ti~aYGqtgSGKT~   92 (103)
                      .|-+-..+++ .||+..   +--|..  --|+.||+.|+|||-
T Consensus       184 eqieklrevve~pll~perfv~lgidppkgvllygppgtgktl  226 (435)
T KOG0729|consen  184 EQIEKLREVVELPLLHPERFVNLGIDPPKGVLLYGPPGTGKTL  226 (435)
T ss_pred             HHHHHHHHHHhccccCHHHHhhcCCCCCCceEEeCCCCCchhH
Confidence            4544333333 455543   222442  247899999999985


No 317
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]
Probab=58.78  E-value=3.3  Score=30.10  Aligned_cols=21  Identities=29%  Similarity=0.378  Sum_probs=14.3

Q ss_pred             hhCCCcEEEEeecCCCCCCceEe
Q psy12526         72 AFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        72 ~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      +-+|-=+-|  .|++|+|||.++
T Consensus        25 ae~Gei~Gl--LG~NGAGKTT~L   45 (245)
T COG4555          25 AEEGEITGL--LGENGAGKTTLL   45 (245)
T ss_pred             eccceEEEE--EcCCCCCchhHH
Confidence            344544433  699999999864


No 318
>KOG0923|consensus
Probab=58.55  E-value=6.9  Score=33.08  Aligned_cols=18  Identities=17%  Similarity=0.359  Sum_probs=14.6

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      +..++--|.||||||.-+
T Consensus       280 ~QVLiI~GeTGSGKTTQi  297 (902)
T KOG0923|consen  280 HQVLIIVGETGSGKTTQI  297 (902)
T ss_pred             CcEEEEEcCCCCCccccc
Confidence            456788999999999744


No 319
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA. This model represents HrpA, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterized, is about 800 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing.
Probab=58.51  E-value=11  Score=33.71  Aligned_cols=24  Identities=25%  Similarity=0.415  Sum_probs=16.6

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      .+++. ++. |-.++-.|.||||||.
T Consensus        74 ~Il~~-l~~-~~vvii~g~TGSGKTT   97 (1283)
T TIGR01967        74 DIAEA-IAE-NQVVIIAGETGSGKTT   97 (1283)
T ss_pred             HHHHH-HHh-CceEEEeCCCCCCcHH
Confidence            44443 344 4466789999999996


No 320
>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD. The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM).
Probab=58.21  E-value=3.3  Score=33.68  Aligned_cols=15  Identities=27%  Similarity=0.430  Sum_probs=12.4

Q ss_pred             EEeecCCCCCCceEe
Q psy12526         80 IFAYGQTGEKTNYLL   94 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm   94 (103)
                      ++.+|.||||||..|
T Consensus       179 ~li~G~tGsGKs~~i  193 (566)
T TIGR02759       179 ILIHGTTGSGKSVAI  193 (566)
T ss_pred             eEEEcCCCCCHHHHH
Confidence            578999999999644


No 321
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional
Probab=58.15  E-value=3.7  Score=33.52  Aligned_cols=16  Identities=25%  Similarity=0.293  Sum_probs=12.6

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      .|.-.|.+|+|||+|+
T Consensus       352 vIaLVGPtGvGKTTta  367 (559)
T PRK12727        352 VIALVGPTGAGKTTTI  367 (559)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            4444599999999986


No 322
>KOG1532|consensus
Probab=57.97  E-value=4.3  Score=30.87  Aligned_cols=18  Identities=17%  Similarity=0.344  Sum_probs=15.7

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      -+||+.-|..|||||.-|
T Consensus        19 p~~ilVvGMAGSGKTTF~   36 (366)
T KOG1532|consen   19 PVIILVVGMAGSGKTTFM   36 (366)
T ss_pred             CcEEEEEecCCCCchhHH
Confidence            579999999999999754


No 323
>PF14553 YqbF:  YqbF, hypothetical protein domain; PDB: 2HJQ_A.
Probab=57.75  E-value=5.3  Score=21.55  Aligned_cols=9  Identities=22%  Similarity=0.434  Sum_probs=6.9

Q ss_pred             CCceEeccC
Q psy12526         89 KTNYLLNGN   97 (103)
Q Consensus        89 GKT~Tm~G~   97 (103)
                      ||||+.+|-
T Consensus         3 GktY~~~g~   11 (43)
T PF14553_consen    3 GKTYYAMGH   11 (43)
T ss_dssp             -SEEEETTE
T ss_pred             CcEEEEeee
Confidence            899999984


No 324
>TIGR03783 Bac_Flav_CT_G Bacteroides conjugation system ATPase, TraG family. Members of this family include the predicted ATPase, TraG, encoded by transfer region genes of conjugative transposons of Bacteroides, such as CTnDOT, found on the main chromosome. Members also include TraG homologs borne on plasmids in Bacteroides. The protein family is related to the conjugative transfer system ATPase VirB4.
Probab=57.57  E-value=3.1  Score=35.36  Aligned_cols=18  Identities=22%  Similarity=0.480  Sum_probs=14.5

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      |.-.+..|.+|||||..|
T Consensus       438 n~N~~I~G~sGsGKS~l~  455 (829)
T TIGR03783       438 NRNKFILGPSGSGKSFFT  455 (829)
T ss_pred             cCceEEECCCCCCHHHHH
Confidence            445667999999999866


No 325
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=57.56  E-value=5.9  Score=22.68  Aligned_cols=13  Identities=15%  Similarity=0.225  Sum_probs=10.0

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .--|..|||||..
T Consensus         3 ~i~G~~gsGKst~   15 (69)
T cd02019           3 AITGGSGSGKSTV   15 (69)
T ss_pred             EEECCCCCCHHHH
Confidence            3469999999853


No 326
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=57.33  E-value=5.7  Score=25.13  Aligned_cols=13  Identities=15%  Similarity=0.273  Sum_probs=10.7

Q ss_pred             EEeecCCCCCCce
Q psy12526         80 IFAYGQTGEKTNY   92 (103)
Q Consensus        80 i~aYGqtgSGKT~   92 (103)
                      +.-.|.+|||||.
T Consensus        14 ~~i~G~nGsGKSt   26 (137)
T PF00005_consen   14 VAIVGPNGSGKST   26 (137)
T ss_dssp             EEEEESTTSSHHH
T ss_pred             EEEEccCCCcccc
Confidence            4458999999986


No 327
>PRK10689 transcription-repair coupling factor; Provisional
Probab=57.05  E-value=10  Score=33.59  Aligned_cols=37  Identities=16%  Similarity=0.160  Sum_probs=23.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         53 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +...|.+.+..+...+    -.....-++..|+||||||-.
T Consensus       601 ~T~~Q~~aI~~il~d~----~~~~~~d~Ll~a~TGsGKT~v  637 (1147)
T PRK10689        601 TTPDQAQAINAVLSDM----CQPLAMDRLVCGDVGFGKTEV  637 (1147)
T ss_pred             CCHHHHHHHHHHHHHh----hcCCCCCEEEEcCCCcCHHHH
Confidence            4556666665544332    233334478899999999953


No 328
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB. Members of this protein family are the bacterial ATP-dependent chaperone ClpB. This protein belongs to the AAA family, ATPases associated with various cellular activities (pfam00004). This molecular chaperone does not act as a protease, but rather serves to disaggregate misfolded and aggregated proteins.
Probab=56.99  E-value=13  Score=31.76  Aligned_cols=37  Identities=19%  Similarity=0.302  Sum_probs=23.2

Q ss_pred             CHHHHHHHHHHHHHHHhhCCC------cEEEEeecCCCCCCceE
Q psy12526         56 SQEKVFDALGRDILDNAFQGY------NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~------n~ti~aYGqtgSGKT~T   93 (103)
                      .|...-+.+.. .+..+..|.      .+.++-+|++|+|||++
T Consensus       569 GQ~~av~~v~~-~i~~~~~gl~~~~~p~~~~Lf~Gp~GvGKt~l  611 (852)
T TIGR03346       569 GQDEAVEAVSD-AIRRSRAGLSDPNRPIGSFLFLGPTGVGKTEL  611 (852)
T ss_pred             CChHHHHHHHH-HHHHHhccCCCCCCCCeEEEEEcCCCCCHHHH
Confidence            45555555443 333444443      35677889999999974


No 329
>PRK13853 type IV secretion system protein VirB4; Provisional
Probab=56.85  E-value=3.2  Score=34.90  Aligned_cols=16  Identities=19%  Similarity=0.370  Sum_probs=13.4

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      -.+.+|.||||||..|
T Consensus       428 ~~~I~G~tGsGKS~l~  443 (789)
T PRK13853        428 MTAIFGPIGRGKTTLM  443 (789)
T ss_pred             EEEEECCCCCCHHHHH
Confidence            3567999999999875


No 330
>PRK13830 conjugal transfer protein TrbE; Provisional
Probab=56.75  E-value=3.8  Score=34.66  Aligned_cols=18  Identities=28%  Similarity=0.453  Sum_probs=14.8

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      ++-.+..|.||||||..|
T Consensus       456 ~g~~~i~G~tGsGKS~l~  473 (818)
T PRK13830        456 VGHTLIFGPTGSGKSTLL  473 (818)
T ss_pred             CCEEEEECCCCCCHHHHH
Confidence            445688999999999876


No 331
>PTZ00035 Rad51 protein; Provisional
Probab=56.58  E-value=13  Score=28.15  Aligned_cols=28  Identities=18%  Similarity=0.236  Sum_probs=20.8

Q ss_pred             HHHHHHhhCC-C--cEEEEeecCCCCCCceE
Q psy12526         66 RDILDNAFQG-Y--NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        66 ~~lv~~~~~G-~--n~ti~aYGqtgSGKT~T   93 (103)
                      -+-++.+|.| +  ...+.-+|..|+|||.-
T Consensus       104 ~~~LD~lLgGGi~~G~iteI~G~~GsGKT~l  134 (337)
T PTZ00035        104 STQLDKLLGGGIETGSITELFGEFRTGKTQL  134 (337)
T ss_pred             cHHHHHHhCCCCCCCeEEEEECCCCCchhHH
Confidence            4567788874 3  45567899999999863


No 332
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]
Probab=56.37  E-value=2.6  Score=36.38  Aligned_cols=14  Identities=7%  Similarity=0.159  Sum_probs=12.1

Q ss_pred             eecCCCCCCceEec
Q psy12526         82 AYGQTGEKTNYLLN   95 (103)
Q Consensus        82 aYGqtgSGKT~Tm~   95 (103)
                      -+--+|||||.||+
T Consensus       278 IWHtqGSGKTlTm~  291 (962)
T COG0610         278 IWHTQGSGKTLTMF  291 (962)
T ss_pred             EEeecCCchHHHHH
Confidence            37789999999996


No 333
>TIGR00554 panK_bact pantothenate kinase, bacterial type. Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.
Probab=56.31  E-value=11  Score=28.24  Aligned_cols=17  Identities=12%  Similarity=-0.080  Sum_probs=13.2

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      ..|---|.+|||||.++
T Consensus        63 ~IIGIaG~~GSGKSTla   79 (290)
T TIGR00554        63 YIISIAGSVAVGKSTTA   79 (290)
T ss_pred             EEEEEECCCCCCHHHHH
Confidence            34445699999999876


No 334
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype. This model describes a CRISPR-associated putative DEAH-box helicase, or Cas3, of a subtype found in Actinomyces naeslundii MG1, Geobacter sulfurreducens PCA, Gemmata obscuriglobus UQM 2246, and Desulfotalea psychrophila. This protein includes both DEAH and HD motifs.
Probab=56.15  E-value=7.7  Score=33.25  Aligned_cols=25  Identities=12%  Similarity=0.069  Sum_probs=17.4

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ++..+++|.+- ++.--+||||||..
T Consensus        23 ~i~~il~G~~~-v~~~apTGSGKTaa   47 (844)
T TIGR02621        23 LAERFVAGQPP-ESCSTPTGLGKTSI   47 (844)
T ss_pred             HHHHHHcCCCc-ceEecCCCCcccHH
Confidence            34456788753 44456999999974


No 335
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]
Probab=55.83  E-value=5.7  Score=31.04  Aligned_cols=34  Identities=15%  Similarity=0.424  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHHHH-hhC--CCc--EEEEeecCCCCCCc
Q psy12526         58 EKVFDALGRDILDN-AFQ--GYN--ACIFAYGQTGEKTN   91 (103)
Q Consensus        58 ~~v~~~~~~~lv~~-~~~--G~n--~ti~aYGqtgSGKT   91 (103)
                      +++-+.+..||.+. +|+  |..  --|+-||+-|+|||
T Consensus       161 ~EirE~VELPL~~PElF~~~GI~PPKGVLLYGPPGTGKT  199 (406)
T COG1222         161 QEIREVVELPLKNPELFEELGIDPPKGVLLYGPPGTGKT  199 (406)
T ss_pred             HHHHHHhcccccCHHHHHHcCCCCCCceEeeCCCCCcHH
Confidence            44555555666544 222  332  24778999999997


No 336
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA.
Probab=55.79  E-value=10  Score=31.62  Aligned_cols=39  Identities=8%  Similarity=0.126  Sum_probs=22.8

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         53 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +...|+.....    ++.-+.......++-||..|+|||....
T Consensus       183 ~~igr~~ei~~----~~~~L~~~~~~n~lL~G~pG~GKT~l~~  221 (731)
T TIGR02639       183 PLIGREDELER----TIQVLCRRKKNNPLLVGEPGVGKTAIAE  221 (731)
T ss_pred             cccCcHHHHHH----HHHHHhcCCCCceEEECCCCCCHHHHHH
Confidence            44456555544    3333333333345679999999998654


No 337
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily. This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus.
Probab=55.63  E-value=5.8  Score=32.98  Aligned_cols=15  Identities=20%  Similarity=0.523  Sum_probs=12.5

Q ss_pred             EEEeecCCCCCCceE
Q psy12526         79 CIFAYGQTGEKTNYL   93 (103)
Q Consensus        79 ti~aYGqtgSGKT~T   93 (103)
                      .|+-||..|+|||..
T Consensus       489 giLL~GppGtGKT~l  503 (733)
T TIGR01243       489 GVLLFGPPGTGKTLL  503 (733)
T ss_pred             eEEEECCCCCCHHHH
Confidence            467799999999874


No 338
>TIGR01817 nifA Nif-specific regulatory protein. This model represents NifA, a DNA-binding regulatory protein for nitrogen fixation. The model produces scores between the trusted and noise cutoffs for a well-described NifA homolog in Aquifex aeolicus (which lacks nitrogenase), for transcriptional activators of alternative nitrogenases (VFe or FeFe instead of MoFe), and truncated forms.
Probab=55.58  E-value=9.5  Score=30.44  Aligned_cols=19  Identities=16%  Similarity=0.398  Sum_probs=15.5

Q ss_pred             CCcEEEEeecCCCCCCceE
Q psy12526         75 GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+..|+-+|++|+||++.
T Consensus       217 ~~~~pvli~Ge~GtGK~~l  235 (534)
T TIGR01817       217 RSNSTVLLRGESGTGKELI  235 (534)
T ss_pred             CcCCCEEEECCCCccHHHH
Confidence            4566788899999999864


No 339
>PF05872 DUF853:  Bacterial protein of unknown function (DUF853);  InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold. This family is restricted to bacterial proteins, none of which have currently been characterised.
Probab=55.42  E-value=5.3  Score=32.13  Aligned_cols=14  Identities=29%  Similarity=0.340  Sum_probs=12.2

Q ss_pred             eecCCCCCCceEec
Q psy12526         82 AYGQTGEKTNYLLN   95 (103)
Q Consensus        82 aYGqtgSGKT~Tm~   95 (103)
                      --|.||+|||-|+.
T Consensus        24 IaGATGTGKTvTLq   37 (502)
T PF05872_consen   24 IAGATGTGKTVTLQ   37 (502)
T ss_pred             eeccCCCCceehHH
Confidence            47999999999975


No 340
>TIGR00959 ffh signal recognition particle protein. This model represents Ffh (Fifty-Four Homolog), the protein component that forms the bacterial (and organellar) signal recognition particle together with a 4.5S RNA. Ffh is a GTPase homologous to eukaryotic SRP54 and also to the GTPase FtsY (TIGR00064) that is the receptor for the signal recognition particle.
Probab=55.24  E-value=6.4  Score=31.02  Aligned_cols=18  Identities=17%  Similarity=0.196  Sum_probs=14.7

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...++..|.+|||||.|.
T Consensus        99 p~vi~~vG~~GsGKTTta  116 (428)
T TIGR00959        99 PTVILMVGLQGSGKTTTC  116 (428)
T ss_pred             CEEEEEECCCCCcHHHHH
Confidence            356778899999999874


No 341
>cd00984 DnaB_C DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
Probab=55.22  E-value=11  Score=26.41  Aligned_cols=24  Identities=17%  Similarity=0.160  Sum_probs=15.8

Q ss_pred             HHhhCCCc--EEEEeecCCCCCCceE
Q psy12526         70 DNAFQGYN--ACIFAYGQTGEKTNYL   93 (103)
Q Consensus        70 ~~~~~G~n--~ti~aYGqtgSGKT~T   93 (103)
                      +.++.|+.  ..++-.|.+|+|||..
T Consensus         4 D~~~~Gl~~G~l~lI~G~~G~GKT~~   29 (242)
T cd00984           4 DNLTGGLQPGDLIIIAARPSMGKTAF   29 (242)
T ss_pred             hhhhcCCCCCeEEEEEeCCCCCHHHH
Confidence            34444552  2456689999999864


No 342
>TIGR01074 rep ATP-dependent DNA helicase Rep. Designed to identify rep members of the uvrD/rep subfamily.
Probab=54.89  E-value=4.2  Score=33.16  Aligned_cols=18  Identities=6%  Similarity=0.152  Sum_probs=14.9

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      .-++..|-.|||||.||.
T Consensus        15 ~~~~V~Ag~GSGKT~~L~   32 (664)
T TIGR01074        15 GPCLVLAGAGSGKTRVIT   32 (664)
T ss_pred             CCEEEEecCCCCHHHHHH
Confidence            346778999999999885


No 343
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms.  SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes.  The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge.  SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.
Probab=54.74  E-value=6.2  Score=26.98  Aligned_cols=13  Identities=15%  Similarity=0.383  Sum_probs=10.6

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|.+|||||-.|
T Consensus        27 i~G~NGsGKSnil   39 (178)
T cd03239          27 IVGPNGSGKSNIV   39 (178)
T ss_pred             EECCCCCCHHHHH
Confidence            6899999998543


No 344
>TIGR00763 lon ATP-dependent protease La. This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock.
Probab=54.67  E-value=17  Score=30.54  Aligned_cols=15  Identities=20%  Similarity=0.255  Sum_probs=12.5

Q ss_pred             EEEeecCCCCCCceE
Q psy12526         79 CIFAYGQTGEKTNYL   93 (103)
Q Consensus        79 ti~aYGqtgSGKT~T   93 (103)
                      .++-||++|+|||+.
T Consensus       349 ~lll~GppG~GKT~l  363 (775)
T TIGR00763       349 ILCLVGPPGVGKTSL  363 (775)
T ss_pred             eEEEECCCCCCHHHH
Confidence            466799999999974


No 345
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=54.36  E-value=3.3  Score=31.68  Aligned_cols=13  Identities=31%  Similarity=0.496  Sum_probs=10.7

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -+|.+|||||..+
T Consensus        33 LlGpSGaGKsTlL   45 (345)
T COG1118          33 LLGPSGAGKSTLL   45 (345)
T ss_pred             EECCCCCcHHHHH
Confidence            3799999999754


No 346
>PF13481 AAA_25:  AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.
Probab=54.27  E-value=5.3  Score=26.85  Aligned_cols=28  Identities=21%  Similarity=0.201  Sum_probs=17.0

Q ss_pred             HHHHHhhCCCc---EEEEeecCCCCCCceEe
Q psy12526         67 DILDNAFQGYN---ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        67 ~lv~~~~~G~n---~ti~aYGqtgSGKT~Tm   94 (103)
                      +-++.++.|+-   .-++-+|++|+|||+.+
T Consensus        19 ~~~~~li~g~~~~g~l~~i~g~~g~GKT~~~   49 (193)
T PF13481_consen   19 PPLDWLIDGLLPRGELTLIAGPPGSGKTTLA   49 (193)
T ss_dssp             ----EEETTEE-TTSEEEEEECSTSSHHHHH
T ss_pred             CCcceeECCcccCCeEEEEEeCCCCCHHHHH
Confidence            44455665552   24667999999999754


No 347
>KOG0330|consensus
Probab=54.17  E-value=7.4  Score=30.83  Aligned_cols=23  Identities=17%  Similarity=0.258  Sum_probs=17.0

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      |..++.|-.+  ++..|||||||-+
T Consensus        92 iP~~L~g~dv--IglAeTGSGKT~a  114 (476)
T KOG0330|consen   92 IPVALGGRDV--IGLAETGSGKTGA  114 (476)
T ss_pred             cchhhCCCcE--EEEeccCCCchhh
Confidence            4456788775  4677999999854


No 348
>COG5022 Myosin heavy chain [Cytoskeleton]
Probab=54.15  E-value=21  Score=32.47  Aligned_cols=32  Identities=22%  Similarity=0.344  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHHHhh-CCCcEEEEeecCCCCCCce
Q psy12526         60 VFDALGRDILDNAF-QGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        60 v~~~~~~~lv~~~~-~G~n~ti~aYGqtgSGKT~   92 (103)
                      ||.- +...-..++ ++-|-||+.-|++|+|||-
T Consensus       135 vfAI-Ae~aY~~lls~~eNQtIiISGESGAGKTe  167 (1463)
T COG5022         135 VFAI-AEEAYRNLLSEKENQTIIISGESGAGKTE  167 (1463)
T ss_pred             HHHH-HHHHHHHHHhcCCCceEEEecCCCCCchH
Confidence            5532 334444444 5779999999999999984


No 349
>KOG1800|consensus
Probab=53.90  E-value=12  Score=29.70  Aligned_cols=21  Identities=33%  Similarity=0.713  Sum_probs=18.0

Q ss_pred             HHHHhhCCCcEEEEeecCCCC
Q psy12526         68 ILDNAFQGYNACIFAYGQTGE   88 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgS   88 (103)
                      .+..+.++|.|.|+|||..|-
T Consensus       101 sl~eL~~~ydavvLaYGa~~d  121 (468)
T KOG1800|consen  101 SLKELTDNYDAVVLAYGADGD  121 (468)
T ss_pred             cHHHHhhcccEEEEEecCCCC
Confidence            456788999999999999884


No 350
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=53.83  E-value=7.2  Score=27.83  Aligned_cols=13  Identities=23%  Similarity=0.358  Sum_probs=10.8

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .-+|++|||||..
T Consensus        26 ~i~G~NGsGKStl   38 (247)
T cd03275          26 CIIGPNGSGKSNL   38 (247)
T ss_pred             EEECCCCCCHHHH
Confidence            4589999999864


No 351
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG. This protein is found in the Agrobacterium tumefaciens Ti plasmid tra region responsible for conjugative transfer of the entire plasmid among Agrobacterium strains. The protein is distantly related to the F-type conjugation system TraG protein. Both of these systems are examples of type IV secretion systems.
Probab=53.53  E-value=9  Score=31.67  Aligned_cols=19  Identities=5%  Similarity=0.111  Sum_probs=15.5

Q ss_pred             cEEEEeecCCCCCCceEec
Q psy12526         77 NACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +.=++.+|.||||||.++.
T Consensus       211 ~~H~lv~ApTgsGKgvg~V  229 (623)
T TIGR02767       211 STHMIFFAGSGGFKTTSVV  229 (623)
T ss_pred             CceEEEEeCCCCCccceee
Confidence            3467899999999998754


No 352
>PLN02165 adenylate isopentenyltransferase
Probab=53.14  E-value=6.7  Score=30.01  Aligned_cols=15  Identities=27%  Similarity=0.445  Sum_probs=11.8

Q ss_pred             EEEeecCCCCCCceE
Q psy12526         79 CIFAYGQTGEKTNYL   93 (103)
Q Consensus        79 ti~aYGqtgSGKT~T   93 (103)
                      .|.-.|.||||||..
T Consensus        45 iivIiGPTGSGKStL   59 (334)
T PLN02165         45 VVVIMGATGSGKSRL   59 (334)
T ss_pred             EEEEECCCCCcHHHH
Confidence            455689999999864


No 353
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=53.13  E-value=4.5  Score=28.04  Aligned_cols=13  Identities=15%  Similarity=0.409  Sum_probs=11.0

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|.+|||||..+
T Consensus        27 i~G~nGsGKStll   39 (197)
T cd03278          27 IVGPNGSGKSNII   39 (197)
T ss_pred             EECCCCCCHHHHH
Confidence            5899999998754


No 354
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]
Probab=53.09  E-value=7.7  Score=30.69  Aligned_cols=39  Identities=13%  Similarity=0.204  Sum_probs=26.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         53 NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        53 ~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      +...|+.+.... .+|-..+-.|.=.+.+-||+-|+|||.
T Consensus        25 e~vGQ~HLlg~~-~~lrr~v~~~~l~SmIl~GPPG~GKTT   63 (436)
T COG2256          25 EVVGQEHLLGEG-KPLRRAVEAGHLHSMILWGPPGTGKTT   63 (436)
T ss_pred             HhcChHhhhCCC-chHHHHHhcCCCceeEEECCCCCCHHH
Confidence            455777776542 354444445666677789999999985


No 355
>PRK05973 replicative DNA helicase; Provisional
Probab=53.08  E-value=10  Score=27.44  Aligned_cols=22  Identities=9%  Similarity=0.199  Sum_probs=15.7

Q ss_pred             HhhCCC--cEEEEeecCCCCCCce
Q psy12526         71 NAFQGY--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        71 ~~~~G~--n~ti~aYGqtgSGKT~   92 (103)
                      .+..|+  ...++-.|.+|+|||.
T Consensus        56 ~l~GGl~~Gsl~LIaG~PG~GKT~   79 (237)
T PRK05973         56 ELFSQLKPGDLVLLGARPGHGKTL   79 (237)
T ss_pred             HhcCCCCCCCEEEEEeCCCCCHHH
Confidence            344555  2356779999999986


No 356
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair]
Probab=53.02  E-value=5.4  Score=35.05  Aligned_cols=19  Identities=11%  Similarity=0.364  Sum_probs=15.2

Q ss_pred             cEEEEeecCCCCCCceEec
Q psy12526         77 NACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +.+++.=...||||||||.
T Consensus        16 ~~~~lveASAGSGKT~vL~   34 (1139)
T COG1074          16 GQSVLVEASAGTGKTFVLA   34 (1139)
T ss_pred             CCcEEEEEcCCCCchhHHH
Confidence            4566667789999999985


No 357
>PRK13537 nodulation ABC transporter NodI; Provisional
Probab=53.02  E-value=3.4  Score=30.67  Aligned_cols=13  Identities=23%  Similarity=0.325  Sum_probs=10.7

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|.+|+|||.+|
T Consensus        38 llGpNGaGKSTLl   50 (306)
T PRK13537         38 LLGPNGAGKTTTL   50 (306)
T ss_pred             EECCCCCCHHHHH
Confidence            3699999999754


No 358
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit. This model represents the ATPase subunit of HslVU, while the proteasome-related peptidase subunit is HslV. Residues 54-61 of the model contain a P-loop ATP-binding motif. Cys-287 of E. coli (position 308 in the seed alignment), studied in PubMed:98389714, is Ser in other members of the seed alignment.
Probab=52.95  E-value=6.5  Score=31.24  Aligned_cols=16  Identities=25%  Similarity=0.326  Sum_probs=13.3

Q ss_pred             EEEEeecCCCCCCceE
Q psy12526         78 ACIFAYGQTGEKTNYL   93 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~T   93 (103)
                      .-|+-+|.+|+|||+.
T Consensus        48 ~~ILLiGppG~GKT~l   63 (441)
T TIGR00390        48 KNILMIGPTGVGKTEI   63 (441)
T ss_pred             ceEEEECCCCCCHHHH
Confidence            4578899999999863


No 359
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=52.92  E-value=7.6  Score=29.95  Aligned_cols=29  Identities=28%  Similarity=0.391  Sum_probs=21.1

Q ss_pred             HHHHHhhCC-C--cEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAFQG-Y--NACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~~G-~--n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +-++.++.| +  ...++-+|..|+|||..++
T Consensus        69 ~eLD~vLgGGi~~GslvLI~G~pG~GKStLll  100 (372)
T cd01121          69 EELDRVLGGGLVPGSVILIGGDPGIGKSTLLL  100 (372)
T ss_pred             HHHHHhhcCCccCCeEEEEEeCCCCCHHHHHH
Confidence            446677754 2  4578899999999997543


No 360
>PF13654 AAA_32:  AAA domain; PDB: 3K1J_B.
Probab=52.90  E-value=4.5  Score=32.54  Aligned_cols=39  Identities=31%  Similarity=0.419  Sum_probs=0.0

Q ss_pred             CCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         54 FASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        54 ~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ...|+...+.+-. -+.-=-.|||  ||+.|..|+||+..+.
T Consensus        10 ~iGQ~RA~~Al~~-gl~i~~~GYN--Ifv~G~~GtGr~t~v~   48 (509)
T PF13654_consen   10 IIGQERAVEALEF-GLGIRKPGYN--IFVMGPPGTGRRTYVR   48 (509)
T ss_dssp             ------------------------------------------
T ss_pred             ccccccccccccc-cccccccccc--cccccccccccccccc
Confidence            4466655554421 1111136999  6889999999987653


No 361
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=52.87  E-value=11  Score=25.89  Aligned_cols=23  Identities=26%  Similarity=0.424  Sum_probs=16.1

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +...+.+ . ++.-.|++|.||+..
T Consensus        29 l~~~l~~-k-~~vl~G~SGvGKSSL   51 (161)
T PF03193_consen   29 LKELLKG-K-TSVLLGQSGVGKSSL   51 (161)
T ss_dssp             HHHHHTT-S-EEEEECSTTSSHHHH
T ss_pred             HHHHhcC-C-EEEEECCCCCCHHHH
Confidence            4456666 3 445589999999863


No 362
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=52.75  E-value=5.7  Score=28.89  Aligned_cols=18  Identities=33%  Similarity=0.564  Sum_probs=13.0

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .|+|+   -.|++|||||-.|
T Consensus        21 ~~~~~---i~G~nGsGKS~il   38 (276)
T cd03241          21 EGLTV---LTGETGAGKSILL   38 (276)
T ss_pred             CCeEE---EEcCCCCCHHHHH
Confidence            45554   4799999998543


No 363
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=52.53  E-value=4.6  Score=27.75  Aligned_cols=14  Identities=21%  Similarity=0.370  Sum_probs=11.0

Q ss_pred             EeecCCCCCCceEe
Q psy12526         81 FAYGQTGEKTNYLL   94 (103)
Q Consensus        81 ~aYGqtgSGKT~Tm   94 (103)
                      --.|++|||||..+
T Consensus        25 ~l~G~nG~GKSTLl   38 (176)
T cd03238          25 VVTGVSGSGKSTLV   38 (176)
T ss_pred             EEECCCCCCHHHHH
Confidence            34799999999754


No 364
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=52.42  E-value=3.2  Score=28.58  Aligned_cols=12  Identities=25%  Similarity=0.385  Sum_probs=10.1

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      --|.+|||||..
T Consensus        32 l~G~nGsGKSTL   43 (211)
T cd03225          32 IVGPNGSGKSTL   43 (211)
T ss_pred             EECCCCCCHHHH
Confidence            369999999974


No 365
>CHL00176 ftsH cell division protein; Validated
Probab=52.41  E-value=6.4  Score=32.55  Aligned_cols=16  Identities=19%  Similarity=0.337  Sum_probs=13.6

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      .|+-||+.|+|||+..
T Consensus       218 gVLL~GPpGTGKT~LA  233 (638)
T CHL00176        218 GVLLVGPPGTGKTLLA  233 (638)
T ss_pred             eEEEECCCCCCHHHHH
Confidence            4788999999999753


No 366
>KOG2035|consensus
Probab=52.23  E-value=19  Score=27.57  Aligned_cols=15  Identities=20%  Similarity=0.481  Sum_probs=12.2

Q ss_pred             EEEeecCCCCCCceE
Q psy12526         79 CIFAYGQTGEKTNYL   93 (103)
Q Consensus        79 ti~aYGqtgSGKT~T   93 (103)
                      -++.||++|+||-..
T Consensus        36 Hll~yGPSGaGKKTr   50 (351)
T KOG2035|consen   36 HLLVYGPSGAGKKTR   50 (351)
T ss_pred             eEEEECCCCCCchhh
Confidence            467899999999554


No 367
>TIGR02239 recomb_RAD51 DNA repair protein RAD51. This eukaryotic sequence family consists of RAD51, a protein involved in DNA homologous recombination and repair. It is similar in sequence the exclusively meiotic recombinase DMC1 (TIGR02238), to archaeal families RadA (TIGR02236) and RadB (TIGR02237), and to bacterial RecA (TIGR02012).
Probab=52.10  E-value=20  Score=26.98  Aligned_cols=28  Identities=18%  Similarity=0.222  Sum_probs=19.1

Q ss_pred             HHHHHhhCC-C--cEEEEeecCCCCCCceEe
Q psy12526         67 DILDNAFQG-Y--NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        67 ~lv~~~~~G-~--n~ti~aYGqtgSGKT~Tm   94 (103)
                      +-++.++.| +  ...+..||..|+|||.-+
T Consensus        83 ~~lD~ll~gGi~~g~i~~i~G~~g~GKT~l~  113 (316)
T TIGR02239        83 KELDKLLGGGIETGSITEIFGEFRTGKTQLC  113 (316)
T ss_pred             HHHHHHhcCCCCCCeEEEEECCCCCCcCHHH
Confidence            445666653 3  345678999999998643


No 368
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional
Probab=51.94  E-value=13  Score=33.09  Aligned_cols=26  Identities=27%  Similarity=0.584  Sum_probs=19.9

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+|..+++|.++  ++--+||+|||-+
T Consensus       466 ~eaI~aiL~GrDV--LVimPTGSGKSLc  491 (1195)
T PLN03137        466 REIINATMSGYDV--FVLMPTGGGKSLT  491 (1195)
T ss_pred             HHHHHHHHcCCCE--EEEcCCCccHHHH
Confidence            3456778999984  5677999999863


No 369
>PRK12337 2-phosphoglycerate kinase; Provisional
Probab=51.87  E-value=10  Score=30.43  Aligned_cols=19  Identities=16%  Similarity=0.142  Sum_probs=16.2

Q ss_pred             CcEEEEeecCCCCCCceEe
Q psy12526         76 YNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        76 ~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ....|+..|.+|+|||.+.
T Consensus       254 ~p~vil~~G~~G~GKSt~a  272 (475)
T PRK12337        254 RPLHVLIGGVSGVGKSVLA  272 (475)
T ss_pred             CCeEEEEECCCCCCHHHHH
Confidence            4678899999999999764


No 370
>PRK11823 DNA repair protein RadA; Provisional
Probab=51.76  E-value=14  Score=29.18  Aligned_cols=28  Identities=25%  Similarity=0.399  Sum_probs=21.1

Q ss_pred             HHHHHhhCC-C--cEEEEeecCCCCCCceEe
Q psy12526         67 DILDNAFQG-Y--NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        67 ~lv~~~~~G-~--n~ti~aYGqtgSGKT~Tm   94 (103)
                      +-++.++.| +  ...++-+|..|+|||.-+
T Consensus        67 ~~LD~~LgGGi~~Gs~~lI~G~pG~GKTtL~   97 (446)
T PRK11823         67 GELDRVLGGGLVPGSVVLIGGDPGIGKSTLL   97 (446)
T ss_pred             HHHHHHhcCCccCCEEEEEECCCCCCHHHHH
Confidence            556777764 3  567889999999998743


No 371
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=51.69  E-value=5.4  Score=27.70  Aligned_cols=13  Identities=23%  Similarity=0.442  Sum_probs=10.9

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -+|++|+|||..|
T Consensus        26 i~G~NGsGKStll   38 (198)
T cd03276          26 IVGNNGSGKSAIL   38 (198)
T ss_pred             EECCCCCcHHHHH
Confidence            4899999999654


No 372
>KOG0344|consensus
Probab=51.52  E-value=8.1  Score=31.74  Aligned_cols=23  Identities=13%  Similarity=0.148  Sum_probs=16.2

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +..++++-  -++|.+.||||||+.
T Consensus       167 ipvfl~~r--~~lAcapTGsgKtla  189 (593)
T KOG0344|consen  167 IPVFLEKR--DVLACAPTGSGKTLA  189 (593)
T ss_pred             hhhhhccc--ceEEeccCCCcchhh
Confidence            33444444  468999999999863


No 373
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=51.44  E-value=8.2  Score=32.95  Aligned_cols=13  Identities=15%  Similarity=0.324  Sum_probs=10.3

Q ss_pred             EEeecCCCCCCce
Q psy12526         80 IFAYGQTGEKTNY   92 (103)
Q Consensus        80 i~aYGqtgSGKT~   92 (103)
                      .+-.|+||||||.
T Consensus        28 ~lI~G~nGsGKSS   40 (908)
T COG0419          28 FLIVGPNGAGKSS   40 (908)
T ss_pred             EEEECCCCCcHHH
Confidence            3458999999964


No 374
>PRK06851 hypothetical protein; Provisional
Probab=51.38  E-value=7.9  Score=29.94  Aligned_cols=28  Identities=21%  Similarity=0.388  Sum_probs=21.5

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +.+.++++.+-.++--|..|+|||++|.
T Consensus        21 ~~~~~~~~~~~~~il~G~pGtGKStl~~   48 (367)
T PRK06851         21 LYDSIIDGANRIFILKGGPGTGKSTLMK   48 (367)
T ss_pred             hhhhhccccceEEEEECCCCCCHHHHHH
Confidence            3455566777777888999999998774


No 375
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional
Probab=51.37  E-value=10  Score=28.44  Aligned_cols=26  Identities=15%  Similarity=0.222  Sum_probs=18.0

Q ss_pred             HHHhhCCCcEEEEe-ecCCCCCCceEe
Q psy12526         69 LDNAFQGYNACIFA-YGQTGEKTNYLL   94 (103)
Q Consensus        69 v~~~~~G~n~ti~a-YGqtgSGKT~Tm   94 (103)
                      .+..|+..++.++. .|..|||||..|
T Consensus        95 ~r~~~~~~~~~~v~l~G~pGsGKTTLl  121 (290)
T PRK10463         95 NRARFAARKQLVLNLVSSPGSGKTTLL  121 (290)
T ss_pred             HHHHHHhcCCeEEEEECCCCCCHHHHH
Confidence            44456666655444 599999999865


No 376
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated
Probab=51.32  E-value=13  Score=30.24  Aligned_cols=37  Identities=24%  Similarity=0.325  Sum_probs=22.1

Q ss_pred             CCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         54 FASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        54 ~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      .-+-.+|.+.+.+-.-.....|+  +|+-.|..|||||.
T Consensus       371 ~f~rpeV~~iL~~~~~~r~~~g~--~Ivl~Gl~GSGKST  407 (568)
T PRK05537        371 WFSFPEVVAELRRTYPPRHKQGF--TVFFTGLSGAGKST  407 (568)
T ss_pred             hhcHHHHHHHHHHHhccccCCCe--EEEEECCCCChHHH
Confidence            34455555543333333344555  56678999999985


No 377
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=51.17  E-value=6.2  Score=27.19  Aligned_cols=17  Identities=12%  Similarity=0.092  Sum_probs=13.2

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      -.+.-.|++|+|||..|
T Consensus        30 ~~~~l~G~Ng~GKStll   46 (202)
T cd03243          30 RLLLITGPNMGGKSTYL   46 (202)
T ss_pred             eEEEEECCCCCccHHHH
Confidence            35567899999999754


No 378
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I. This model represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll. This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria.
Probab=51.13  E-value=18  Score=27.48  Aligned_cols=37  Identities=14%  Similarity=0.209  Sum_probs=24.7

Q ss_pred             CCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         55 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ..|+++    ..-|+-.+++..-+-++-.|.+|+|||..+-
T Consensus         7 vgq~~~----~~al~~~~~~~~~g~vli~G~~G~gKttl~r   43 (337)
T TIGR02030         7 VGQDEM----KLALLLNVIDPKIGGVMVMGDRGTGKSTAVR   43 (337)
T ss_pred             ccHHHH----HHHHHHHhcCCCCCeEEEEcCCCCCHHHHHH
Confidence            356544    3445556666555567789999999997543


No 379
>PRK13889 conjugal transfer relaxase TraA; Provisional
Probab=50.96  E-value=9.4  Score=33.30  Aligned_cols=27  Identities=19%  Similarity=0.282  Sum_probs=20.1

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .|..++.+.+.+ +.-|..|+||||+|-
T Consensus       354 Av~~il~s~~v~-vv~G~AGTGKTT~l~  380 (988)
T PRK13889        354 ALAHVTDGRDLG-VVVGYAGTGKSAMLG  380 (988)
T ss_pred             HHHHHhcCCCeE-EEEeCCCCCHHHHHH
Confidence            456677766644 478999999999763


No 380
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=50.94  E-value=6.6  Score=29.40  Aligned_cols=15  Identities=27%  Similarity=0.519  Sum_probs=11.8

Q ss_pred             EEee-cCCCCCCceEe
Q psy12526         80 IFAY-GQTGEKTNYLL   94 (103)
Q Consensus        80 i~aY-GqtgSGKT~Tm   94 (103)
                      ||.. |++|+|||.|.
T Consensus        30 i~GllG~NGAGKTTtf   45 (300)
T COG4152          30 IFGLLGPNGAGKTTTF   45 (300)
T ss_pred             EEEeecCCCCCccchH
Confidence            4444 99999999985


No 381
>PF01078 Mg_chelatase:  Magnesium chelatase, subunit ChlI;  InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. As a result, it is thought that Mg-chelatase has an important role in channeling intermediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weights between 38-42 kDa.; GO: 0016851 magnesium chelatase activity, 0015979 photosynthesis, 0015995 chlorophyll biosynthetic process; PDB: 2X31_J 1G8P_A 3K1J_B.
Probab=50.67  E-value=20  Score=25.58  Aligned_cols=21  Identities=19%  Similarity=0.213  Sum_probs=13.3

Q ss_pred             HHhhCCCcEEEEeecCCCCCCce
Q psy12526         70 DNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        70 ~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      -.+..|.  -|+-+|..|+|||.
T Consensus        17 iAAaG~h--~lLl~GppGtGKTm   37 (206)
T PF01078_consen   17 IAAAGGH--HLLLIGPPGTGKTM   37 (206)
T ss_dssp             HHHHCC----EEEES-CCCTHHH
T ss_pred             HHHcCCC--CeEEECCCCCCHHH
Confidence            3444554  46779999999975


No 382
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=50.67  E-value=5.5  Score=29.41  Aligned_cols=18  Identities=28%  Similarity=0.237  Sum_probs=14.4

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      -.+.-+|++|+|||.++.
T Consensus        76 ~~i~~~G~~g~GKTtl~~   93 (270)
T PRK06731         76 QTIALIGPTGVGKTTTLA   93 (270)
T ss_pred             CEEEEECCCCCcHHHHHH
Confidence            466778999999998653


No 383
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=50.44  E-value=4.1  Score=30.99  Aligned_cols=12  Identities=25%  Similarity=0.476  Sum_probs=10.0

Q ss_pred             ecCCCCCCceEe
Q psy12526         83 YGQTGEKTNYLL   94 (103)
Q Consensus        83 YGqtgSGKT~Tm   94 (103)
                      -|++|||||-|.
T Consensus        37 VGESGsGKS~~~   48 (316)
T COG0444          37 VGESGSGKSVLA   48 (316)
T ss_pred             EcCCCCCHHHHH
Confidence            499999998754


No 384
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=50.36  E-value=3.6  Score=28.47  Aligned_cols=12  Identities=17%  Similarity=0.379  Sum_probs=10.1

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      -.|.+|||||.-
T Consensus        34 i~G~nGsGKSTL   45 (216)
T TIGR00960        34 LVGHSGAGKSTF   45 (216)
T ss_pred             EECCCCCCHHHH
Confidence            369999999974


No 385
>PRK10869 recombination and repair protein; Provisional
Probab=50.27  E-value=8.9  Score=31.08  Aligned_cols=16  Identities=25%  Similarity=0.441  Sum_probs=12.5

Q ss_pred             CCCcEEEEeecCCCCCCce
Q psy12526         74 QGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~   92 (103)
                      .|+|+   -.|.||||||-
T Consensus        22 ~glnv---itGetGaGKS~   37 (553)
T PRK10869         22 SGMTV---ITGETGAGKSI   37 (553)
T ss_pred             CCcEE---EECCCCCChHH
Confidence            57775   37999999974


No 386
>PHA02774 E1; Provisional
Probab=50.26  E-value=13  Score=30.84  Aligned_cols=25  Identities=20%  Similarity=0.563  Sum_probs=18.3

Q ss_pred             HHHhhCCCc--EEEEeecCCCCCCceE
Q psy12526         69 LDNAFQGYN--ACIFAYGQTGEKTNYL   93 (103)
Q Consensus        69 v~~~~~G~n--~ti~aYGqtgSGKT~T   93 (103)
                      +..+++|.-  .|++-||+.++||||-
T Consensus       424 lk~~l~~~PKknciv~~GPP~TGKS~f  450 (613)
T PHA02774        424 LKDFLKGIPKKNCLVIYGPPDTGKSMF  450 (613)
T ss_pred             HHHHHhcCCcccEEEEECCCCCCHHHH
Confidence            444555543  4888999999999973


No 387
>COG3587 Restriction endonuclease [Defense mechanisms]
Probab=50.20  E-value=6.9  Score=33.73  Aligned_cols=17  Identities=29%  Similarity=0.374  Sum_probs=12.3

Q ss_pred             CcEEEEeecCCCCCCceEe
Q psy12526         76 YNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        76 ~n~ti~aYGqtgSGKT~Tm   94 (103)
                      +|+-|.  =+||+|||||-
T Consensus        75 lNiDI~--METGTGKTy~Y   91 (985)
T COG3587          75 LNIDIL--METGTGKTYTY   91 (985)
T ss_pred             ceeeEE--EecCCCceeeH
Confidence            455553  38999999973


No 388
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only]
Probab=50.18  E-value=10  Score=27.62  Aligned_cols=13  Identities=15%  Similarity=0.268  Sum_probs=11.1

Q ss_pred             ecCCCCCCceEec
Q psy12526         83 YGQTGEKTNYLLN   95 (103)
Q Consensus        83 YGqtgSGKT~Tm~   95 (103)
                      .|++|+|||.|..
T Consensus        36 LGPNGAGKTT~Fy   48 (243)
T COG1137          36 LGPNGAGKTTTFY   48 (243)
T ss_pred             ECCCCCCceeEEE
Confidence            6999999998753


No 389
>KOG0925|consensus
Probab=49.94  E-value=11  Score=30.88  Aligned_cols=19  Identities=26%  Similarity=0.214  Sum_probs=15.6

Q ss_pred             CCcEEEEeecCCCCCCceE
Q psy12526         75 GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..|-+|.--|.||||||.-
T Consensus        60 ~~nQ~~v~vGetgsGKttQ   78 (699)
T KOG0925|consen   60 LNNQIIVLVGETGSGKTTQ   78 (699)
T ss_pred             hcCceEEEEecCCCCcccc
Confidence            3477888899999999864


No 390
>PRK13822 conjugal transfer coupling protein TraG; Provisional
Probab=49.87  E-value=11  Score=31.17  Aligned_cols=19  Identities=5%  Similarity=0.048  Sum_probs=15.4

Q ss_pred             cEEEEeecCCCCCCceEec
Q psy12526         77 NACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +.-++.+|.||||||..+.
T Consensus       224 ~~H~Lv~ApTgsGKt~g~V  242 (641)
T PRK13822        224 STHGLVFAGSGGFKTTSVV  242 (641)
T ss_pred             CceEEEEeCCCCCccceEe
Confidence            4557899999999998653


No 391
>PLN02200 adenylate kinase family protein
Probab=49.75  E-value=7.9  Score=27.73  Aligned_cols=15  Identities=20%  Similarity=0.293  Sum_probs=12.8

Q ss_pred             EEEEeecCCCCCCce
Q psy12526         78 ACIFAYGQTGEKTNY   92 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~   92 (103)
                      ..|+..|..|||||.
T Consensus        44 ~ii~I~G~PGSGKsT   58 (234)
T PLN02200         44 FITFVLGGPGSGKGT   58 (234)
T ss_pred             EEEEEECCCCCCHHH
Confidence            457889999999975


No 392
>PRK13946 shikimate kinase; Provisional
Probab=49.56  E-value=8.2  Score=26.24  Aligned_cols=15  Identities=13%  Similarity=0.251  Sum_probs=12.8

Q ss_pred             EEEeecCCCCCCceE
Q psy12526         79 CIFAYGQTGEKTNYL   93 (103)
Q Consensus        79 ti~aYGqtgSGKT~T   93 (103)
                      .|+--|..|||||..
T Consensus        12 ~I~l~G~~GsGKsti   26 (184)
T PRK13946         12 TVVLVGLMGAGKSTV   26 (184)
T ss_pred             eEEEECCCCCCHHHH
Confidence            588899999999863


No 393
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]
Probab=49.54  E-value=6.7  Score=29.01  Aligned_cols=18  Identities=22%  Similarity=0.237  Sum_probs=13.7

Q ss_pred             hCCCcEEEEeecCCCCCCce
Q psy12526         73 FQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~   92 (103)
                      -.|-+=.|  +|.+|||||.
T Consensus        55 ~~ge~W~I--~G~NGsGKTT   72 (257)
T COG1119          55 NPGEHWAI--VGPNGAGKTT   72 (257)
T ss_pred             cCCCcEEE--ECCCCCCHHH
Confidence            34656555  9999999986


No 394
>KOG0160|consensus
Probab=49.38  E-value=13  Score=31.99  Aligned_cols=24  Identities=21%  Similarity=0.260  Sum_probs=20.6

Q ss_pred             HhhCCCcEEEEeecCCCCCCceEe
Q psy12526         71 NAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        71 ~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      -..++.|-+|..-|.+|+|||-|+
T Consensus        88 m~~~~~~QsIivsGESGAgkT~~a  111 (862)
T KOG0160|consen   88 MTPDGVNQSIIVSGESGAGKTETA  111 (862)
T ss_pred             hhhccCCceeeeeCCCCCchhHHH
Confidence            346788999999999999999765


No 395
>PRK14701 reverse gyrase; Provisional
Probab=49.19  E-value=15  Score=33.80  Aligned_cols=24  Identities=13%  Similarity=0.102  Sum_probs=18.8

Q ss_pred             HHHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         67 DILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        67 ~lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      ..+..+++|.+..  +.++||||||.
T Consensus        86 ~~i~~il~G~d~l--i~APTGsGKTl  109 (1638)
T PRK14701         86 TWAKRILRGKSFS--IVAPTGMGKST  109 (1638)
T ss_pred             HHHHHHHcCCCEE--EEEcCCCCHHH
Confidence            4556778888754  67899999996


No 396
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional
Probab=49.07  E-value=13  Score=29.78  Aligned_cols=19  Identities=26%  Similarity=0.384  Sum_probs=15.4

Q ss_pred             CCcEEEEeecCCCCCCceE
Q psy12526         75 GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+.-|+-+|++|+||++.
T Consensus       225 ~~~~pvlI~GE~GtGK~~l  243 (520)
T PRK10820        225 MLDAPLLITGDTGTGKDLL  243 (520)
T ss_pred             CCCCCEEEECCCCccHHHH
Confidence            3566788999999999763


No 397
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=49.03  E-value=10  Score=27.05  Aligned_cols=17  Identities=24%  Similarity=0.413  Sum_probs=12.7

Q ss_pred             CCCcEEEEeecCCCCCCceE
Q psy12526         74 QGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~T   93 (103)
                      .|+|+   -.|++|||||..
T Consensus        25 ~~~~~---IvG~NGsGKStl   41 (251)
T cd03273          25 PQFNA---ITGLNGSGKSNI   41 (251)
T ss_pred             CCeEE---EECCCCCCHHHH
Confidence            45554   479999999864


No 398
>TIGR02858 spore_III_AA stage III sporulation protein AA. Members of this protein are the stage III sporulation protein AA, encoded by one of several genes in the spoIIIA locus. It seems that this protein is found in a species if and only if that species is capable of endospore formation.
Probab=49.02  E-value=6.1  Score=29.11  Aligned_cols=16  Identities=13%  Similarity=0.002  Sum_probs=12.8

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      .+.-+|.+|||||..+
T Consensus       113 ~~~i~g~~g~GKttl~  128 (270)
T TIGR02858       113 NTLIISPPQCGKTTLL  128 (270)
T ss_pred             EEEEEcCCCCCHHHHH
Confidence            4556999999998754


No 399
>KOG0735|consensus
Probab=49.00  E-value=8.1  Score=32.99  Aligned_cols=17  Identities=29%  Similarity=0.493  Sum_probs=14.3

Q ss_pred             cEEEEeecCCCCCCceE
Q psy12526         77 NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~T   93 (103)
                      ..-|+-||..|.||||-
T Consensus       701 ~~giLLyGppGcGKT~l  717 (952)
T KOG0735|consen  701 RTGILLYGPPGCGKTLL  717 (952)
T ss_pred             ccceEEECCCCCcHHHH
Confidence            35588999999999984


No 400
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=48.97  E-value=3.9  Score=28.20  Aligned_cols=13  Identities=23%  Similarity=0.225  Sum_probs=10.7

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .-.|.+|||||..
T Consensus        29 ~i~G~nGsGKSTL   41 (211)
T cd03264          29 GLLGPNGAGKTTL   41 (211)
T ss_pred             EEECCCCCCHHHH
Confidence            3479999999974


No 401
>PRK13536 nodulation factor exporter subunit NodI; Provisional
Probab=48.93  E-value=4  Score=30.90  Aligned_cols=12  Identities=17%  Similarity=0.365  Sum_probs=10.3

Q ss_pred             ecCCCCCCceEe
Q psy12526         83 YGQTGEKTNYLL   94 (103)
Q Consensus        83 YGqtgSGKT~Tm   94 (103)
                      .|.+|+|||.+|
T Consensus        73 lGpNGaGKSTLl   84 (340)
T PRK13536         73 LGPNGAGKSTIA   84 (340)
T ss_pred             ECCCCCCHHHHH
Confidence            599999999754


No 402
>COG5519 Superfamily II helicase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=48.89  E-value=39  Score=27.78  Aligned_cols=40  Identities=23%  Similarity=0.290  Sum_probs=27.9

Q ss_pred             CCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEec
Q psy12526         55 ASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        55 ~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      .--..||..++.|||+-+ .--..-+--||||..|||.||-
T Consensus       167 ~~~~~~y~alaa~llr~i-ga~sf~vhi~~qSS~gKT~~~~  206 (562)
T COG5519         167 MMRLKVYAALAAPLLRLI-GAESFIVHIYGQSSTGKTTTMN  206 (562)
T ss_pred             hhHHHHHHHHHHHHHHHh-CCcceeEeecccCCCCceeeee
Confidence            344568888888887653 2222335569999999999985


No 403
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=48.73  E-value=6.3  Score=27.56  Aligned_cols=13  Identities=23%  Similarity=0.296  Sum_probs=10.6

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .-.|.+|||||..
T Consensus        35 ~l~G~nGsGKSTL   47 (233)
T cd03258          35 GIIGRSGAGKSTL   47 (233)
T ss_pred             EEECCCCCCHHHH
Confidence            3479999999974


No 404
>KOG0951|consensus
Probab=48.72  E-value=43  Score=30.64  Aligned_cols=56  Identities=11%  Similarity=0.159  Sum_probs=32.3

Q ss_pred             ceEEeceEEecCCCC---CCCCCCHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         36 KTFAFDHCFYSLDPN---LPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        36 ~~F~fd~vf~s~~~~---~~~~~~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      +.|.-+.=||.+.+.   ..+.-.|..-|+.+-.-+-+.++.+ ...++-+|+||+|||=
T Consensus       282 ~pf~~~Ekl~~iselP~Wnq~aF~g~~sLNrIQS~v~daAl~~-~EnmLlCAPTGaGKTN  340 (1674)
T KOG0951|consen  282 FPFHKEEKLVKISELPKWNQPAFFGKQSLNRIQSKVYDAALRG-DENMLLCAPTGAGKTN  340 (1674)
T ss_pred             CCCCccceeEeecCCcchhhhhcccchhhhHHHHHHHHHHhcC-cCcEEEeccCCCCchH
Confidence            445445555544311   1122233344666655566666655 4467889999999984


No 405
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional
Probab=48.70  E-value=13  Score=31.46  Aligned_cols=16  Identities=19%  Similarity=0.430  Sum_probs=12.8

Q ss_pred             EeecCCCCCCceEecc
Q psy12526         81 FAYGQTGEKTNYLLNG   96 (103)
Q Consensus        81 ~aYGqtgSGKT~Tm~G   96 (103)
                      +-+|.+|+|||+...+
T Consensus       211 LLvGppGvGKT~lae~  226 (758)
T PRK11034        211 LLVGESGVGKTAIAEG  226 (758)
T ss_pred             EEECCCCCCHHHHHHH
Confidence            3499999999986554


No 406
>PRK13898 type IV secretion system ATPase VirB4; Provisional
Probab=48.66  E-value=6.1  Score=33.26  Aligned_cols=17  Identities=24%  Similarity=0.389  Sum_probs=13.8

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      ...+..|.||||||..|
T Consensus       447 ~~~~i~G~tGsGKS~l~  463 (800)
T PRK13898        447 GHTLIIGPTGAGKTVLM  463 (800)
T ss_pred             CEEEEECCCCCcHHHHH
Confidence            44677999999999865


No 407
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional
Probab=48.65  E-value=19  Score=28.68  Aligned_cols=17  Identities=12%  Similarity=0.128  Sum_probs=13.9

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      ..++-||+.|+|||.+.
T Consensus        37 ~~~Lf~GPpGtGKTTlA   53 (472)
T PRK14962         37 HAYIFAGPRGTGKTTVA   53 (472)
T ss_pred             eEEEEECCCCCCHHHHH
Confidence            45788999999999754


No 408
>KOG0739|consensus
Probab=48.65  E-value=8.4  Score=29.80  Aligned_cols=31  Identities=29%  Similarity=0.504  Sum_probs=21.4

Q ss_pred             HHHHHHH-HHHhhCCCc---EEEEeecCCCCCCce
Q psy12526         62 DALGRDI-LDNAFQGYN---ACIFAYGQTGEKTNY   92 (103)
Q Consensus        62 ~~~~~~l-v~~~~~G~n---~ti~aYGqtgSGKT~   92 (103)
                      +.++.|+ ..++|.|.-   ..|+-||+.|+||+|
T Consensus       147 EAVILPIKFPqlFtGkR~PwrgiLLyGPPGTGKSY  181 (439)
T KOG0739|consen  147 EAVILPIKFPQLFTGKRKPWRGILLYGPPGTGKSY  181 (439)
T ss_pred             hheeecccchhhhcCCCCcceeEEEeCCCCCcHHH
Confidence            3333443 345666654   568999999999998


No 409
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR. At least five distinct pathways exists for the catabolism of propionate by way of propionyl-CoA. Members of this family represent the transcriptional regulatory protein PrpR, whose gene is found in most cases divergently transcribed from an operon for the methylcitric acid cycle of propionate catabolism. 2-methylcitric acid, a catabolite by this pathway, is a coactivator of PrpR.
Probab=48.61  E-value=13  Score=30.00  Aligned_cols=20  Identities=15%  Similarity=0.390  Sum_probs=16.3

Q ss_pred             CCCcEEEEeecCCCCCCceE
Q psy12526         74 QGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~T   93 (103)
                      ...+..|+-+|++|+||+..
T Consensus       232 A~~~~pVLI~GE~GTGKe~l  251 (526)
T TIGR02329       232 ARSDATVLILGESGTGKELV  251 (526)
T ss_pred             hCCCCcEEEECCCCcCHHHH
Confidence            45577899999999999753


No 410
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily. Members of this protein family are the putative conjugative coupling factor, TraD (or TraG), rather distantly related to the well-characterized TraD of the F plasmid. Members are associated with conjugative-transposon-like mobile genetic elements of the class that includes SXT, an antibiotic resistance transfer element in some Vibrio cholerae strains.
Probab=48.58  E-value=5.9  Score=32.74  Aligned_cols=18  Identities=22%  Similarity=0.239  Sum_probs=14.0

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      +.=++..|.||+|||..+
T Consensus       176 ~~H~lv~G~TGsGKT~l~  193 (634)
T TIGR03743       176 VGHTLVLGTTGVGKTRLA  193 (634)
T ss_pred             CCcEEEECCCCCCHHHHH
Confidence            344567999999999765


No 411
>PRK00254 ski2-like helicase; Provisional
Probab=48.55  E-value=10  Score=31.44  Aligned_cols=20  Identities=15%  Similarity=0.125  Sum_probs=15.3

Q ss_pred             hhCCCcEEEEeecCCCCCCceE
Q psy12526         72 AFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        72 ~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +++|-|.  +...+||||||..
T Consensus        36 ~~~g~nv--lv~apTGsGKT~~   55 (720)
T PRK00254         36 VLEGKNL--VLAIPTASGKTLV   55 (720)
T ss_pred             HhCCCcE--EEECCCCcHHHHH
Confidence            4678775  4567999999964


No 412
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=48.49  E-value=6.4  Score=27.31  Aligned_cols=13  Identities=23%  Similarity=0.230  Sum_probs=10.4

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .--|.+|||||..
T Consensus        34 ~i~G~nGsGKSTL   46 (220)
T cd03293          34 ALVGPSGCGKSTL   46 (220)
T ss_pred             EEECCCCCCHHHH
Confidence            3469999999873


No 413
>TIGR00609 recB exodeoxyribonuclease V, beta subunit. All proteins in this family for which functions are known are DNA-DNA helicases that are used as part of an exonuclease-helicase complex (made up of RecBCD homologs) that function to generate substrates for the initiation of recombination and recombinational repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=48.35  E-value=3.9  Score=35.70  Aligned_cols=16  Identities=6%  Similarity=0.233  Sum_probs=12.1

Q ss_pred             EeecCCCCCCceEecc
Q psy12526         81 FAYGQTGEKTNYLLNG   96 (103)
Q Consensus        81 ~aYGqtgSGKT~Tm~G   96 (103)
                      +-=..-|+||||||..
T Consensus        13 lieAsAGtGKT~ti~~   28 (1087)
T TIGR00609        13 LIEASAGTGKTFTIAQ   28 (1087)
T ss_pred             EEEECCCCCHHHHHHH
Confidence            3445689999999863


No 414
>PRK13897 type IV secretion system component VirD4; Provisional
Probab=48.32  E-value=14  Score=30.55  Aligned_cols=18  Identities=11%  Similarity=0.130  Sum_probs=14.6

Q ss_pred             EEEEeecCCCCCCceEec
Q psy12526         78 ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~   95 (103)
                      .-++..|.||||||..+.
T Consensus       159 ~hvLviapTgSGKg~g~V  176 (606)
T PRK13897        159 QHALLFAPTGSGKGVGFV  176 (606)
T ss_pred             ceEEEEcCCCCCcceEEe
Confidence            347789999999998653


No 415
>PRK13850 type IV secretion system protein VirD4; Provisional
Probab=48.28  E-value=12  Score=31.16  Aligned_cols=21  Identities=10%  Similarity=-0.027  Sum_probs=16.3

Q ss_pred             CCcEEEEeecCCCCCCceEec
Q psy12526         75 GYNACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +-+.-++..|.||||||..+.
T Consensus       137 ~~~~hvlviApTgSGKgvg~V  157 (670)
T PRK13850        137 GEQPHSLVVAPTRAGKGVGVV  157 (670)
T ss_pred             CCCceEEEEecCCCCceeeeh
Confidence            334467889999999998764


No 416
>PLN03186 DNA repair protein RAD51 homolog; Provisional
Probab=48.26  E-value=23  Score=27.05  Aligned_cols=27  Identities=22%  Similarity=0.310  Sum_probs=19.0

Q ss_pred             HHHHHhhCC-C--cEEEEeecCCCCCCceE
Q psy12526         67 DILDNAFQG-Y--NACIFAYGQTGEKTNYL   93 (103)
Q Consensus        67 ~lv~~~~~G-~--n~ti~aYGqtgSGKT~T   93 (103)
                      +-++.++.| +  ...+..||..|+|||.-
T Consensus       110 ~~LD~lL~GG~~~g~i~~i~G~~g~GKT~l  139 (342)
T PLN03186        110 RELDKILEGGIETGSITEIYGEFRTGKTQL  139 (342)
T ss_pred             HHHHHhhcCCCcCceEEEEECCCCCCccHH
Confidence            446676664 3  34467899999999863


No 417
>TIGR02655 circ_KaiC circadian clock protein KaiC. Members of this family are the circadian clock protein KaiC, part of the kaiABC operon that controls circadian rhythm. It may be universal in Cyanobacteria. Each member has two copies of the KaiC domain (Pfam model pfam06745), which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor.
Probab=48.01  E-value=15  Score=29.06  Aligned_cols=27  Identities=30%  Similarity=0.434  Sum_probs=20.7

Q ss_pred             HHHHHHhhCC-C--cEEEEeecCCCCCCce
Q psy12526         66 RDILDNAFQG-Y--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        66 ~~lv~~~~~G-~--n~ti~aYGqtgSGKT~   92 (103)
                      -+-++.++.| +  ..+++-.|++|+|||.
T Consensus       249 i~~lD~~lgGG~~~gs~~li~G~~G~GKt~  278 (484)
T TIGR02655       249 VVRLDEMCGGGFFKDSIILATGATGTGKTL  278 (484)
T ss_pred             hHhHHHHhcCCccCCcEEEEECCCCCCHHH
Confidence            3556777765 3  5678899999999985


No 418
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=48.00  E-value=6.6  Score=28.93  Aligned_cols=13  Identities=15%  Similarity=0.266  Sum_probs=10.8

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|.+|||||..|
T Consensus        24 l~G~NGaGKSTLl   36 (302)
T TIGR01188        24 FLGPNGAGKTTTI   36 (302)
T ss_pred             EECCCCCCHHHHH
Confidence            4699999999854


No 419
>KOG0328|consensus
Probab=47.87  E-value=18  Score=27.70  Aligned_cols=25  Identities=16%  Similarity=0.304  Sum_probs=19.4

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      -+..++.|.++  .|-.|+|+|||-|.
T Consensus        57 Ai~~IlkGrdV--iaQaqSGTGKTa~~   81 (400)
T KOG0328|consen   57 AIPQILKGRDV--IAQAQSGTGKTATF   81 (400)
T ss_pred             hhhhhhcccce--EEEecCCCCceEEE
Confidence            34567889885  57789999998765


No 420
>PF00176 SNF2_N:  SNF2 family N-terminal domain;  InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g., ERCC6, RAD16, RAD5), DNA recombination (e.g., RAD54), and chromatin unwinding (e.g., ISWI) as well as a variety of other proteins with little functional information (e.g., lodestar, ETL1) [, ]. SNF2 functions as the ATPase component of the SNF2/SWI multisubunit complex, which utilises energy derived from ATP hydrolysis to disrupt histone-DNA interactions, resulting in the increased accessibility of DNA to transcription factors. Proteins that contain this domain appear to be distantly related to the DEAX box helicases IPR001410 from INTERPRO, however no helicase activity has ever been demonstrated for these proteins. ; GO: 0003677 DNA binding, 0005524 ATP binding; PDB: 1Z63_B 1Z3I_X 3DMQ_A 3MWY_W.
Probab=47.67  E-value=14  Score=26.29  Aligned_cols=22  Identities=9%  Similarity=-0.034  Sum_probs=14.0

Q ss_pred             CCCcEEEEeecCCCCCCceEecc
Q psy12526         74 QGYNACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm~G   96 (103)
                      ...+++|+|- ..|.|||.++.+
T Consensus        23 ~~~~g~lL~d-e~GlGKT~~~i~   44 (299)
T PF00176_consen   23 SPPRGGLLAD-EMGLGKTITAIA   44 (299)
T ss_dssp             TTT-EEEE----TTSSHHHHHHH
T ss_pred             cCCCCEEEEE-CCCCCchhhhhh
Confidence            5677777765 899999987653


No 421
>PF03969 AFG1_ATPase:  AFG1-like ATPase;  InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP. AFG1 also has substantial homology to these proteins outside the ATPase domain []. This family of proteins contains a P-loop motif.; GO: 0005524 ATP binding
Probab=47.38  E-value=7.1  Score=30.01  Aligned_cols=16  Identities=19%  Similarity=0.590  Sum_probs=13.7

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      -|.-||.-|.|||+-|
T Consensus        64 GlYl~G~vG~GKT~Lm   79 (362)
T PF03969_consen   64 GLYLWGPVGRGKTMLM   79 (362)
T ss_pred             eEEEECCCCCchhHHH
Confidence            4678999999999866


No 422
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=47.29  E-value=6.9  Score=26.73  Aligned_cols=13  Identities=23%  Similarity=0.381  Sum_probs=10.5

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      --.|.+|||||..
T Consensus        28 ~i~G~nGsGKSTL   40 (206)
T TIGR03608        28 AIIGESGSGKSTL   40 (206)
T ss_pred             EEECCCCCCHHHH
Confidence            3479999999973


No 423
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=47.27  E-value=6.9  Score=27.16  Aligned_cols=13  Identities=15%  Similarity=0.089  Sum_probs=10.6

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .-.|.+|||||..
T Consensus        30 ~i~G~nGsGKSTL   42 (220)
T cd03265          30 GLLGPNGAGKTTT   42 (220)
T ss_pred             EEECCCCCCHHHH
Confidence            3479999999973


No 424
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]
Probab=47.14  E-value=25  Score=28.36  Aligned_cols=22  Identities=27%  Similarity=0.335  Sum_probs=16.1

Q ss_pred             HHhhCCCcEEEEeecCCCCCCceE
Q psy12526         70 DNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        70 ~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      -.+.-|.|  ++-||.-|||||..
T Consensus       193 iAAAGgHn--Ll~~GpPGtGKTml  214 (490)
T COG0606         193 IAAAGGHN--LLLVGPPGTGKTML  214 (490)
T ss_pred             HHHhcCCc--EEEecCCCCchHHh
Confidence            33445666  67799999999764


No 425
>PF04665 Pox_A32:  Poxvirus A32 protein;  InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein. This is thought to be an ATPase involved in viral DNA packaging [].
Probab=47.13  E-value=7.4  Score=28.39  Aligned_cols=17  Identities=24%  Similarity=0.565  Sum_probs=12.5

Q ss_pred             CcEEEEeecCCCCCCceEe
Q psy12526         76 YNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        76 ~n~ti~aYGqtgSGKT~Tm   94 (103)
                      ++.+|  -|.+|||||..+
T Consensus        14 fr~vi--IG~sGSGKT~li   30 (241)
T PF04665_consen   14 FRMVI--IGKSGSGKTTLI   30 (241)
T ss_pred             ceEEE--ECCCCCCHHHHH
Confidence            45554  799999998643


No 426
>PRK07667 uridine kinase; Provisional
Probab=47.05  E-value=8.9  Score=26.36  Aligned_cols=18  Identities=6%  Similarity=-0.145  Sum_probs=13.4

Q ss_pred             CCcEEEEeecCCCCCCce
Q psy12526         75 GYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~   92 (103)
                      +--.-|.-.|..|||||+
T Consensus        15 ~~~~iIgI~G~~gsGKSt   32 (193)
T PRK07667         15 ENRFILGIDGLSRSGKTT   32 (193)
T ss_pred             CCCEEEEEECCCCCCHHH
Confidence            333455667999999997


No 427
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=46.91  E-value=7  Score=28.79  Aligned_cols=13  Identities=15%  Similarity=0.307  Sum_probs=10.7

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|.+|||||..|
T Consensus        35 l~G~NGaGKSTLl   47 (303)
T TIGR01288        35 LLGPNGAGKSTIA   47 (303)
T ss_pred             EECCCCCCHHHHH
Confidence            4699999999754


No 428
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=46.91  E-value=4.4  Score=28.07  Aligned_cols=12  Identities=17%  Similarity=0.279  Sum_probs=10.1

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      -.|.+|||||..
T Consensus        33 i~G~nGsGKSTL   44 (220)
T cd03263          33 LLGHNGAGKTTT   44 (220)
T ss_pred             EECCCCCCHHHH
Confidence            469999999973


No 429
>KOG0348|consensus
Probab=46.83  E-value=15  Score=30.35  Aligned_cols=23  Identities=22%  Similarity=0.288  Sum_probs=16.7

Q ss_pred             HHHHhhCCCcEEEEeecCCCCCCce
Q psy12526         68 ILDNAFQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        68 lv~~~~~G~n~ti~aYGqtgSGKT~   92 (103)
                      .|..+|+|-.+-  .-.|||||||-
T Consensus       167 ~IP~lL~grD~l--V~aQTGSGKTL  189 (708)
T KOG0348|consen  167 AIPVLLEGRDAL--VRAQTGSGKTL  189 (708)
T ss_pred             chhhhhcCcceE--EEcCCCCcccH
Confidence            344567788765  46799999984


No 430
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=46.75  E-value=4.4  Score=28.06  Aligned_cols=13  Identities=31%  Similarity=0.498  Sum_probs=10.6

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|.+|||||..|
T Consensus        35 i~G~nGsGKSTLl   47 (220)
T cd03245          35 IIGRVGSGKSTLL   47 (220)
T ss_pred             EECCCCCCHHHHH
Confidence            4699999999743


No 431
>KOG0652|consensus
Probab=46.59  E-value=10  Score=28.85  Aligned_cols=14  Identities=21%  Similarity=0.541  Sum_probs=11.8

Q ss_pred             EEEeecCCCCCCce
Q psy12526         79 CIFAYGQTGEKTNY   92 (103)
Q Consensus        79 ti~aYGqtgSGKT~   92 (103)
                      -++-||+.|+|||-
T Consensus       207 GvLmYGPPGTGKTl  220 (424)
T KOG0652|consen  207 GVLMYGPPGTGKTL  220 (424)
T ss_pred             ceEeeCCCCCcHHH
Confidence            36889999999973


No 432
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]
Probab=46.56  E-value=11  Score=30.26  Aligned_cols=18  Identities=17%  Similarity=0.350  Sum_probs=15.9

Q ss_pred             hCCCcEEEEeecCCCCCC
Q psy12526         73 FQGYNACIFAYGQTGEKT   90 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGK   90 (103)
                      +...++.|+-.|+||+||
T Consensus       160 vA~s~a~VLI~GESGtGK  177 (464)
T COG2204         160 VAPSDASVLITGESGTGK  177 (464)
T ss_pred             HhCCCCCEEEECCCCCcH
Confidence            456789999999999999


No 433
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=46.50  E-value=7.2  Score=26.75  Aligned_cols=13  Identities=23%  Similarity=0.294  Sum_probs=10.5

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .-.|.+|||||..
T Consensus        30 ~i~G~nGsGKSTL   42 (205)
T cd03226          30 ALTGKNGAGKTTL   42 (205)
T ss_pred             EEECCCCCCHHHH
Confidence            3479999999974


No 434
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=46.39  E-value=4.5  Score=27.87  Aligned_cols=12  Identities=25%  Similarity=0.324  Sum_probs=10.0

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      --|.+|||||..
T Consensus        32 l~G~nGsGKSTL   43 (204)
T PRK13538         32 IEGPNGAGKTSL   43 (204)
T ss_pred             EECCCCCCHHHH
Confidence            469999999873


No 435
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=46.34  E-value=4.5  Score=28.20  Aligned_cols=13  Identities=23%  Similarity=0.371  Sum_probs=10.4

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .--|.+|||||..
T Consensus        40 ~i~G~nGsGKSTL   52 (228)
T PRK10584         40 ALIGESGSGKSTL   52 (228)
T ss_pred             EEECCCCCCHHHH
Confidence            3469999999974


No 436
>PLN02748 tRNA dimethylallyltransferase
Probab=46.34  E-value=9.9  Score=30.38  Aligned_cols=15  Identities=20%  Similarity=0.361  Sum_probs=12.4

Q ss_pred             EEEEeecCCCCCCce
Q psy12526         78 ACIFAYGQTGEKTNY   92 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~   92 (103)
                      -.|+-.|.||||||.
T Consensus        23 ~~i~i~GptgsGKs~   37 (468)
T PLN02748         23 KVVVVMGPTGSGKSK   37 (468)
T ss_pred             CEEEEECCCCCCHHH
Confidence            356779999999985


No 437
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional
Probab=46.28  E-value=8.6  Score=30.61  Aligned_cols=19  Identities=16%  Similarity=0.340  Sum_probs=15.5

Q ss_pred             CCcEEEEeecCCCCCCceE
Q psy12526         75 GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+..|+-+|++|+||++.
T Consensus       208 ~~~~pVlI~Ge~GtGK~~~  226 (509)
T PRK05022        208 ASDLNVLILGETGVGKELV  226 (509)
T ss_pred             CCCCcEEEECCCCccHHHH
Confidence            4567788999999999763


No 438
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=46.18  E-value=6.7  Score=26.20  Aligned_cols=17  Identities=18%  Similarity=0.147  Sum_probs=13.6

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      ..|.-.|.+|+|||..+
T Consensus        19 ~~i~ivG~~~~GKStli   35 (179)
T TIGR03598        19 PEIAFAGRSNVGKSSLI   35 (179)
T ss_pred             CEEEEEcCCCCCHHHHH
Confidence            45677999999998754


No 439
>PRK02362 ski2-like helicase; Provisional
Probab=46.16  E-value=17  Score=30.34  Aligned_cols=20  Identities=20%  Similarity=0.199  Sum_probs=14.9

Q ss_pred             hhCCCcEEEEeecCCCCCCceE
Q psy12526         72 AFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        72 ~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +++|-|+  +.-.+||||||..
T Consensus        36 ~~~g~nv--lv~APTGSGKTli   55 (737)
T PRK02362         36 LLDGKNL--LAAIPTASGKTLI   55 (737)
T ss_pred             HhCCCcE--EEECCCcchHHHH
Confidence            4577774  4578999999864


No 440
>TIGR00678 holB DNA polymerase III, delta' subunit. At position 126-127 of the seed alignment, this family lacks the HM motif of gamma/tau; at 132 it has a near-invariant A vs. an invariant F in gamma/tau.
Probab=46.08  E-value=25  Score=23.72  Aligned_cols=22  Identities=18%  Similarity=0.215  Sum_probs=16.1

Q ss_pred             hhCC-CcEEEEeecCCCCCCceE
Q psy12526         72 AFQG-YNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        72 ~~~G-~n~ti~aYGqtgSGKT~T   93 (103)
                      +..| ..-+++-||+.|.|||..
T Consensus         8 i~~~~~~~~~L~~G~~G~gkt~~   30 (188)
T TIGR00678         8 LEKGRLAHAYLFAGPEGVGKELL   30 (188)
T ss_pred             HHcCCCCeEEEEECCCCCCHHHH
Confidence            3344 445777899999999864


No 441
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]
Probab=46.06  E-value=11  Score=27.69  Aligned_cols=12  Identities=25%  Similarity=0.457  Sum_probs=10.0

Q ss_pred             ecCCCCCCceEe
Q psy12526         83 YGQTGEKTNYLL   94 (103)
Q Consensus        83 YGqtgSGKT~Tm   94 (103)
                      -|++|+|||...
T Consensus        36 IGPNGAGKTTlf   47 (250)
T COG0411          36 IGPNGAGKTTLF   47 (250)
T ss_pred             ECCCCCCceeee
Confidence            499999999753


No 442
>COG1783 XtmB Phage terminase large subunit [General function prediction only]
Probab=46.00  E-value=9.4  Score=30.01  Aligned_cols=16  Identities=25%  Similarity=0.426  Sum_probs=14.0

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      ..+++|+.||+|||+.
T Consensus        26 ~~i~~G~rGS~KSy~~   41 (414)
T COG1783          26 YFIAKGGRGSSKSYAT   41 (414)
T ss_pred             EEEEEccCCCchhHHH
Confidence            4889999999999964


No 443
>cd01919 PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).
Probab=46.00  E-value=13  Score=30.04  Aligned_cols=18  Identities=17%  Similarity=0.300  Sum_probs=14.6

Q ss_pred             EEEeecCCCCCCceEecc
Q psy12526         79 CIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm~G   96 (103)
                      ++..+|.+|+|||.+-+.
T Consensus       219 ~~~~~GlSGtGKTTLa~~  236 (515)
T cd01919         219 VLVFFGLSGTGKTTLSMD  236 (515)
T ss_pred             EEEEEecccCCCcccccC
Confidence            677899999999976543


No 444
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional
Probab=45.87  E-value=9.1  Score=30.45  Aligned_cols=15  Identities=27%  Similarity=0.286  Sum_probs=13.3

Q ss_pred             EEEEeecCCCCCCce
Q psy12526         78 ACIFAYGQTGEKTNY   92 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~   92 (103)
                      ..|+-+|++|+|||.
T Consensus        51 ~~ILliGp~G~GKT~   65 (443)
T PRK05201         51 KNILMIGPTGVGKTE   65 (443)
T ss_pred             ceEEEECCCCCCHHH
Confidence            568899999999985


No 445
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated
Probab=45.85  E-value=6.6  Score=27.69  Aligned_cols=19  Identities=11%  Similarity=0.107  Sum_probs=16.3

Q ss_pred             EEEEeecCCCCCCceEecc
Q psy12526         78 ACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm~G   96 (103)
                      +.|..|+-+|.|||+..+|
T Consensus        23 g~v~v~~g~GkGKtt~a~g   41 (191)
T PRK05986         23 GLLIVHTGNGKGKSTAAFG   41 (191)
T ss_pred             CeEEEECCCCCChHHHHHH
Confidence            5788899999999997765


No 446
>PF08423 Rad51:  Rad51;  InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51. It is critical for DNA binding []. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain.; PDB: 2ZUC_A 2Z43_C 2ZUD_B 2DFL_A 2ZUB_A 2BKE_A 2KZ3_A 2CVH_B 2CVF_B 1SZP_D ....
Probab=45.53  E-value=7.4  Score=28.26  Aligned_cols=27  Identities=19%  Similarity=0.251  Sum_probs=18.8

Q ss_pred             HHHHHHhhCC-C--cEEEEeecCCCCCCce
Q psy12526         66 RDILDNAFQG-Y--NACIFAYGQTGEKTNY   92 (103)
Q Consensus        66 ~~lv~~~~~G-~--n~ti~aYGqtgSGKT~   92 (103)
                      -+-++.+|.| .  ....=-||+.|||||.
T Consensus        24 ~~~lD~~L~GGi~~g~itEi~G~~gsGKTq   53 (256)
T PF08423_consen   24 CKSLDELLGGGIPTGSITEIVGESGSGKTQ   53 (256)
T ss_dssp             SHHHHHHTTSSEETTSEEEEEESTTSSHHH
T ss_pred             CHHHHHhhCCCCCCCcEEEEEEecccccch
Confidence            3567888875 2  2233468999999985


No 447
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=45.48  E-value=7.6  Score=28.63  Aligned_cols=13  Identities=15%  Similarity=0.276  Sum_probs=10.8

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|++|+|||..|
T Consensus        33 l~G~NGaGKTTLl   45 (301)
T TIGR03522        33 FLGPNGAGKSTTM   45 (301)
T ss_pred             EECCCCCCHHHHH
Confidence            4699999999854


No 448
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=45.45  E-value=4.8  Score=27.84  Aligned_cols=12  Identities=25%  Similarity=0.340  Sum_probs=10.0

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      --|.+|||||..
T Consensus        33 i~G~nGsGKSTL   44 (207)
T PRK13539         33 LTGPNGSGKTTL   44 (207)
T ss_pred             EECCCCCCHHHH
Confidence            369999999974


No 449
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=45.38  E-value=4.8  Score=28.32  Aligned_cols=12  Identities=25%  Similarity=0.398  Sum_probs=10.0

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      --|.+|||||.-
T Consensus        32 i~G~nGsGKSTL   43 (236)
T TIGR03864        32 LLGPNGAGKSTL   43 (236)
T ss_pred             EECCCCCCHHHH
Confidence            369999999873


No 450
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=45.32  E-value=7.7  Score=26.11  Aligned_cols=12  Identities=25%  Similarity=0.432  Sum_probs=10.1

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      --|++|||||.-
T Consensus        31 i~G~nGsGKSTL   42 (178)
T cd03229          31 LLGPSGSGKSTL   42 (178)
T ss_pred             EECCCCCCHHHH
Confidence            369999999974


No 451
>PLN02840 tRNA dimethylallyltransferase
Probab=45.31  E-value=11  Score=29.82  Aligned_cols=15  Identities=33%  Similarity=0.423  Sum_probs=12.4

Q ss_pred             EEEeecCCCCCCceE
Q psy12526         79 CIFAYGQTGEKTNYL   93 (103)
Q Consensus        79 ti~aYGqtgSGKT~T   93 (103)
                      .|+-.|.||||||..
T Consensus        23 vi~I~GptgsGKTtl   37 (421)
T PLN02840         23 VIVISGPTGAGKSRL   37 (421)
T ss_pred             EEEEECCCCCCHHHH
Confidence            466789999999864


No 452
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=45.23  E-value=7.8  Score=29.50  Aligned_cols=12  Identities=25%  Similarity=0.415  Sum_probs=10.4

Q ss_pred             ecCCCCCCceEe
Q psy12526         83 YGQTGEKTNYLL   94 (103)
Q Consensus        83 YGqtgSGKT~Tm   94 (103)
                      .|.+|||||..|
T Consensus        38 lGpsGsGKSTLL   49 (351)
T PRK11432         38 LGPSGCGKTTVL   49 (351)
T ss_pred             ECCCCCcHHHHH
Confidence            699999999854


No 453
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of Ser-46 of HPr and its dephosphorylation by phosphorolysis. The latter reaction uses inorganic phosphate as substrate and produces pyrophosphate. Phosphoenolpyruvate carboxykinase (PEPCK) and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting these two phosphotransferases have related functions.  The HprK/P N-terminal domain is structurally similar to the N-terminal domains of the MurE and MurF amino acid ligases.
Probab=45.22  E-value=15  Score=24.75  Aligned_cols=18  Identities=17%  Similarity=0.169  Sum_probs=14.3

Q ss_pred             CcEEEEeecCCCCCCceE
Q psy12526         76 YNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        76 ~n~ti~aYGqtgSGKT~T   93 (103)
                      ++..|+-.|.+|+|||.+
T Consensus        13 ~g~gvLi~G~sG~GKStl   30 (149)
T cd01918          13 GGIGVLITGPSGIGKSEL   30 (149)
T ss_pred             CCEEEEEEcCCCCCHHHH
Confidence            456678899999999843


No 454
>PRK10263 DNA translocase FtsK; Provisional
Probab=45.20  E-value=7.3  Score=34.96  Aligned_cols=16  Identities=19%  Similarity=0.283  Sum_probs=13.2

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      -++..|.||||||..|
T Consensus      1012 HLLIAGaTGSGKSv~L 1027 (1355)
T PRK10263       1012 HLLVAGTTGSGKSVGV 1027 (1355)
T ss_pred             cEEEecCCCCCHHHHH
Confidence            4678999999999754


No 455
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=45.13  E-value=7.7  Score=29.53  Aligned_cols=13  Identities=31%  Similarity=0.409  Sum_probs=10.9

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|++|||||..|
T Consensus        35 l~GpsGsGKSTLL   47 (353)
T TIGR03265        35 LLGPSGCGKTTLL   47 (353)
T ss_pred             EECCCCCCHHHHH
Confidence            4799999999854


No 456
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=45.09  E-value=7.8  Score=26.25  Aligned_cols=12  Identities=25%  Similarity=0.398  Sum_probs=10.1

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      --|.+|||||..
T Consensus        23 i~G~nGsGKSTL   34 (190)
T TIGR01166        23 LLGANGAGKSTL   34 (190)
T ss_pred             EECCCCCCHHHH
Confidence            469999999974


No 457
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=45.02  E-value=12  Score=25.76  Aligned_cols=14  Identities=14%  Similarity=0.264  Sum_probs=11.2

Q ss_pred             EEEeecCCCCCCce
Q psy12526         79 CIFAYGQTGEKTNY   92 (103)
Q Consensus        79 ti~aYGqtgSGKT~   92 (103)
                      .+.-.|++|||||.
T Consensus        25 ~~~i~G~nGsGKST   38 (214)
T cd03297          25 VTGIFGASGAGKST   38 (214)
T ss_pred             eEEEECCCCCCHHH
Confidence            34557999999986


No 458
>KOG1514|consensus
Probab=44.96  E-value=34  Score=29.06  Aligned_cols=30  Identities=20%  Similarity=0.439  Sum_probs=22.2

Q ss_pred             HHHHHhhC--CCcEEEEeecCCCCCCceEecc
Q psy12526         67 DILDNAFQ--GYNACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        67 ~lv~~~~~--G~n~ti~aYGqtgSGKT~Tm~G   96 (103)
                      ..++.++.  |-.+|+..-|.-|+|||.|+..
T Consensus       410 ~f~~~~i~~~~~g~~mYIsGvPGtGKT~tV~~  441 (767)
T KOG1514|consen  410 DFLRSFISDQGLGSCMYISGVPGTGKTATVLE  441 (767)
T ss_pred             HHHHhhcCCCCCceeEEEecCCCCCceehHHH
Confidence            44444443  6667888889999999999753


No 459
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=44.89  E-value=13  Score=25.96  Aligned_cols=14  Identities=14%  Similarity=0.157  Sum_probs=11.1

Q ss_pred             EEeecCCCCCCceE
Q psy12526         80 IFAYGQTGEKTNYL   93 (103)
Q Consensus        80 i~aYGqtgSGKT~T   93 (103)
                      +.-.|.+|||||.-
T Consensus        29 ~~l~G~nGsGKSTL   42 (232)
T cd03218          29 VGLLGPNGAGKTTT   42 (232)
T ss_pred             EEEECCCCCCHHHH
Confidence            34579999999974


No 460
>KOG1970|consensus
Probab=44.83  E-value=30  Score=28.69  Aligned_cols=44  Identities=9%  Similarity=0.083  Sum_probs=26.0

Q ss_pred             CCCCCHHHHHHHHHHHHHH------HhhCCCc-EEEEeecCCCCCCceEec
Q psy12526         52 PNFASQEKVFDALGRDILD------NAFQGYN-ACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        52 ~~~~~q~~v~~~~~~~lv~------~~~~G~n-~ti~aYGqtgSGKT~Tm~   95 (103)
                      |....+-.|+..-+..+=+      .+..+.- -.++--|++|+|||.|+.
T Consensus        78 P~t~eeLAVHkkKI~eVk~WL~~~~~~~~~l~~~iLLltGPsGcGKSTtvk  128 (634)
T KOG1970|consen   78 PRTLEELAVHKKKISEVKQWLKQVAEFTPKLGSRILLLTGPSGCGKSTTVK  128 (634)
T ss_pred             cccHHHHhhhHHhHHHHHHHHHHHHHhccCCCceEEEEeCCCCCCchhHHH
Confidence            4555566677655433222      2233443 245667999999999863


No 461
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=44.68  E-value=7.9  Score=27.10  Aligned_cols=12  Identities=25%  Similarity=0.407  Sum_probs=10.1

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      -.|.+|||||..
T Consensus        32 i~G~nGsGKSTL   43 (241)
T cd03256          32 LIGPSGAGKSTL   43 (241)
T ss_pred             EECCCCCCHHHH
Confidence            469999999874


No 462
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=44.62  E-value=9.8  Score=29.08  Aligned_cols=12  Identities=25%  Similarity=0.562  Sum_probs=10.2

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      -||.+|||||.-
T Consensus        29 lFG~SGsGKTsl   40 (352)
T COG4148          29 LFGPSGSGKTSL   40 (352)
T ss_pred             EecCCCCChhhH
Confidence            389999999974


No 463
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=44.60  E-value=8  Score=26.58  Aligned_cols=13  Identities=15%  Similarity=0.089  Sum_probs=10.6

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .--|.+|||||.-
T Consensus        30 ~i~G~nGsGKSTL   42 (210)
T cd03269          30 GLLGPNGAGKTTT   42 (210)
T ss_pred             EEECCCCCCHHHH
Confidence            4479999999974


No 464
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA. This protein contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, pfam03389) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, TIGR02760). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer.
Probab=44.54  E-value=13  Score=31.29  Aligned_cols=27  Identities=11%  Similarity=0.231  Sum_probs=18.0

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceEecc
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYLLNG   96 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~Tm~G   96 (103)
                      +..++.+ +-.++--|..|+|||++|-.
T Consensus       361 v~~i~~s-~~~~il~G~aGTGKTtll~~  387 (744)
T TIGR02768       361 VRHVTGS-GDIAVVVGRAGTGKSTMLKA  387 (744)
T ss_pred             HHHHhcC-CCEEEEEecCCCCHHHHHHH
Confidence            3444544 23455789999999987643


No 465
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=44.41  E-value=5  Score=27.09  Aligned_cols=12  Identities=25%  Similarity=0.410  Sum_probs=10.1

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      --|.+|||||.-
T Consensus        30 l~G~nGsGKStL   41 (180)
T cd03214          30 ILGPNGAGKSTL   41 (180)
T ss_pred             EECCCCCCHHHH
Confidence            469999999974


No 466
>PRK06645 DNA polymerase III subunits gamma and tau; Validated
Probab=44.40  E-value=22  Score=28.68  Aligned_cols=17  Identities=12%  Similarity=0.006  Sum_probs=14.2

Q ss_pred             EEEEeecCCCCCCceEe
Q psy12526         78 ACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        78 ~ti~aYGqtgSGKT~Tm   94 (103)
                      -.++-+|..|+|||.+.
T Consensus        44 ~a~Lf~Gp~G~GKTT~A   60 (507)
T PRK06645         44 GGYLLTGIRGVGKTTSA   60 (507)
T ss_pred             ceEEEECCCCCCHHHHH
Confidence            46788999999999753


No 467
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=44.38  E-value=5  Score=26.30  Aligned_cols=14  Identities=29%  Similarity=0.328  Sum_probs=11.0

Q ss_pred             EeecCCCCCCceEe
Q psy12526         81 FAYGQTGEKTNYLL   94 (103)
Q Consensus        81 ~aYGqtgSGKT~Tm   94 (103)
                      .--|.+|+|||.-+
T Consensus        30 ~i~G~nGsGKStLl   43 (144)
T cd03221          30 GLVGRNGAGKSTLL   43 (144)
T ss_pred             EEECCCCCCHHHHH
Confidence            34799999999743


No 468
>PRK13700 conjugal transfer protein TraD; Provisional
Probab=44.34  E-value=7.2  Score=32.90  Aligned_cols=16  Identities=13%  Similarity=0.254  Sum_probs=13.1

Q ss_pred             EEeecCCCCCCceEec
Q psy12526         80 IFAYGQTGEKTNYLLN   95 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm~   95 (103)
                      ++..|.||||||..|.
T Consensus       188 ~li~GttGSGKS~~i~  203 (732)
T PRK13700        188 FCLHGTVGAGKSEVIR  203 (732)
T ss_pred             eEEeCCCCCCHHHHHH
Confidence            4668999999998764


No 469
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=44.29  E-value=5.5  Score=30.35  Aligned_cols=13  Identities=31%  Similarity=0.391  Sum_probs=10.8

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|.+|||||..+
T Consensus        35 llG~sGsGKSTLL   47 (356)
T PRK11650         35 LVGPSGCGKSTLL   47 (356)
T ss_pred             EECCCCCcHHHHH
Confidence            3799999999854


No 470
>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family. Members of this protein are assigned by homology to the TraD family of conjugative coupling factor. This particular clade serves as a marker for an extended gene region that occurs occasionally on plasmids, including the toluene catabolism TOL plasmid. More commonly, the gene region is chromosomal, flanked by various markers of conjugative transfer and insertion.
Probab=44.09  E-value=11  Score=31.44  Aligned_cols=15  Identities=20%  Similarity=0.184  Sum_probs=12.6

Q ss_pred             EEeecCCCCCCceEe
Q psy12526         80 IFAYGQTGEKTNYLL   94 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm   94 (103)
                      .+..|.||+|||-.+
T Consensus       183 tlV~GtTGsGKT~l~  197 (643)
T TIGR03754       183 TLVLGTTRVGKTRLA  197 (643)
T ss_pred             eEEECCCCCCHHHHH
Confidence            457899999999765


No 471
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=44.07  E-value=13  Score=25.60  Aligned_cols=13  Identities=23%  Similarity=0.322  Sum_probs=10.5

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .-.|.+|||||..
T Consensus        34 ~l~G~nGsGKSTL   46 (218)
T cd03255          34 AIVGPSGSGKSTL   46 (218)
T ss_pred             EEEcCCCCCHHHH
Confidence            3479999999963


No 472
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=44.02  E-value=8.1  Score=29.72  Aligned_cols=14  Identities=29%  Similarity=0.335  Sum_probs=11.4

Q ss_pred             EeecCCCCCCceEe
Q psy12526         81 FAYGQTGEKTNYLL   94 (103)
Q Consensus        81 ~aYGqtgSGKT~Tm   94 (103)
                      --.|.+|||||..|
T Consensus        49 ~llGpsGsGKSTLL   62 (377)
T PRK11607         49 ALLGASGCGKSTLL   62 (377)
T ss_pred             EEECCCCCcHHHHH
Confidence            34799999999864


No 473
>PRK10876 recB exonuclease V subunit beta; Provisional
Probab=43.98  E-value=5  Score=35.45  Aligned_cols=13  Identities=8%  Similarity=0.281  Sum_probs=10.6

Q ss_pred             ecCCCCCCceEec
Q psy12526         83 YGQTGEKTNYLLN   95 (103)
Q Consensus        83 YGqtgSGKT~Tm~   95 (103)
                      =..-|+|||||+.
T Consensus        23 EASAGTGKTyTIa   35 (1181)
T PRK10876         23 EASAGTGKTFTIA   35 (1181)
T ss_pred             EeCCCCcHHHHHH
Confidence            3467999999986


No 474
>CHL00095 clpC Clp protease ATP binding subunit
Probab=43.96  E-value=33  Score=29.14  Aligned_cols=36  Identities=25%  Similarity=0.266  Sum_probs=21.5

Q ss_pred             CHHHHHHHHHHHHHHHhhCCC------cEEEEeecCCCCCCce
Q psy12526         56 SQEKVFDALGRDILDNAFQGY------NACIFAYGQTGEKTNY   92 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~------n~ti~aYGqtgSGKT~   92 (103)
                      .|++.-..+..-+ .....|.      -+.++-+|++|+|||+
T Consensus       513 GQ~~ai~~l~~~i-~~~~~gl~~~~~p~~~~lf~Gp~GvGKt~  554 (821)
T CHL00095        513 GQDEAVVAVSKAI-RRARVGLKNPNRPIASFLFSGPTGVGKTE  554 (821)
T ss_pred             ChHHHHHHHHHHH-HHHhhcccCCCCCceEEEEECCCCCcHHH
Confidence            5665555554333 3323333      2455669999999996


No 475
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=43.91  E-value=14  Score=24.01  Aligned_cols=18  Identities=17%  Similarity=0.261  Sum_probs=14.1

Q ss_pred             cEEEEeecCCCCCCceEe
Q psy12526         77 NACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm   94 (103)
                      ...|.-.|..|+|||.-+
T Consensus        14 ~~~v~i~G~~g~GKStLl   31 (173)
T cd04155          14 EPRILILGLDNAGKTTIL   31 (173)
T ss_pred             ccEEEEEccCCCCHHHHH
Confidence            456778999999998643


No 476
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=43.83  E-value=8.4  Score=27.02  Aligned_cols=13  Identities=23%  Similarity=0.332  Sum_probs=10.5

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .-.|.+|||||..
T Consensus        30 ~l~G~nGsGKSTL   42 (235)
T cd03261          30 AIIGPSGSGKSTL   42 (235)
T ss_pred             EEECCCCCCHHHH
Confidence            3479999999973


No 477
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]
Probab=43.83  E-value=8.6  Score=28.12  Aligned_cols=13  Identities=31%  Similarity=0.503  Sum_probs=11.0

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      --|.+|+|||.+|
T Consensus        34 llG~NGaGKTTlL   46 (237)
T COG0410          34 LLGRNGAGKTTLL   46 (237)
T ss_pred             EECCCCCCHHHHH
Confidence            3799999999865


No 478
>TIGR00634 recN DNA repair protein RecN. All proteins in this family for which functions are known are ATP binding proteins involved in the initiation of recombination and recombinational repair.
Probab=43.82  E-value=12  Score=30.26  Aligned_cols=18  Identities=22%  Similarity=0.525  Sum_probs=13.2

Q ss_pred             CCCcEEEEeecCCCCCCceEe
Q psy12526         74 QGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        74 ~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .|+|+   -.|.||+|||-.|
T Consensus        22 ~g~~v---itG~nGaGKS~ll   39 (563)
T TIGR00634        22 RGLTV---LTGETGAGKSMII   39 (563)
T ss_pred             CCeEE---EECCCCCCHHHHH
Confidence            46554   4899999998543


No 479
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=43.69  E-value=15  Score=29.08  Aligned_cols=29  Identities=28%  Similarity=0.336  Sum_probs=21.0

Q ss_pred             HHHHHhhC-CC--cEEEEeecCCCCCCceEec
Q psy12526         67 DILDNAFQ-GY--NACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        67 ~lv~~~~~-G~--n~ti~aYGqtgSGKT~Tm~   95 (103)
                      +-++.++. |+  ...++-+|..|+|||..++
T Consensus        81 ~~LD~vLgGGi~~GsvilI~G~pGsGKTTL~l  112 (454)
T TIGR00416        81 GELDRVLGGGIVPGSLILIGGDPGIGKSTLLL  112 (454)
T ss_pred             HHHHHHhcCCccCCeEEEEEcCCCCCHHHHHH
Confidence            45677775 33  5677889999999997543


No 480
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional
Probab=43.65  E-value=23  Score=28.52  Aligned_cols=20  Identities=15%  Similarity=0.114  Sum_probs=15.3

Q ss_pred             CCCcE-EEEeecCCCCCCceE
Q psy12526         74 QGYNA-CIFAYGQTGEKTNYL   93 (103)
Q Consensus        74 ~G~n~-ti~aYGqtgSGKT~T   93 (103)
                      .|.-. .++-+|..|+|||.+
T Consensus        31 ~~ri~ha~Lf~Gp~G~GKTT~   51 (491)
T PRK14964         31 LNKIPQSILLVGASGVGKTTC   51 (491)
T ss_pred             cCCCCceEEEECCCCccHHHH
Confidence            34433 688899999999974


No 481
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=43.62  E-value=9.3  Score=26.58  Aligned_cols=16  Identities=19%  Similarity=0.196  Sum_probs=12.3

Q ss_pred             EEEeecCCCCCCceEe
Q psy12526         79 CIFAYGQTGEKTNYLL   94 (103)
Q Consensus        79 ti~aYGqtgSGKT~Tm   94 (103)
                      .+.--|++|+|||..|
T Consensus        27 ~~~ltGpNg~GKSTll   42 (199)
T cd03283          27 GILITGSNMSGKSTFL   42 (199)
T ss_pred             EEEEECCCCCChHHHH
Confidence            3456799999999754


No 482
>PRK04220 2-phosphoglycerate kinase; Provisional
Probab=43.61  E-value=27  Score=26.36  Aligned_cols=17  Identities=24%  Similarity=0.173  Sum_probs=14.8

Q ss_pred             CcEEEEeecCCCCCCce
Q psy12526         76 YNACIFAYGQTGEKTNY   92 (103)
Q Consensus        76 ~n~ti~aYGqtgSGKT~   92 (103)
                      ....|+..|.+|||||.
T Consensus        91 ~p~iIlI~G~sgsGKSt  107 (301)
T PRK04220         91 EPIIILIGGASGVGTST  107 (301)
T ss_pred             CCEEEEEECCCCCCHHH
Confidence            45789999999999986


No 483
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=43.58  E-value=5.1  Score=30.06  Aligned_cols=12  Identities=17%  Similarity=0.318  Sum_probs=10.1

Q ss_pred             eecCCCCCCceE
Q psy12526         82 AYGQTGEKTNYL   93 (103)
Q Consensus        82 aYGqtgSGKT~T   93 (103)
                      --|.+|||||..
T Consensus        38 lvG~sGsGKSTL   49 (326)
T PRK11022         38 IVGESGSGKSVS   49 (326)
T ss_pred             EECCCCChHHHH
Confidence            359999999875


No 484
>KOG2228|consensus
Probab=43.32  E-value=49  Score=25.99  Aligned_cols=35  Identities=17%  Similarity=0.360  Sum_probs=24.3

Q ss_pred             CHHHHHHHHHHHHHHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         56 SQEKVFDALGRDILDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        56 ~q~~v~~~~~~~lv~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      .|..++.-+-    ..++.|=.-.++--|+.|||||+-+
T Consensus        32 ~~~~l~~~lk----qt~~~gEsnsviiigprgsgkT~li   66 (408)
T KOG2228|consen   32 EQKHLSELLK----QTILHGESNSVIIIGPRGSGKTILI   66 (408)
T ss_pred             HHHHHHHHHH----HHHHhcCCCceEEEccCCCCceEee
Confidence            4555554332    4466777667888999999999854


No 485
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF. Members of this protein family are PspF, the sigma-54-dependent transcriptional activator of the phage shock protein (psp) operon, in Escherichia coli and numerous other species. The psp operon is induced by a number of stress conditions, including heat shock, ethanol, and filamentous phage infection. Changed com_name to adhere to TIGR role notes conventions. 09/15/06 - DMH
Probab=43.14  E-value=9.8  Score=28.67  Aligned_cols=19  Identities=11%  Similarity=0.314  Sum_probs=15.4

Q ss_pred             CCcEEEEeecCCCCCCceE
Q psy12526         75 GYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        75 G~n~ti~aYGqtgSGKT~T   93 (103)
                      ..+.-|+-+|++|+||++.
T Consensus        20 ~~~~pVLI~GE~GtGK~~l   38 (329)
T TIGR02974        20 PLDRPVLIIGERGTGKELI   38 (329)
T ss_pred             CCCCCEEEECCCCChHHHH
Confidence            4566788899999999763


No 486
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=43.11  E-value=7.7  Score=26.64  Aligned_cols=14  Identities=21%  Similarity=0.162  Sum_probs=10.9

Q ss_pred             EEeecCCCCCCceE
Q psy12526         80 IFAYGQTGEKTNYL   93 (103)
Q Consensus        80 i~aYGqtgSGKT~T   93 (103)
                      +--.|++|||||..
T Consensus        28 ~~l~G~nGsGKSTL   41 (177)
T cd03222          28 IGIVGPNGTGKTTA   41 (177)
T ss_pred             EEEECCCCChHHHH
Confidence            33479999999874


No 487
>COG1866 PckA Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion]
Probab=43.09  E-value=19  Score=29.08  Aligned_cols=21  Identities=19%  Similarity=0.351  Sum_probs=16.2

Q ss_pred             EEEeecCCCCCCce-------EeccCCC
Q psy12526         79 CIFAYGQTGEKTNY-------LLNGNGP   99 (103)
Q Consensus        79 ti~aYGqtgSGKT~-------Tm~G~~~   99 (103)
                      ..+-+|-+|+|||.       +++|+++
T Consensus       229 valFFGLSGTGKTTLSaDp~R~LIGDDE  256 (529)
T COG1866         229 VALFFGLSGTGKTTLSADPHRRLIGDDE  256 (529)
T ss_pred             eEEEEeccCCCcceeccCCccccccCcc
Confidence            35679999999986       5667664


No 488
>PHA02558 uvsW UvsW helicase; Provisional
Probab=43.07  E-value=21  Score=28.37  Aligned_cols=24  Identities=4%  Similarity=0.022  Sum_probs=16.4

Q ss_pred             HHHhhCCCcEEEEeecCCCCCCceEe
Q psy12526         69 LDNAFQGYNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        69 v~~~~~G~n~ti~aYGqtgSGKT~Tm   94 (103)
                      +..++++-++  +...+||+|||.++
T Consensus       123 v~~~l~~~~~--il~apTGsGKT~i~  146 (501)
T PHA02558        123 VYEGLKNNRR--LLNLPTSAGKSLIQ  146 (501)
T ss_pred             HHHHHhcCce--EEEeCCCCCHHHHH
Confidence            3445555554  45789999999754


No 489
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=43.02  E-value=8.7  Score=26.93  Aligned_cols=13  Identities=23%  Similarity=0.332  Sum_probs=10.5

Q ss_pred             EeecCCCCCCceE
Q psy12526         81 FAYGQTGEKTNYL   93 (103)
Q Consensus        81 ~aYGqtgSGKT~T   93 (103)
                      .--|.+|||||..
T Consensus        39 ~l~G~nGsGKSTL   51 (233)
T PRK11629         39 AIVGSSGSGKSTL   51 (233)
T ss_pred             EEECCCCCCHHHH
Confidence            3479999999974


No 490
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=42.88  E-value=8.8  Score=27.55  Aligned_cols=14  Identities=21%  Similarity=0.202  Sum_probs=11.0

Q ss_pred             EEeecCCCCCCceE
Q psy12526         80 IFAYGQTGEKTNYL   93 (103)
Q Consensus        80 i~aYGqtgSGKT~T   93 (103)
                      +--.|.+|||||..
T Consensus        28 ~~i~G~NGsGKSTL   41 (246)
T cd03237          28 IGILGPNGIGKTTF   41 (246)
T ss_pred             EEEECCCCCCHHHH
Confidence            34579999999974


No 491
>PRK13876 conjugal transfer coupling protein TraG; Provisional
Probab=42.85  E-value=18  Score=30.20  Aligned_cols=19  Identities=11%  Similarity=0.079  Sum_probs=15.8

Q ss_pred             CcEEEEeecCCCCCCceEe
Q psy12526         76 YNACIFAYGQTGEKTNYLL   94 (103)
Q Consensus        76 ~n~ti~aYGqtgSGKT~Tm   94 (103)
                      -+.-++++|.||||||-.+
T Consensus       143 g~~hvLviApTrSGKgvg~  161 (663)
T PRK13876        143 GPEHVLCFAPTRSGKGVGL  161 (663)
T ss_pred             CCceEEEEecCCCCcceeE
Confidence            3567889999999999765


No 492
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA. Designed to identify pcrA members of the uvrD/rep subfamily.
Probab=42.84  E-value=9  Score=31.79  Aligned_cols=19  Identities=11%  Similarity=0.230  Sum_probs=15.4

Q ss_pred             cEEEEeecCCCCCCceEec
Q psy12526         77 NACIFAYGQTGEKTNYLLN   95 (103)
Q Consensus        77 n~ti~aYGqtgSGKT~Tm~   95 (103)
                      ++-++..|--|||||.||.
T Consensus        17 ~g~~lV~AgaGSGKT~~l~   35 (726)
T TIGR01073        17 EGPLLIMAGAGSGKTRVLT   35 (726)
T ss_pred             CCCEEEEeCCCCCHHHHHH
Confidence            3457788999999999875


No 493
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]
Probab=42.79  E-value=25  Score=27.68  Aligned_cols=20  Identities=15%  Similarity=0.306  Sum_probs=14.8

Q ss_pred             hCCCcEEEEeecCCCCCCce
Q psy12526         73 FQGYNACIFAYGQTGEKTNY   92 (103)
Q Consensus        73 ~~G~n~ti~aYGqtgSGKT~   92 (103)
                      +......|+-+|+||+||..
T Consensus        97 ~ap~~~~vLi~GetGtGKel  116 (403)
T COG1221          97 YAPSGLPVLIIGETGTGKEL  116 (403)
T ss_pred             hCCCCCcEEEecCCCccHHH
Confidence            44444557779999999975


No 494
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=42.74  E-value=14  Score=25.28  Aligned_cols=11  Identities=18%  Similarity=0.311  Sum_probs=9.7

Q ss_pred             eecCCCCCCce
Q psy12526         82 AYGQTGEKTNY   92 (103)
Q Consensus        82 aYGqtgSGKT~   92 (103)
                      -.|.+|||||.
T Consensus        32 i~G~nGsGKST   42 (214)
T cd03292          32 LVGPSGAGKST   42 (214)
T ss_pred             EECCCCCCHHH
Confidence            47999999986


No 495
>TIGR00611 recf recF protein. All proteins in this family for which functions are known are DNA binding proteins that assist the filamentation of RecA onto DNA for the initiation of recombination or recombinational repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=42.74  E-value=10  Score=29.10  Aligned_cols=14  Identities=29%  Similarity=0.465  Sum_probs=11.3

Q ss_pred             EeecCCCCCCceEe
Q psy12526         81 FAYGQTGEKTNYLL   94 (103)
Q Consensus        81 ~aYGqtgSGKT~Tm   94 (103)
                      +-+|++|+|||..+
T Consensus        27 vi~G~NGsGKT~lL   40 (365)
T TIGR00611        27 VIVGPNGQGKTNLL   40 (365)
T ss_pred             EEECCCCCCHHHHH
Confidence            35999999998744


No 496
>PRK00064 recF recombination protein F; Reviewed
Probab=42.72  E-value=10  Score=28.94  Aligned_cols=14  Identities=29%  Similarity=0.501  Sum_probs=11.2

Q ss_pred             EeecCCCCCCceEe
Q psy12526         81 FAYGQTGEKTNYLL   94 (103)
Q Consensus        81 ~aYGqtgSGKT~Tm   94 (103)
                      +-+|++|+|||-.+
T Consensus        27 ~i~G~NgsGKT~ll   40 (361)
T PRK00064         27 VLVGENGQGKTNLL   40 (361)
T ss_pred             EEECCCCCCHHHHH
Confidence            35899999998643


No 497
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=42.64  E-value=8.7  Score=29.56  Aligned_cols=13  Identities=23%  Similarity=0.353  Sum_probs=10.8

Q ss_pred             eecCCCCCCceEe
Q psy12526         82 AYGQTGEKTNYLL   94 (103)
Q Consensus        82 aYGqtgSGKT~Tm   94 (103)
                      -.|.+|||||..|
T Consensus        45 LlGpsGsGKSTLL   57 (375)
T PRK09452         45 LLGPSGCGKTTVL   57 (375)
T ss_pred             EECCCCCcHHHHH
Confidence            4799999999754


No 498
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit. This model describes the aerobic cobalamin pathway Pseudomonas denitrificans CobS gene product, which is a cobalt chelatase subunit, with a MW ~37 kDa. The aerobic pathway cobalt chelatase is a heterotrimeric, ATP-dependent enzyme that catalyzes cobalt insertion during cobalamin biosynthesis. The other two subunits are the P. denitrificans CobT (TIGR01651) and CobN (pfam02514 CobN/Magnesium Chelatase) proteins. To avoid potential confusion with the nonhomologous Salmonella typhimurium/E.coli cobS gene product, the P. denitrificans gene symbol is not used in the name of this model.
Probab=42.58  E-value=11  Score=28.68  Aligned_cols=26  Identities=12%  Similarity=0.083  Sum_probs=17.2

Q ss_pred             HHHHHHhhCCCcEEEEeecCCCCCCceE
Q psy12526         66 RDILDNAFQGYNACIFAYGQTGEKTNYL   93 (103)
Q Consensus        66 ~~lv~~~~~G~n~ti~aYGqtgSGKT~T   93 (103)
                      +.++..+..+  .-|+-.|.+|+|||..
T Consensus        55 ~~vl~~l~~~--~~ilL~G~pGtGKTtl   80 (327)
T TIGR01650        55 KAICAGFAYD--RRVMVQGYHGTGKSTH   80 (327)
T ss_pred             HHHHHHHhcC--CcEEEEeCCCChHHHH
Confidence            3344444434  3477799999999864


No 499
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=42.57  E-value=5.7  Score=28.93  Aligned_cols=14  Identities=14%  Similarity=0.223  Sum_probs=10.9

Q ss_pred             EeecCCCCCCceEe
Q psy12526         81 FAYGQTGEKTNYLL   94 (103)
Q Consensus        81 ~aYGqtgSGKT~Tm   94 (103)
                      --.|.+|||||..+
T Consensus        37 ~i~G~nGsGKSTLl   50 (279)
T PRK13650         37 SIIGHNGSGKSTTV   50 (279)
T ss_pred             EEECCCCCCHHHHH
Confidence            34699999999743


No 500
>TIGR00750 lao LAO/AO transport system ATPase. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however.
Probab=42.55  E-value=17  Score=26.82  Aligned_cols=15  Identities=27%  Similarity=0.324  Sum_probs=11.4

Q ss_pred             EEeecCCCCCCceEe
Q psy12526         80 IFAYGQTGEKTNYLL   94 (103)
Q Consensus        80 i~aYGqtgSGKT~Tm   94 (103)
                      |.--|..|+|||.++
T Consensus        37 i~i~G~~G~GKttl~   51 (300)
T TIGR00750        37 VGITGTPGAGKSTLL   51 (300)
T ss_pred             EEEECCCCCCHHHHH
Confidence            333499999999855


Done!