RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy12538
         (93 letters)



>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related
          kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
          Kinase (PTK) family; Human Fyn-related kinase (Frk) and
          similar proteins; catalytic (c) domain. The PTKc family
          is part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Frk and
          Srk are members of the Src subfamily of proteins, which
          are cytoplasmic (or non-receptor) tyr kinases. Src
          kinases contain an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          containing a conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. Frk, also known as Rak, is
          specifically expressed in liver, lung, kidney,
          intestine, mammary glands, and the islets of
          Langerhans. Rodent homologs were previously referred to
          as GTK (gastrointestinal tyr kinase), BSK (beta-cell
          Src-like kinase), or IYK (intestinal tyr kinase).
          Studies in mice reveal that Frk is not essential for
          viability. It plays a role in the signaling that leads
          to cytokine-induced beta-cell death in Type I diabetes.
          It also regulates beta-cell number during embryogenesis
          and early in life.
          Length = 261

 Score = 98.3 bits (245), Expect = 7e-27
 Identities = 34/44 (77%), Positives = 41/44 (93%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSID 91
          WEIDR S++ +RKLG+GQFGEVWEGLWNNTTPVA+KTLK G++D
Sbjct: 1  WEIDRTSIQLLRKLGAGQFGEVWEGLWNNTTPVAVKTLKPGTMD 44


>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like
          Protein Tyrosine Kinases.  Protein Tyrosine Kinase
          (PTK) family; Src kinase subfamily; catalytic (c)
          domain. Src subfamily members include Src, Lck, Hck,
          Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Src (or
          c-Src) proteins are cytoplasmic (or non-receptor) tyr
          kinases which are anchored to the plasma membrane. They
          contain an N-terminal SH4 domain with a myristoylation
          site, followed by SH3 and SH2 domains, a tyr kinase
          domain, and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. They were identified as the first
          proto-oncogene products, and they regulate cell
          adhesion, invasion, and motility in cancer cells and
          tumor vasculature, contributing to cancer progression
          and metastasis. Src kinases are overexpressed in a
          variety of human cancers, making them attractive
          targets for therapy. They are also implicated in acute
          inflammatory responses and osteoclast function. Src,
          Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
          Hck, Fgr, and Lyn show a limited expression pattern.
          Length = 261

 Score = 89.3 bits (222), Expect = 2e-23
 Identities = 30/44 (68%), Positives = 34/44 (77%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSID 91
          WEI R SLK  RKLG+GQFGEVW G WN TT VA+KTLK G++ 
Sbjct: 1  WEIPRESLKLERKLGAGQFGEVWMGTWNGTTKVAVKTLKPGTMS 44


>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine
          Kinases, Lymphocyte-specific kinase and Blk.  Protein
          Tyrosine Kinase (PTK) family; Lck and Blk kinases;
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. Lck
          (lymphocyte-specific kinase) and Blk are members of the
          Src subfamily of proteins, which are cytoplasmic (or
          non-receptor) tyr kinases. Src kinases contain an
          N-terminal SH4 domain with a myristoylation site,
          followed by SH3 and SH2 domains, a tyr kinase domain,
          and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. Lck is expressed in T-cells and
          natural killer (NK) cells. It plays a critical role in
          T-cell maturation, activation, and T-cell receptor
          (TCR) signaling. Lck phosphorylates ITAM
          (immunoreceptor tyr activation motif) sequences on
          several subunits of TCRs, leading to the activation of
          different second messenger cascades. Phosphorylated
          ITAMs serve as binding sites for other signaling factor
          such as Syk and ZAP-70, leading to their activation and
          propagation of downstream events. In addition, Lck
          regulates drug-induced apoptosis by interfering with
          the mitochondrial death pathway. The apototic role of
          Lck is independent of its primary function in T-cell
          signaling. Blk is expressed specifically in B-cells. It
          is involved in pre-BCR (B-cell receptor) signaling.
          Length = 260

 Score = 76.0 bits (187), Expect = 2e-18
 Identities = 27/44 (61%), Positives = 34/44 (77%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSID 91
          WE+ R +LK V+KLG+GQFGEVW G +N  T VAIK+LK GS+ 
Sbjct: 1  WEVPRETLKLVKKLGAGQFGEVWMGYYNGHTKVAIKSLKQGSMS 44


>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine
          Kinase, Lyn.  Protein Tyrosine Kinase (PTK) family; Lyn
          kinase; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Lyn is a
          member of the Src subfamily of proteins, which are
          cytoplasmic (or non-receptor) tyr kinases. Src kinases
          contain an N-terminal SH4 domain with a myristoylation
          site, followed by SH3 and SH2 domains, a tyr kinase
          domain, and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. Lyn is expressed in B lymphocytes
          and myeloid cells. It exhibits both positive and
          negative regulatory roles in B cell receptor (BCR)
          signaling. Lyn, as well as Fyn and Blk, promotes B cell
          activation by phosphorylating ITAMs (immunoreceptor tyr
          activation motifs) in CD19 and in Ig components of BCR.
          It negatively regulates signaling by its unique ability
          to phosphorylate ITIMs (immunoreceptor tyr inhibition
          motifs) in cell surface receptors like CD22 and CD5.
          Lyn also plays an important role in G-CSF receptor
          signaling by phosphorylating a variety of adaptor
          molecules.
          Length = 261

 Score = 70.1 bits (171), Expect = 5e-16
 Identities = 28/43 (65%), Positives = 36/43 (83%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSI 90
          WEI R S+K V+KLG+GQFGEVW G +NN+T VA+KTLK G++
Sbjct: 1  WEIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTM 43


>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine
          Kinases, Fyn and Yrk.  Protein Tyrosine Kinase (PTK)
          family; Fyn and Yrk kinases; catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Fyn and
          Yrk are members of the Src subfamily of proteins, which
          are cytoplasmic (or non-receptor) tyr kinases. Src
          kinases contain an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          containing a conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. Fyn, together with Lck, plays a
          critical role in T-cell signal transduction by
          phosphorylating ITAM (immunoreceptor tyr activation
          motif) sequences on T-cell receptors, ultimately
          leading to the proliferation and differentiation of
          T-cells. In addition, Fyn is involved in the
          myelination of neurons, and is implicated in
          Alzheimer's and Parkinson's diseases. Yrk has been
          detected only in chickens. It is primarily found in
          neuronal and epithelial cells and in macrophages. It
          may play a role in inflammation and in response to
          injury.
          Length = 260

 Score = 67.7 bits (165), Expect = 4e-15
 Identities = 27/43 (62%), Positives = 34/43 (79%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSI 90
          WEI R SL+ ++KLG+GQFGEVW G WN  T VA+KTLK G++
Sbjct: 1  WEIPRESLQLIKKLGNGQFGEVWMGTWNGNTKVAVKTLKPGTM 43


>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine
          Kinases, Srm and Brk.  Protein Tyrosine Kinase (PTK)
          family; Src-related kinase lacking C-terminal
          regulatory tyrosine and N-terminal myristylation sites
          (Srm) and breast tumor kinase (Brk, also called protein
          tyrosine kinase 6); catalytic (c) domains. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Srm and
          Brk are a member of the Src subfamily of proteins,
          which are cytoplasmic (or non-receptor) tyr kinases.
          Src kinases in general contain an N-terminal SH4 domain
          with a myristoylation site, followed by SH3 and SH2
          domains, a tyr kinase domain, and a regulatory
          C-terminal region containing a conserved tyr; they are
          activated by autophosphorylation at the tyr kinase
          domain, but are negatively regulated by phosphorylation
          at the C-terminal tyr by Csk (C-terminal Src Kinase).
          Srm and Brk however, lack the N-terminal myristylation
          sites. Src proteins are involved in signaling pathways
          that regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. Brk has been found to be
          overexpressed in a majority of breast tumors.
          Length = 261

 Score = 62.8 bits (153), Expect = 2e-13
 Identities = 25/39 (64%), Positives = 25/39 (64%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLK 86
          WE  R      RKLGSG FGEVWEGLW N   VAIK LK
Sbjct: 1  WERPREEFTLERKLGSGYFGEVWEGLWKNRVRVAIKILK 39


>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine
          Kinase, Src.  Protein Tyrosine Kinase (PTK) family; Src
          kinase; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Src (or
          c-Src) is a cytoplasmic (or non-receptor) tyr kinase,
          containing an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          with a conserved tyr. It is activated by
          autophosphorylation at the tyr kinase domain, and is
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is
          the vertebrate homolog of the oncogenic protein (v-Src)
          from Rous sarcoma virus. Together with other Src
          subfamily proteins, it is involved in signaling
          pathways that regulate cytokine and growth factor
          responses, cytoskeleton dynamics, cell proliferation,
          survival, and differentiation. Src also play a role in
          regulating cell adhesion, invasion, and motility in
          cancer cells and tumor vasculature, contributing to
          cancer progression and metastasis. Elevated levels of
          Src kinase activity have been reported in a variety of
          human cancers. Several inhibitors of Src have been
          developed as anti-cancer drugs. Src is also implicated
          in acute inflammatory responses and osteoclast
          function.
          Length = 262

 Score = 60.8 bits (147), Expect = 1e-12
 Identities = 28/43 (65%), Positives = 31/43 (72%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSI 90
          WEI R SL+   KLG G FGEVW G WN TT VAIKTLK G++
Sbjct: 1  WEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTM 43


>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine
          Kinase, Yes.  Protein Tyrosine Kinase (PTK) family; Yes
          kinase; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Yes (or
          c-Yes) is a member of the Src subfamily of proteins,
          which are cytoplasmic (or non-receptor) tyr kinases.
          Src kinases contain an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          containing a conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. c-Yes kinase is the cellular
          homolog of the oncogenic protein (v-Yes) encoded by the
          Yamaguchi 73 and Esh sarcoma viruses. It displays
          functional overlap with other Src subfamily members,
          particularly Src. It also shows some unique functions
          such as binding to occludins, transmembrane proteins
          that regulate extracellular interactions in tight
          junctions. Yes also associates with a number of
          proteins in different cell types that Src does not
          interact with, like JAK2 and gp130 in pre-adipocytes,
          and Pyk2 in treated pulmonary vein endothelial cells.
          Although the biological function of Yes remains
          unclear, it appears to have a role in regulating
          cell-cell interactions and vesicle trafficking in
          polarized cells.
          Length = 260

 Score = 60.5 bits (146), Expect = 2e-12
 Identities = 28/43 (65%), Positives = 31/43 (72%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSI 90
          WEI R SL+   KLG G FGEVW G WN TT VAIKTLK G++
Sbjct: 1  WEIPRESLRLDVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTM 43


>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine
          Kinase, Hematopoietic cell kinase.  Protein Tyrosine
          Kinase (PTK) family; Hematopoietic cell kinase (Hck);
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. Hck is a member of the
          Src subfamily of proteins, which are cytoplasmic (or
          non-receptor) tyr kinases. Src kinases contain an
          N-terminal SH4 domain with a myristoylation site,
          followed by SH3 and SH2 domains, a tyr kinase domain,
          and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. Hck is present in myeloid and
          lymphoid cells that play a role in the development of
          cancer. It may be important in the oncogenic signaling
          of the protein Tel-Abl, which induces a chronic
          myelogenous leukemia (CML)-like disease. Hck also acts
          as a negative regulator of granulocyte
          colony-stimulating factor (G-CSF)-induced proliferation
          of granulocytic precursors, suggesting a possible role
          in the development of acute myeloid leukemia (AML). In
          addition, Hck is essential in regulating the
          degranulation of polymorphonuclear leukocytes (PMNs).
          Genetic polymorphisms affect the expression level of
          Hck, which affects PMN mediator release and influences
          the development of chronic obstructive pulmonary
          disease (COPD).
          Length = 260

 Score = 60.4 bits (146), Expect = 2e-12
 Identities = 26/43 (60%), Positives = 32/43 (74%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSI 90
          WEI R SLK  +KLG+GQFGEVW   +N  T VA+KT+K GS+
Sbjct: 1  WEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSM 43


>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase. 
          Length = 258

 Score = 57.9 bits (141), Expect = 1e-11
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 5/40 (12%)

Query: 55 LKFVRKLGSGQFGEVWEGLW-----NNTTPVAIKTLKMGS 89
          L+  +KLG G FGEV++G          T VA+KTLK G+
Sbjct: 1  LELGKKLGEGAFGEVYKGTLKGDGEGTETKVAVKTLKEGA 40


>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
          Phosphotransferases. The specificity of this class of
          kinases can not be predicted. Possible dual-specificity
          Ser/Thr/Tyr kinase.
          Length = 258

 Score = 52.6 bits (127), Expect = 1e-09
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 5/42 (11%)

Query: 55 LKFVRKLGSGQFGEVWEGLW-----NNTTPVAIKTLKMGSID 91
          L   +KLG G FGEV++G            VA+KTLK  + +
Sbjct: 1  LTLGKKLGEGAFGEVYKGTLKGKGDGKEVEVAVKTLKEDASE 42


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
          Phosphotransferases. Tyrosine-specific kinase
          subfamily.
          Length = 257

 Score = 51.8 bits (125), Expect = 2e-09
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 5/42 (11%)

Query: 55 LKFVRKLGSGQFGEVWEGLWNNT-----TPVAIKTLKMGSID 91
          L   +KLG G FGEV++G            VA+KTLK  + +
Sbjct: 1  LTLGKKLGEGAFGEVYKGKLKGKGGKKKVEVAVKTLKEDASE 42


>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine
          Kinase, Interleukin-2-inducible T-cell Kinase.  Protein
          Tyrosine Kinase (PTK) family; Interleukin-2
          (IL-2)-inducible T-cell kinase (Itk); catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Itk
          (also known as Tsk or Emt) is a member of the Tec
          subfamily of proteins, which are cytoplasmic (or
          nonreceptor) tyr kinases with similarity to Src kinases
          in that they contain Src homology protein interaction
          domains (SH3, SH2) N-terminal to the catalytic tyr
          kinase domain. Unlike Src kinases, most Tec subfamily
          members (except Rlk) also contain an N-terminal
          pleckstrin homology (PH) domain, which binds the
          products of PI3K and allows membrane recruitment and
          activation. In addition, Itk contains the Tec homology
          (TH) domain containing one proline-rich region and a
          zinc-binding region. Tec kinases are expressed mainly
          by haematopoietic cells. Itk is expressed in T-cells
          and mast cells, and is important in their development
          and differentiation. Of the three Tec kinases expressed
          in T-cells, Itk plays the predominant role in T-cell
          receptor (TCR) signaling. It is activated by
          phosphorylation upon TCR crosslinking and is involved
          in the pathway resulting in phospholipase C-gamma1
          activation and actin polymerization. It also plays a
          role in the downstream signaling of the T-cell
          costimulatory receptor CD28, the T-cell surface
          receptor CD2, and the chemokine receptor CXCR4. In
          addition, Itk is crucial for the development of
          T-helper(Th)2 effector responses.
          Length = 256

 Score = 49.6 bits (118), Expect = 1e-08
 Identities = 19/41 (46%), Positives = 27/41 (65%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSI 90
          I  + L  V+++GSGQFG VW G W     VAIKT++ G++
Sbjct: 1  IHPSELTLVQEIGSGQFGLVWLGYWLEKRKVAIKTIREGAM 41


>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine
          Kinase, Abelson kinase.  Protein Tyrosine Kinase (PTK)
          family; Abelson (Abl) kinase; catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Abl (or
          c-Abl) is a ubiquitously-expressed cytoplasmic (or
          nonreceptor) tyr kinase that contains SH3, SH2, and tyr
          kinase domains in its N-terminal region, as well as
          nuclear localization motifs, a putative DNA-binding
          domain, and F- and G-actin binding domains in its
          C-terminal tail. It also contains a short
          autoinhibitory cap region in its N-terminus. Abl is
          normally inactive and requires phosphorylation and
          myristoylation for activation. Abl function depends on
          its subcellular localization. In the cytoplasm, Abl
          plays a role in cell proliferation and survival. In
          response to DNA damage or oxidative stress, Abl is
          transported to the nucleus where it induces apoptosis.
          In chronic myelogenous leukemia (CML) patients, an
          aberrant translocation results in the replacement of
          the first exon of Abl with the BCR (breakpoint cluster
          region) gene. The resulting BCR-Abl fusion protein is
          constitutively active and associates into tetramers,
          resulting in a hyperactive kinase sending a continuous
          signal. This leads to uncontrolled proliferation,
          morphological transformation and anti-apoptotic
          effects. BCR-Abl is the target of selective inhibitors,
          such as imatinib (Gleevec), used in the treatment of
          CML. Abl2, also known as ARG (Abelson-related gene), is
          thought to play a cooperative role with Abl in the
          proper development of the nervous system. The Tel-ARG
          fusion protein, resulting from reciprocal translocation
          between chromosomes 1 and 12, is associated with acute
          myeloid leukemia (AML). The TEL gene is a frequent
          fusion partner of other tyr kinase oncogenes, including
          Tel/Abl, Tel/PDGFRbeta, and Tel/Jak2, found in patients
          with leukemia and myeloproliferative disorders.
          Length = 263

 Score = 49.5 bits (118), Expect = 1e-08
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 5/42 (11%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLW---NNTTPVAIKTLK 86
          WE++R  +    KLG GQ+GEV+EG+W   + T  VA+KTLK
Sbjct: 1  WEMERTDITMKHKLGGGQYGEVYEGVWKKYSLT--VAVKTLK 40


>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
          Protein Tyrosine Kinase (PTK) family, catalytic domain.
          This PTKc family is part of a larger superfamily that
          includes the catalytic domains of protein
          serine/threonine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. They can
          be classified into receptor and non-receptor tyr
          kinases. PTKs play important roles in many cellular
          processes including, lymphocyte activation, epithelium
          growth and maintenance, metabolism control,
          organogenesis regulation, survival, proliferation,
          differentiation, migration, adhesion, motility, and
          morphogenesis. Receptor tyr kinases (RTKs) are integral
          membrane proteins which contain an extracellular
          ligand-binding region, a transmembrane segment, and an
          intracellular tyr kinase domain. RTKs are usually
          activated through ligand binding, which causes
          dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain, leading to
          intracellular signaling. Some RTKs are orphan receptors
          with no known ligands. Non-receptor (or cytoplasmic)
          tyr kinases are distributed in different intracellular
          compartments and are usually multi-domain proteins
          containing a catalytic tyr kinase domain as well as
          various regulatory domains such as SH3 and SH2. PTKs
          are usually autoinhibited and require a mechanism for
          activation. In many PTKs, the phosphorylation of tyr
          residues in the activation loop is essential for
          optimal activity. Aberrant expression of PTKs is
          associated with many development abnormalities and
          cancers.
          Length = 262

 Score = 48.3 bits (116), Expect = 4e-08
 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 4/32 (12%)

Query: 59 RKLGSGQFGEVWEGLW----NNTTPVAIKTLK 86
          +KLG G FGEV++G        TT VA+KTLK
Sbjct: 1  KKLGEGAFGEVYKGKLKGKDGKTTEVAVKTLK 32


>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Tyrosine kinase expressed in hepatocellular
          carcinoma (Tec) subfamily; catalytic (c) domain. The
          Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk
          (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Tec
          kinases are cytoplasmic (or nonreceptor) tyr kinases
          (nRTKs) with similarity to Src kinases in that they
          contain Src homology protein interaction domains (SH3,
          SH2) N-terminal to the catalytic tyr kinase domain.
          Unlike Src kinases, most Tec subfamily members (except
          Rlk) also contain an N-terminal pleckstrin homology
          (PH) domain, which binds the products of PI3K and
          allows membrane recruitment and activation. In
          addition, some members contain the Tec homology (TH)
          domain, which contains proline-rich and zinc-binding
          regions. Tec kinases form the second largest subfamily
          of nRTKs and are expressed mainly by haematopoietic
          cells, although Tec and Bmx are also found in
          endothelial cells. B-cells express Btk and Tec, while
          T-cells express Itk, Txk, and Tec. Collectively, Tec
          kinases are expressed in a variety of myeloid cells
          such as mast cells, platelets, macrophages, and
          dendritic cells. Each Tec kinase shows a distinct
          cell-type pattern of expression. The function of Tec
          kinases in lymphoid cells have been studied
          extensively. They play important roles in the
          development, differentiation, maturation, regulation,
          survival, and function of B-cells and T-cells.
          Mutations in Btk cause the severe B-cell
          immunodeficiency, X-linked agammaglobulinaemia (XLA).
          Length = 256

 Score = 48.2 bits (115), Expect = 4e-08
 Identities = 21/47 (44%), Positives = 30/47 (63%), Gaps = 3/47 (6%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSI---DFV 93
          ID + L F+++LGSGQFG V  G W     VAIK ++ G++   DF+
Sbjct: 1  IDPSELTFLKELGSGQFGVVHLGKWRGKIDVAIKMIREGAMSEDDFI 47


>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin
          Receptor-like Protein Tyrosine Kinases.  Protein
          Tyrosine Kinase (PTK) family; Insulin Receptor (InsR)
          subfamily; catalytic (c) domain. The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). The InsR subfamily is
          composed of InsR, Insulin-like Growth Factor-1 Receptor
          (IGF-1R), and similar proteins. PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. InsR and
          IGF-1R are receptor tyr kinases (RTKs) composed of two
          alphabeta heterodimers. Binding of the ligand (insulin,
          IGF-1, or IGF-2) to the extracellular alpha subunit
          activates the intracellular tyr kinase domain of the
          transmembrane beta subunit. Receptor activation leads
          to autophosphorylation, stimulating downstream kinase
          activities, which initiate signaling cascades and
          biological function. InsR and IGF-1R, which share 84%
          sequence identity in their kinase domains, display
          physiologically distinct yet overlapping functions in
          cell growth, differentiation, and metabolism. InsR
          activation leads primarily to metabolic effects while
          IGF-1R activation stimulates mitogenic pathways. In
          cells expressing both receptors, InsR/IGF-1R hybrids
          are found together with classical receptors. Both
          receptors can interact with common adaptor molecules
          such as IRS-1 and IRS-2.
          Length = 277

 Score = 46.6 bits (111), Expect = 2e-07
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNT------TPVAIKTL 85
          WE+ R  +  +R+LG G FG V+EGL          T VAIKT+
Sbjct: 1  WELPREKITLIRELGQGSFGMVYEGLAKGVVKGEPETRVAIKTV 44


>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine
          Kinases, Bruton's tyrosine kinase and Bone marrow
          kinase on the X chromosome.  Protein Tyrosine Kinase
          (PTK) family; Bruton's tyrosine kinase (Btk) and Bone
          marrow kinase on the X chromosome (Bmx); catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Btk and
          Bmx (also named Etk) are members of the Tec subfamily
          of proteins, which are cytoplasmic (or nonreceptor) tyr
          kinases with similarity to Src kinases in that they
          contain Src homology protein interaction domains (SH3,
          SH2) N-terminal to the catalytic tyr kinase domain.
          Unlike Src kinases, most Tec subfamily members (except
          Rlk) also contain an N-terminal pleckstrin homology
          (PH) domain, which binds the products of PI3K and
          allows membrane recruitment and activation. In
          addition, Btk contains the Tec homology (TH) domain
          with proline-rich and zinc-binding regions. Tec kinases
          are expressed mainly by haematopoietic cells. Btk is
          expressed in B-cells, and a variety of myeloid cells
          including mast cells, platelets, neutrophils, and
          dendrictic cells. It interacts with a variety of
          partners, from cytosolic proteins to nuclear
          transcription factors, suggesting a diversity of
          functions. Stimulation of a diverse array of cell
          surface receptors, including antigen engagement of the
          B-cell receptor (BCR), leads to PH-mediated membrane
          translocation of Btk and subsequent phosphorylation by
          Src kinase and activation. Btk plays an important role
          in the life cycle of B-cells including their
          development, differentiation, proliferation, survival,
          and apoptosis. Mutations in Btk cause the primary
          immunodeficiency disease, X-linked agammaglobulinaemia
          (XLA) in humans. Bmx is primarily expressed in bone
          marrow and the arterial endothelium, and plays an
          important role in ischemia-induced angiogenesis. It
          facilitates arterial growth, capillary formation,
          vessel maturation, and bone marrow-derived endothelial
          progenitor cell mobilization.
          Length = 256

 Score = 44.5 bits (105), Expect = 1e-06
 Identities = 20/41 (48%), Positives = 26/41 (63%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSI 90
          ID   L F+++LG+GQFG V  G W     VAIK +K GS+
Sbjct: 1  IDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSM 41


>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src
          kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
          Kinase (PTK) family; C-terminal Src kinase (Csk)
          subfamily; catalytic (c) domain. The Csk subfamily is
          composed of Csk, Chk, and similar proteins. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Csk
          subfamily kinases are cytoplasmic (or nonreceptor) tyr
          kinases containing the Src homology domains, SH3 and
          SH2, N-terminal to the catalytic tyr kinase domain.
          They negatively regulate the activity of Src kinases
          that are anchored to the plasma membrane. To inhibit
          Src kinases, Csk and Chk are translocated to the
          membrane via binding to specific transmembrane
          proteins, G-proteins, or adaptor proteins near the
          membrane. Csk catalyzes the tyr phosphorylation of the
          regulatory C-terminal tail of Src kinases, resulting in
          their inactivation. Chk inhibit Src kinases using a
          noncatalytic mechanism by simply binding to them. As
          negative regulators of Src kinases, Csk and Chk play
          important roles in cell proliferation, survival, and
          differentiation, and consequently, in cancer
          development and progression.
          Length = 256

 Score = 44.3 bits (105), Expect = 1e-06
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLK 86
          W I+   LK    +G G+FG+V  G +     VA+K LK
Sbjct: 1  WAINSKELKLGATIGKGEFGDVMLGDYRGQK-VAVKCLK 38


>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine
          Kinases, Tyrosine kinase expressed in hepatocellular
          carcinoma and Resting lymphocyte kinase.  Protein
          Tyrosine Kinase (PTK) family; Tyrosine kinase expressed
          in hepatocellular carcinoma (Tec) and Resting
          lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc
          family is part of a larger superfamily, that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Tec and
          Rlk (also named Txk) are members of the Tec subfamily
          of proteins, which are cytoplasmic (or nonreceptor) tyr
          kinases with similarity to Src kinases in that they
          contain Src homology protein interaction domains (SH3,
          SH2) N-terminal to the catalytic tyr kinase domain.
          Unlike Src kinases, most Tec subfamily members (except
          Rlk) also contain an N-terminal pleckstrin homology
          (PH) domain, which binds the products of PI3K and
          allows membrane recruitment and activation. Instead of
          PH, Rlk contains an N-terminal cysteine-rich region. In
          addition to PH, Tec also contains the Tec homology (TH)
          domain with proline-rich and zinc-binding regions. Tec
          kinases are expressed mainly by haematopoietic cells.
          Tec is more widely-expressed than other Tec subfamily
          kinases. It is found in endothelial cells, both B- and
          T-cells, and a variety of myeloid cells including mast
          cells, erythroid cells, platelets, macrophages and
          neutrophils. Rlk is expressed in T-cells and mast cell
          lines. Tec and Rlk are both key components of T-cell
          receptor (TCR) signaling. They are important in
          TCR-stimulated proliferation, IL-2 production and
          phopholipase C-gamma1 activation.
          Length = 256

 Score = 42.9 bits (101), Expect = 3e-06
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLKMGSI---DFV 93
          I+ + L F+++LGSGQFG V  G W     VAIK +  G++   DF+
Sbjct: 1  INPSELTFMKELGSGQFGVVHLGKWRAQIKVAIKAINEGAMSEEDFI 47


>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Ephrin Receptor (EphR) subfamily; catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). They can be classified into two classes (EphA
          and EphB), according to their extracellular sequences,
          which largely correspond to binding preferences for
          either GPI-anchored ephrin-A ligands or transmembrane
          ephrin-B ligands. Vertebrates have ten EphA and six
          EhpB receptors, which display promiscuous ligand
          interactions within each class. EphRs contain an ephrin
          binding domain and two fibronectin repeats
          extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. This allows
          ephrin/EphR dimers to form, leading to the activation
          of the intracellular tyr kinase domain. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling). The main
          effect of ephrin/EphR interaction is cell-cell
          repulsion or adhesion. Ephrin/EphR signaling is
          important in neural development and plasticity, cell
          morphogenesis and proliferation, cell-fate
          determination, embryonic development, tissue
          patterning, and angiogenesis.
          Length = 266

 Score = 42.3 bits (100), Expect = 5e-06
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 4/46 (8%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLWN----NTTPVAIKTLKMGSID 91
          ID + +   + +G G+FGEV  G           VAIKTLK GS D
Sbjct: 1  IDPSYVTIEKVIGGGEFGEVCRGRLKLPGKKEIDVAIKTLKAGSSD 46


>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine
          Kinase, Colony-Stimulating Factor-1 Receptor.  Protein
          Tyrosine Kinase (PTK) family; Colony-Stimulating
          Factor-1 Receptor (CSF-1R); catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. CSF-1R,
          also called c-Fms, is a member of the Platelet Derived
          Growth Factor Receptor (PDGFR) subfamily of proteins,
          which are receptor tyr kinases (RTKs) containing an
          extracellular ligand-binding region with five
          immunoglobulin-like domains, a transmembrane segment,
          and an intracellular catalytic domain. The binding of
          CSF-1R to its ligand, CSF-1, leads to receptor
          dimerization, trans phosphorylation and activation, and
          intracellular signaling. CSF-1R signaling is critical
          in the regulation of macrophages and osteoclasts. It
          leads to increases in gene transcription and protein
          translation, and induces cytoskeletal remodeling.
          CSF-1R signaling leads to a variety of cellular
          responses including survival, proliferation, and
          differentiation of target cells. It plays an important
          role in innate immunity, tissue development and
          function, and the pathogenesis of some diseases
          including atherosclerosis and cancer. CSF-1R signaling
          is also implicated in mammary gland development during
          pregnancy and lactation. Aberrant CSF-1/CSF-1R
          expression correlates with tumor cell invasiveness,
          poor clinical prognosis, and bone metastasis in breast
          cancer. Although the structure of the human CSF-1R
          catalytic domain is known, it is excluded from this
          specific alignment model because it contains a deletion
          in its sequence.
          Length = 374

 Score = 42.1 bits (99), Expect = 6e-06
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 6/47 (12%)

Query: 46 DQWEIDRNSLKFVRKLGSGQFGEVWE----GLWN--NTTPVAIKTLK 86
          ++WE  R++L+F + LG+G FG+V E    GL    N   VA+K LK
Sbjct: 31 EKWEFPRDNLQFGKTLGAGAFGKVVEATAFGLGKEDNVLRVAVKMLK 77


>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine
          Kinases, Anaplastic Lymphoma Kinase and Leukocyte
          Tyrosine Kinase.  Protein Tyrosine Kinase (PTK) family;
          Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine
          (tyr) Kinase (LTK); catalytic (c) domain. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to tyr
          residues in protein substrates. ALK and LTK are orphan
          receptor tyr kinases (RTKs) whose ligands are not yet
          well-defined. RTKs contain an extracellular
          ligand-binding domain, a transmembrane region, and an
          intracellular tyr kinase domain. They are usually
          activated through ligand binding, which causes
          dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain. ALK appears
          to play an important role in mammalian neural
          development as well as visceral muscle differentiation
          in Drosophila. ALK is aberrantly expressed as fusion
          proteins, due to chromosomal translocations, in about
          60% of anaplastic large cell lymphomas (ALCLs). ALK
          fusion proteins are also found in rare cases of diffuse
          large B cell lymphomas (DLBCLs). LTK is mainly
          expressed in B lymphocytes and neuronal tissues. It is
          important in cell proliferation and survival.
          Transgenic mice expressing TLK display retarded growth
          and high mortality rate. In addition, a polymorphism in
          mouse and human LTK is implicated in the pathogenesis
          of systemic lupus erythematosus.
          Length = 277

 Score = 42.0 bits (99), Expect = 7e-06
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 6/43 (13%)

Query: 49 EIDRNSLKFVRKLGSGQFGEVWEGLW------NNTTPVAIKTL 85
          E+ R+S+  +R LG G FGEV+EGL+           VA+KTL
Sbjct: 2  EVPRDSITLLRALGHGAFGEVYEGLYRGRDGDAVELQVAVKTL 44


>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine
          Kinase, Focal Adhesion Kinase.  Protein Tyrosine Kinase
          (PTK) family; Focal Adhesion Kinase (FAK); catalytic
          (c) domain. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. FAK is a cytoplasmic (or nonreceptor) tyr
          kinase that contains an autophosphorylation site and a
          FERM domain at the N-terminus, a central tyr kinase
          domain, proline-rich regions, and a C-terminal FAT
          (focal adhesion targeting) domain. FAK activity is
          dependent on integrin-mediated cell adhesion, which
          facilitates N-terminal autophosphorylation. Full
          activation is achieved by the phosphorylation of its
          two adjacent A-loop tyrosines. FAK is important in
          mediating signaling initiated at sites of cell
          adhesions and at growth factor receptors. Through
          diverse molecular interactions, FAK functions as a
          biosensor or integrator to control cell motility. It is
          a key regulator of cell survival, proliferation,
          migration and invasion, and thus plays an important
          role in the development and progression of cancer. Src
          binds to autophosphorylated FAK forming the FAK-Src
          dual kinase complex, which is activated in a wide
          variety of tumor cells and generates signals promoting
          growth and metastasis. FAK is being developed as a
          target for cancer therapy.
          Length = 270

 Score = 41.3 bits (97), Expect = 1e-05
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 4/43 (9%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLW----NNTTPVAIKTLK 86
          +EI R  +   R +G GQFG+V++G++    N    VA+KT K
Sbjct: 1  YEIQREDITLGRCIGEGQFGDVYQGVYMSPENEKIAVAVKTCK 43


>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine
          Kinases, Fibroblast Growth Factor Receptors.  Protein
          Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
          Receptor (FGFR) subfamily; catalytic (c) domain. The
          FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4,
          and similar proteins. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K).PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. FGFR subfamily members
          are receptor tyr kinases (RTKs) containing an
          extracellular ligand-binding region with three
          immunoglobulin-like domains, a transmembrane segment,
          and an intracellular catalytic domain. The binding of
          FGFRs to their ligands, the FGFs, and to
          heparin/heparan sulfate (HS) results in the formation
          of a ternary complex, which leads to receptor
          dimerization and activation, and intracellular
          signaling. There are at least 23 FGFs and four types of
          FGFRs. The binding of FGFs to FGFRs is promiscuous, in
          that a receptor may be activated by several ligands and
          a ligand may bind to more that one type of receptor.
          FGF/FGFR signaling is important in the regulation of
          embryonic development, homeostasis, and regenerative
          processes. Depending on the cell type and stage, FGFR
          signaling produces diverse cellular responses including
          proliferation, growth arrest, differentiation, and
          apoptosis. Aberrant signaling leads to many human
          diseases such as skeletal, olfactory, and metabolic
          disorders, as well as cancer.
          Length = 293

 Score = 40.9 bits (96), Expect = 2e-05
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEVWEGLW------NNTTPVAIKTLKMGSID 91
          +WE+ R+ L   + LG G FG+V +         N T+ VA+K LK  + +
Sbjct: 6  EWELPRDRLTLGKPLGEGAFGQVVKAEAVGLDNPNETSTVAVKMLKDDATE 56


>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth
          Factor Receptor-like Protein Tyrosine Kinases.  Protein
          Tyrosine Kinase (PTK) family; Epidermal Growth Factor
          Receptor (EGFR) subfamily; catalytic (c) domain. EGFR
          (HER, ErbB) subfamily members include EGFR (HER1,
          ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. The EGFR proteins are receptor tyr kinases
          (RTKs) containing an extracellular EGF-related
          ligand-binding region, a transmembrane helix, and a
          cytoplasmic region with a tyr kinase domain and a
          regulatory C-terminal tail. Unlike other tyr kinases,
          phosphorylation of the activation loop of EGFR proteins
          is not critical to their activation. Instead, they are
          activated by ligand-induced dimerization, resulting in
          the phosphorylation of tyr residues in the C-terminal
          tail, which serve as binding sites for downstream
          signaling molecules. Collectively, they can recognize a
          variety of ligands including EGF, TGFalpha, and
          neuregulins, among others. All four subfamily members
          can form homo- or heterodimers. HER3 contains an
          impaired kinase domain and depends on its
          heterodimerization partner for activation. EGFR
          subfamily members are involved in signaling pathways
          leading to a broad range of cellular responses
          including cell proliferation, differentiation,
          migration, growth inhibition, and apoptosis. Gain of
          function alterations, through their overexpression,
          deletions, or point mutations in their kinase domains,
          have been implicated in various cancers. These
          receptors are targets of many small molecule inhibitors
          and monoclonal antibodies used in cancer therapy.
          Length = 279

 Score = 40.5 bits (95), Expect = 3e-05
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 5/37 (13%)

Query: 55 LKFVRKLGSGQFGEVWEGLW-----NNTTPVAIKTLK 86
          L+ ++ LGSG FG V++G+W         PVAIK L+
Sbjct: 9  LEKIKVLGSGAFGTVYKGVWIPEGEKVKIPVAIKVLR 45


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 39.9 bits (94), Expect = 3e-05
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 55 LKFVRKLGSGQFGEVWEGLWNNT-TPVAIKTLK 86
           + +RKLGSG FG V++     T   VA+K LK
Sbjct: 1  YELLRKLGSGSFGTVYKAKHKGTGKIVAVKILK 33


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
          domain.  Phosphotransferases. Serine or
          threonine-specific kinase subfamily.
          Length = 254

 Score = 39.4 bits (93), Expect = 5e-05
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 56 KFVRKLGSGQFGEVWEGLWNNT-TPVAIKTLKMGSID 91
          + + KLG G FG+V+      T   VAIK +K   I 
Sbjct: 2  EILEKLGEGSFGKVYLARDKKTGKLVAIKVIKKKKIK 38


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
          cell-Associated Kinase-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Male germ
          cell-Associated Kinase (MAK)-like subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAK-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of human MAK and MAK-related kinase (MRK),
          Saccharomyces cerevisiae Ime2p, Schizosaccharomyces
          pombe Mei4-dependent protein 3 (Mde3) and Pit1,
          Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK,
          and similar proteins. These proteins play important
          roles during meiosis. MAK is highly expressed in
          testicular cells specifically in the meiotic phase, but
          is not essential for spermatogenesis and fertility. It
          functions as a coactivator of the androgen receptor in
          prostate cells. MRK, also called Intestinal Cell Kinase
          (ICK), is expressed ubiquitously, with highest
          expression in the ovary and uterus. A missense mutation
          in MRK causes endocrine-cerebro-osteodysplasia (ECO),
          suggesting that this protein plays an important role in
          the development of many organs. MAK and MRK may be
          involved in regulating cell cycle and cell fate. Ime2p
          is a meiosis-specific kinase that is important during
          meiotic initiation and during the later stages of
          meiosis. Mde3 functions downstream of the transcription
          factor Mei-4 which is essential for meiotic prophase I.
          Length = 283

 Score = 39.1 bits (92), Expect = 8e-05
 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 56 KFVRKLGSGQFGEVWEGLWNNTTP-VAIKTLK 86
          K +++LG G FG V+      T   VAIK +K
Sbjct: 2  KVIKQLGDGTFGSVYLARNKETGELVAIKKMK 33


>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine
          Kinase, Kit.  Protein Tyrosine Kinase (PTK) family; Kit
          (or c-Kit); catalytic (c) domain. The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Kit is a
          member of the Platelet Derived Growth Factor Receptor
          (PDGFR) subfamily of proteins, which are receptor tyr
          kinases (RTKs) containing an extracellular
          ligand-binding region with five immunoglobulin-like
          domains, a transmembrane segment, and an intracellular
          catalytic domain. The binding of Kit to its ligand, the
          stem-cell factor (SCF), leads to receptor dimerization,
          trans phosphorylation and activation, and intracellular
          signaling. Kit is important in the development of
          melanocytes, germ cells, mast cells, hematopoietic stem
          cells, the interstitial cells of Cajal, and the
          pacemaker cells of the GI tract. Kit signaling is
          involved in major cellular functions including cell
          survival, proliferation, differentiation, adhesion, and
          chemotaxis. Mutations in Kit, which result in
          constitutive ligand-independent activation, are found
          in human cancers such as gastrointestinal stromal tumor
          (GIST) and testicular germ cell tumor (TGCT). The
          aberrant expression of Kit and/or SCF is associated
          with other tumor types such as systemic mastocytosis
          and cancers of the breast, neurons, lung, prostate,
          colon, and rectum.  Although the structure of the human
          Kit catalytic domain is known, it is excluded from this
          specific alignment model because it contains a deletion
          in its sequence.
          Length = 375

 Score = 38.7 bits (90), Expect = 1e-04
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 6/46 (13%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEVWE----GLW--NNTTPVAIKTLK 86
          +WE  RN L F + LG+G FG+V E    GL+  +    VA+K LK
Sbjct: 29 KWEFPRNRLSFGKTLGAGAFGKVVEATAYGLFKSDAAMTVAVKMLK 74


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein
          Kinases (PKs), catalytic (c) domain. PKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine or tyrosine residues on protein
          substrates. The PK family is part of a larger
          superfamily that includes the catalytic domains of RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, phosphoinositide 3-kinase (PI3K), and
          actin-fragmin kinase. PKs make up a large family of
          serine/threonine kinases, protein tyrosine kinases
          (PTKs), and dual-specificity PKs that phosphorylate
          both serine/threonine and tyrosine residues of target
          proteins. Majority of protein phosphorylation, about
          95%, occurs on serine residues while only 1% occurs on
          tyrosine residues. Protein phosphorylation is a
          mechanism by which a wide variety of cellular proteins,
          such as enzymes and membrane channels, are reversibly
          regulated in response to certain stimuli. PKs often
          function as components of signal transduction pathways
          in which one kinase activates a second kinase, which in
          turn, may act on other kinases; this sequential action
          transmits a signal from the cell surface to target
          proteins, which results in cellular responses. The PK
          family is one of the largest known protein families
          with more than 100 homologous yeast enzymes and 550
          human proteins. A fraction of PK family members are
          pseudokinases that lack crucial residues for catalytic
          activity. The mutiplicity of kinases allows for
          specific regulation according to substrate, tissue
          distribution, and cellular localization. PKs regulate
          many cellular processes including proliferation,
          division, differentiation, motility, survival,
          metabolism, cell-cycle progression, cytoskeletal
          rearrangement, immunity, and neuronal functions. Many
          kinases are implicated in the development of various
          human diseases including different types of cancer.
          Length = 215

 Score = 37.6 bits (88), Expect = 2e-04
 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 1/27 (3%)

Query: 61 LGSGQFGEVWEGLWNNT-TPVAIKTLK 86
          LG G FG V+      T   VAIK +K
Sbjct: 1  LGEGGFGTVYLARDKKTGKKVAIKIIK 27


>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Fes subfamily; catalytic (c) domain. Fes
          subfamily members include Fes (or Fps), Fer, and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. Fes subfamily proteins are cytoplasmic (or
          nonreceptor) tyr kinases containing an N-terminal
          region with FCH (Fes/Fer/CIP4 homology) and coiled-coil
          domains, followed by a SH2 domain, and a C-terminal
          catalytic domain. The genes for Fes (feline sarcoma)
          and Fps (Fujinami poultry sarcoma) were first isolated
          from tumor-causing retroviruses. The viral oncogenes
          encode chimeric Fes proteins consisting of Gag
          sequences at the N-termini, resulting in unregulated
          tyr kinase activity. Fes and Fer kinases play roles in
          haematopoiesis, inflammation and immunity, growth
          factor signaling, cytoskeletal regulation, cell
          migration and adhesion, and the regulation of cell-cell
          interactions. Fes and Fer show redundancy in their
          biological functions.
          Length = 251

 Score = 37.8 bits (88), Expect = 2e-04
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 59 RKLGSGQFGEVWEGLWNNTTPVAIKTLKM 87
           K+G G FG+V++G+    T VA+KT + 
Sbjct: 1  EKIGKGNFGDVYKGVLKGNTEVAVKTCRS 29


>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine
          Kinase, Activated Cdc42-associated kinase.  Protein
          Tyrosine Kinase (PTK) family; Activated
          Cdc42-associated kinase (Ack) subfamily; catalytic (c)
          domain. Ack subfamily members include Ack1,
          thirty-eight-negative kinase 1 (Tnk1), and similar
          proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. Ack subfamily members are cytoplasmic (or
          nonreceptor) tyr kinases containing an N-terminal
          catalytic domain, an SH3 domain, a Cdc42-binding CRIB
          domain, and a proline-rich region. They are mainly
          expressed in brain and skeletal tissues and are
          involved in the regulation of cell adhesion and growth,
          receptor degradation, and axonal guidance. Ack1 is also
          associated with androgen-independent  prostate cancer
          progression. Tnk1 regulates TNFalpha signaling and may
          play an important role in cell death.
          Length = 257

 Score = 37.7 bits (88), Expect = 2e-04
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 4/31 (12%)

Query: 60 KLGSGQFGEVWEGLWNNTT----PVAIKTLK 86
          KLG G FG V  G W+ +     PVA+K LK
Sbjct: 2  KLGDGSFGVVRRGEWSTSGGKVIPVAVKCLK 32


>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine
          Kinase, C-ros.  Protein Tyrosine Kinases (PTK) family;
          C-ros and Drosophila Sevenless proteins; catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. The
          proto-oncogene c-ros encodes an orphan receptor tyr
          kinase (RTK) with an unknown ligand. RTKs contain an
          extracellular ligand-binding domain, a transmembrane
          region, and an intracellular tyr kinase domain. RTKs
          are usually activated through ligand binding, which
          causes dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain. C-ros is
          expressed in embryonic cells of the kidney, intestine
          and lung, but disappears soon after birth. It persists
          only in the adult epididymis. Male mice bearing
          inactive mutations of c-ros lack the initial segment of
          the epididymis and are infertile. The Drosophila
          protein, Sevenless, is required for the specification
          of the R7 photoreceptor cell during eye development.
          Length = 269

 Score = 37.5 bits (87), Expect = 3e-04
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 7/38 (18%)

Query: 61 LGSGQFGEVWEG-----LWNNTTP--VAIKTLKMGSID 91
          LGSG FGEV+EG     L   + P  VA+KTL+ G+ D
Sbjct: 3  LGSGAFGEVYEGTATDILGPGSGPIRVAVKTLRKGATD 40


>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine
          Kinase, HER2.  Protein Tyrosine Kinase (PTK) family;
          HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. HER2 is
          a member of the EGFR (HER, ErbB) subfamily of proteins,
          which are receptor tyr kinases (RTKs) containing an
          extracellular EGF-related ligand-binding region, a
          transmembrane helix, and a cytoplasmic region with a
          tyr kinase domain and a regulatory C-terminal tail.
          Unlike other tyr kinases, phosphorylation of the
          activation loop of EGFR proteins is not critical to
          their activation. Instead, they are activated by
          ligand-induced dimerization, leading to the
          phosphorylation of tyr residues in the C-terminal tail,
          which serve as binding sites for downstream signaling
          molecules. HER2 does not bind to any known EGFR
          subfamily ligands, but contributes to the kinase
          activity of all possible heterodimers. It acts as the
          preferred partner with other ligand-bound EGFR proteins
          and functions as a signal amplifier, with the HER2-HER3
          heterodimer being the most potent pair in mitogenic
          signaling. HER2 plays an important role in cell
          development, proliferation, survival and motility.
          Overexpression of HER2 results in its activation and
          downstream signaling, even in the absence of ligand.
          HER2 overexpression, mainly due to gene amplification,
          has been shown in a variety of human cancers. Its role
          in breast cancer is especially well-documented. HER2 is
          up-regulated in about 25% of breast tumors and is
          associated with increases in tumor aggressiveness,
          recurrence and mortality. HER2 is a target for
          monoclonal antibodies and small molecule inhibitors,
          which are being developed as treatments for cancer. The
          first humanized antibody approved for clinical use is
          Trastuzumab (Herceptin), which is being used in
          combination with other therapies to improve the
          survival rates of patients with HER2-overexpressing
          breast cancer.
          Length = 279

 Score = 36.9 bits (85), Expect = 4e-04
 Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 5/37 (13%)

Query: 55 LKFVRKLGSGQFGEVWEGLW-----NNTTPVAIKTLK 86
          LK V+ LGSG FG V++G+W     N   PVAIK L+
Sbjct: 9  LKKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLR 45


>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the
          Protein Tyrosine Kinases, Janus kinases.  Protein
          Tyrosine Kinase (PTK) family; Janus kinase (Jak)
          subfamily; catalytic (c) domain (repeat 2). The Jak
          subfamily is composed of Jak1, Jak2, Jak3, TYK2, and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. Jak subfamily proteins are cytoplasmic (or
          nonreceptor) tyr kinases containing an N-terminal FERM
          domain, followed by a Src homology 2 (SH2) domain, a
          pseudokinase domain, and a C-terminal tyr kinase
          catalytic domain. Most Jaks are expressed in a wide
          variety of tissues, except for Jak3, which is expressed
          only in hematopoietic cells. Jaks are crucial for
          cytokine receptor signaling. They are activated by
          autophosphorylation upon cytokine-induced receptor
          aggregation, and subsequently trigger downstream
          signaling events such as the phosphorylation of signal
          transducers and activators of transcription (STATs).
          Jaks are also involved in regulating the surface
          expression of some cytokine receptors. The Jak-STAT
          pathway is involved in many biological processes
          including hematopoiesis, immunoregulation, host
          defense, fertility, lactation, growth, and
          embryogenesis.
          Length = 284

 Score = 36.6 bits (85), Expect = 5e-04
 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 5/37 (13%)

Query: 55 LKFVRKLGSGQFGEV----WEGLWNNTTP-VAIKTLK 86
          LKF+++LG G FG+V    ++ L +NT   VA+K+L 
Sbjct: 6  LKFIKQLGEGHFGKVELCRYDPLGDNTGEQVAVKSLN 42


>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine
          Kinases, Vascular Endothelial Growth Factor Receptors. 
          Protein Tyrosine Kinase (PTK) family; Vascular
          Endothelial Growth Factor Receptor (VEGFR) subfamily;
          catalytic (c) domain. The VEGFR subfamily consists of
          VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. VEGFR subfamily members are receptor tyr
          kinases (RTKs) containing an extracellular
          ligand-binding region with seven immunoglobulin
          (Ig)-like domains, a transmembrane segment, and an
          intracellular catalytic domain. In VEGFR3, the fifth
          Ig-like domain is replaced by a disulfide bridge. The
          binding of VEGFRs to their ligands, the VEGFs, leads to
          receptor dimerization, activation, and intracellular
          signaling. There are five VEGF ligands in mammals,
          which bind, in an overlapping pattern to the three
          VEGFRs, which can form homo or heterodimers. VEGFRs
          regulate the cardiovascular system. They are critical
          for vascular development during embryogenesis and blood
          vessel formation in adults. They induce cellular
          functions common to other growth factor receptors such
          as cell migration, survival, and proliferation. VEGFR1
          binds VEGFA, VEGFB, and placenta growth factor (PLGF).
          It regulates monocyte and macrophage migration,
          vascular permeability, haematopoiesis, and the
          recruitment of haematopietic progenitor cells from the
          bone marrow.
          Length = 337

 Score = 36.8 bits (85), Expect = 5e-04
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 6/49 (12%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEVWE----GLWNNTT--PVAIKTLKMGS 89
          +WE  R+ LK  + LG G FG+V +    G+  + +   VA+K LK G+
Sbjct: 1  KWEFPRDRLKLGKPLGRGAFGKVIQASAFGIEKSASCRTVAVKMLKEGA 49


>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine
          Kinase, Epidermal Growth Factor Receptor.  Protein
          Tyrosine Kinase (PTK) family; Epidermal Growth Factor
          Receptor (EGFR); catalytic (c) domain. The PTKc family
          is part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EGFR
          (HER1, ErbB1) is a member of the EGFR (HER, ErbB)
          subfamily of proteins, which are receptor tyr kinases
          (RTKs) containing an extracellular EGF-related
          ligand-binding region, a transmembrane helix, and a
          cytoplasmic region with a tyr kinase domain and a
          regulatory C-terminal tail. Unlike other tyr kinases,
          phosphorylation of the activation loop of EGFR proteins
          is not critical to their activation. Instead, they are
          activated by ligand-induced dimerization, leading to
          the phosphorylation of tyr residues in the C-terminal
          tail, which serve as binding sites for downstream
          signaling molecules. Ligands for EGFR include EGF,
          heparin binding EGF-like growth factor (HBEGF),
          epiregulin, amphiregulin, TGFalpha, and betacellulin.
          Upon ligand binding, EGFR can form homo- or
          heterodimers with other EGFR subfamily members. The
          EGFR signaling pathway is one of the most important
          pathways regulating cell proliferation,
          differentiation, survival, and growth. Overexpression
          and mutation in the kinase domain of EGFR have been
          implicated in the development and progression of a
          variety of cancers. A number of monoclonal antibodies
          and small molecule inhibitors have been developed that
          target EGFR, including the antibodies Cetuximab and
          Panitumumab, which are used in combination with other
          therapies for the treatment of colorectal cancer and
          non-small cell lung carcinoma (NSCLC). The small
          molecule inhibitors Gefitinib (Iressa) and Erlotinib
          (Tarceva), already used for NSCLC, are undergoing
          clinical trials for other types of cancer including
          gastrointestinal, breast, head and neck, and bladder.
          Length = 316

 Score = 36.5 bits (84), Expect = 6e-04
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 55 LKFVRKLGSGQFGEVWEGLW-----NNTTPVAIKTLK 86
           K ++ LGSG FG V++GLW         PVAIK L+
Sbjct: 9  FKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELR 45


>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine
          Kinases, Platelet Derived Growth Factor Receptors.
          Protein Tyrosine Kinase (PTK) family; Platelet Derived
          Growth Factor Receptor (PDGFR) subfamily; catalytic (c)
          domain. The PDGFR subfamily consists of PDGFR alpha,
          PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. PDGFR subfamily members are receptor tyr
          kinases (RTKs) containing an extracellular
          ligand-binding region with five immunoglobulin-like
          domains, a transmembrane segment, and an intracellular
          catalytic domain. PDGFR kinase domains are
          autoinhibited by their juxtamembrane regions containing
          tyr residues. The binding to their ligands leads to
          receptor dimerization, trans phosphorylation and
          activation, and intracellular signaling. PDGFR
          subfamily receptors are important in the development of
          a variety of cells. PDGFRs are expressed in a many
          cells including fibroblasts, neurons, endometrial
          cells, mammary epithelial cells, and vascular smooth
          muscle cells. PDGFR signaling is critical in normal
          embryonic development, angiogenesis, and wound healing.
          PDGFRs transduce mitogenic signals for connective
          tissue cells and are important for cell shape and
          motility. Kit is important in the development of
          melanocytes, germ cells, mast cells, hematopoietic stem
          cells, the interstitial cells of Cajal, and the
          pacemaker cells of the GI tract. CSF-1R signaling is
          critical in the regulation of macrophages and
          osteoclasts. Mammalian FLT3 plays an important role in
          the survival, proliferation, and differentiation of
          stem cells.
          Length = 302

 Score = 36.7 bits (85), Expect = 6e-04
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 6/46 (13%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEVWE----GLWNN--TTPVAIKTLK 86
          +WE  RN+L F + LG+G FG+V E    GL  +     VA+K LK
Sbjct: 29 KWEFPRNNLSFGKTLGAGAFGKVVEATAYGLSKSDAVMKVAVKMLK 74


>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine
          Kinases, Receptor tyrosine kinase-like Orphan
          Receptors.  Protein Tyrosine Kinase (PTK) family;
          Receptor tyrosine kinase-like Orphan Receptor (Ror)
          subfamily; catalytic (c) domain. The Ror subfamily
          consists of Ror1, Ror2, and similar proteins. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Ror
          proteins are orphan receptor tyr kinases (RTKs)
          containing an extracellular region with
          immunoglobulin-like, cysteine-rich, and kringle
          domains, a transmembrane segment, and an intracellular
          catalytic domain. Ror RTKs are unrelated to the nuclear
          receptor subfamily called retinoid-related orphan
          receptors (RORs). RTKs are usually activated through
          ligand binding, which causes dimerization and
          autophosphorylation of the intracellular tyr kinase
          catalytic domain. Ror kinases are expressed in many
          tissues during development. They play important roles
          in bone and heart formation. Mutations in human Ror2
          result in two different bone development genetic
          disorders, recessive Robinow syndrome and brachydactyly
          type B. Drosophila Ror is expressed only in the
          developing nervous system during neurite outgrowth and
          neuronal differentiation, suggesting a role for
          Drosophila Ror in neural development. More recently,
          mouse Ror1 and Ror2 have also been found to play an
          important role in regulating neurite growth in central
          neurons. Ror1 and Ror2 are believed to have some
          overlapping and redundant functions.
          Length = 283

 Score = 36.3 bits (84), Expect = 7e-04
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 6/44 (13%)

Query: 49 EIDRNSLKFVRKLGSGQFGEVWEG------LWNNTTPVAIKTLK 86
          EI  ++++F+ +LG G FG+V++G         + T VAIKTLK
Sbjct: 1  EIPLSAVRFLEELGEGAFGKVYKGELTGPNERLSATSVAIKTLK 44


>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine
          Kinase, Cyclin-Dependent protein Kinase 7.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 7 (CDK7) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK7 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDK7 plays essential roles in the cell cycle
          and in transcription. It associates with cyclin H and
          MAT1 and acts as a CDK-Activating Kinase (CAK) by
          phosphorylating and activating cell cycle CDKs
          (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is
          also a component of the general transcription factor
          TFIIH, which phosphorylates the C-terminal domain (CTD)
          of RNA polymerase II when it is bound with
          unphosphorylated DNA, as present in the pre-initiation
          complex. Following phosphorylation, the CTD dissociates
          from the DNA which allows transcription initiation.
          Length = 298

 Score = 36.4 bits (85), Expect = 7e-04
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%)

Query: 56 KFVRKLGSGQFGEVWEGLWNNT-TPVAIKTLKMGSI 90
          +  +KLG G +  V++     T   VAIK +K+G  
Sbjct: 3  EKGKKLGEGTYAVVYKARDKETGRIVAIKKIKLGER 38


>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine
          Kinases, Discoidin Domain Receptors.  Protein Tyrosine
          Kinase (PTK) family; Discoidin Domain Receptor (DDR)
          subfamily; catalytic (c) domain. The DDR subfamily
          consists of homologs of mammalian DDR1, DDR2, and
          similar proteins. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. DDR subfamily members are receptor tyr
          kinases (RTKs) containing an extracellular discoidin
          homology domain, a transmembrane segment, an extended
          juxtamembrane region, and an intracellular catalytic
          domain. The binding of the ligand, collagen, to DDRs
          results in a slow but sustained receptor activation.
          DDRs regulate cell adhesion, proliferation, and
          extracellular matrix remodeling. They have been linked
          to a variety of human cancers including breast, colon,
          ovarian, brain, and lung. There is no evidence showing
          that DDRs act as transforming oncogenes. They are more
          likely to play a role in the regulation of tumor growth
          and metastasis.
          Length = 296

 Score = 36.2 bits (84), Expect = 8e-04
 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 17/60 (28%)

Query: 49 EIDRNSLKFVRKLGSGQFGEV----------------WEGLWNN-TTPVAIKTLKMGSID 91
          E  R  L FV KLG GQFGEV                 E    +    VA+K L+  + D
Sbjct: 1  EFPRQPLNFVEKLGEGQFGEVHLCEADGLQDFSEKAFAENDNADAPVLVAVKVLRPDASD 60


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
          prediction only / Signal transduction mechanisms /
          Transcription / DNA replication, recombination, and
          repair].
          Length = 384

 Score = 35.9 bits (81), Expect = 0.001
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 54 SLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLK 86
          S + +RKLG G FGEV+     +   VA+K L 
Sbjct: 1  SYRILRKLGEGSFGEVYLAR--DRKLVALKVLA 31


>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine
          Kinase, Fer.  Protein Tyrosine Kinase (PTK) family; Fer
          kinase; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Fer
          kinase is a member of the Fes subfamily of proteins
          which are cytoplasmic (or nonreceptor) tyr kinases
          containing an N-terminal region with FCH (Fes/Fer/CIP4
          homology) and coiled-coil domains, followed by a SH2
          domain, and a C-terminal catalytic domain. Fer kinase
          is expressed in a wide variety of tissues, and is found
          to reside in both the cytoplasm and the nucleus. It
          plays important roles in neuronal polarization and
          neurite development, cytoskeletal reorganization, cell
          migration, growth factor signaling, and the regulation
          of cell-cell interactions mediated by adherens
          junctions and focal adhesions. Fer kinase also
          regulates cell cycle progression in malignant cells.
          Length = 250

 Score = 35.7 bits (82), Expect = 0.001
 Identities = 15/26 (57%), Positives = 19/26 (73%)

Query: 61 LGSGQFGEVWEGLWNNTTPVAIKTLK 86
          LG G FGEV++G   + TPVA+KT K
Sbjct: 3  LGKGNFGEVFKGTLKDKTPVAVKTCK 28


>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine
          Kinase, Insulin Receptor.  Protein Tyrosine Kinase
          (PTK) family; Insulin Receptor (InsR); catalytic (c)
          domain. The PTKc family is part of a larger superfamily
          that includes the catalytic domains of other kinases
          such as protein serine/threonine kinases, RIO kinases,
          and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. InsR is
          a receptor tyr kinase (RTK) that is composed of two
          alphabeta heterodimers. Binding of the insulin ligand
          to the extracellular alpha subunit activates the
          intracellular tyr kinase domain of the transmembrane
          beta subunit. Receptor activation leads to
          autophosphorylation, stimulating downstream kinase
          activities, which initiate signaling cascades and
          biological function. InsR signaling plays an important
          role in many cellular processes including glucose
          homeostasis, glycogen synthesis, lipid and protein
          metabolism, ion and amino acid transport, cell cycle
          and proliferation, cell differentiation, gene
          transcription, and nitric oxide synthesis. Insulin
          resistance, caused by abnormalities in InsR signaling,
          has been described in diabetes, hypertension,
          cardiovascular disease, metabolic syndrome, heart
          failure, and female infertility.
          Length = 288

 Score = 35.7 bits (82), Expect = 0.001
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 6/44 (13%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNT------TPVAIKTL 85
          WE+ R  +  +R+LG G FG V+EG   +       T VA+KT+
Sbjct: 1  WEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTV 44


>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine
          Kinase, Receptor tyrosine kinase-like Orphan Receptor
          2.  Protein Tyrosine Kinase (PTK) family; Receptor
          tyrosine kinase-like Orphan Receptor 2 (Ror2);
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. Ror proteins are orphan
          receptor tyr kinases (RTKs) containing an extracellular
          region with immunoglobulin-like, cysteine-rich, and
          kringle domains, a transmembrane segment, and an
          intracellular catalytic domain. Ror RTKs are unrelated
          to the nuclear receptor subfamily called
          retinoid-related orphan receptors (RORs). RTKs are
          usually activated through ligand binding, which causes
          dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain. Ror2 plays
          important roles in skeletal and heart formation.
          Ror2-deficient mice show widespread bone abnormalities,
          ventricular defects in the heart, and respiratory
          dysfunction. Mutations in human Ror2 result in two
          different bone development genetic disorders, recessive
          Robinow syndrome and brachydactyly type B. Ror2 is also
          implicated in neural development.
          Length = 283

 Score = 35.4 bits (81), Expect = 0.001
 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 6/44 (13%)

Query: 49 EIDRNSLKFVRKLGSGQFGEVWEGLWNNTTP------VAIKTLK 86
          EI+ ++++F+ +LG  +FG+V++G    T P      VAIKTLK
Sbjct: 1  EINLSTVRFMEELGEDRFGKVYKGHLFGTAPGEQTQAVAIKTLK 44


>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine
          Kinases, Tropomyosin Related Kinases.  Protein Tyrosine
          Kinase (PTK) family; Tropomyosin Related Kinase (Trk)
          subfamily; catalytic (c) domain. The Trk subfamily
          consists of TrkA, TrkB, TrkC, and similar proteins. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Trk
          subfamily members are receptor tyr kinases (RTKs)
          containing an extracellular region with arrays of
          leucine-rich motifs flanked by two cysteine-rich
          clusters followed by two immunoglobulin-like domains, a
          transmembrane segment, and an intracellular catalytic
          domain. Binding to their ligands, the nerve growth
          factor (NGF) family of neutrotrophins, leads to Trk
          receptor oligomerization and activation of the
          catalytic domain. Trk receptors are mainly expressed in
          the peripheral and central nervous systems. They play
          important roles in cell fate determination, neuronal
          survival and differentiation, as well as in the
          regulation of synaptic plasticity. Altered expression
          of Trk receptors is associated with many human
          diseases.
          Length = 280

 Score = 35.1 bits (81), Expect = 0.002
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 49 EIDRNSLKFVRKLGSGQFGEVWEGLWNNTTP------VAIKTLKMGSID 91
           + R+++   R+LG G FG+V+ G   +  P      VA+KTLK  + +
Sbjct: 1  HVQRDTIVLKRELGEGAFGKVFLGECYHLEPENDKELVAVKTLKETASN 49


>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine
          Kinases, Class EphA Ephrin Receptors.  Protein Tyrosine
          Kinase (PTK) family; Ephrin Receptor (EphR) subfamily;
          most class EphA receptors including EphA3, EphA4,
          EphA5, and EphA7, but excluding EphA1, EphA2 and
          EphA10; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). In general, class EphA receptors bind
          GPI-anchored ephrin-A ligands. There are ten vertebrate
          EphA receptors (EphA1-10), which display promiscuous
          interactions with six ephrin-A ligands. One exception
          is EphA4, which also binds ephrins-B2/B3. EphRs contain
          an ephrin-binding domain and two fibronectin repeats
          extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling).
          Ephrin/EphR interaction mainly results in cell-cell
          repulsion or adhesion, making it important in neural
          development and plasticity, cell morphogenesis,
          cell-fate determination, embryonic development, tissue
          patterning, and angiogenesis. EphARs and ephrin-A
          ligands are expressed in multiple areas of the
          developing brain, especially in the retina and tectum.
          They are part of a system controlling retinotectal
          mapping.
          Length = 267

 Score = 34.9 bits (80), Expect = 0.002
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLW----NNTTPVAIKTLKMGSID 91
          ID + +K  + +G+G+FGEV  G          PVAIKTLK G  +
Sbjct: 1  IDASCIKIEKVIGAGEFGEVCSGRLKLPGKREIPVAIKTLKAGYTE 46


>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein
          Tyrosine Kinase, Platelet Derived Growth Factor
          Receptor beta.  Protein Tyrosine Kinase (PTK) family;
          Platelet Derived Growth Factor Receptor (PDGFR) beta;
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. PDGFR beta is a
          receptor tyr kinase (RTK) containing an extracellular
          ligand-binding region with five immunoglobulin-like
          domains, a transmembrane segment, and an intracellular
          catalytic domain. The binding to its ligands, the
          PDGFs, leads to receptor dimerization, trans
          phosphorylation and activation, and intracellular
          signaling. PDGFR beta forms homodimers or heterodimers
          with PDGFR alpha, depending on the nature of the PDGF
          ligand. PDGF-BB and PDGF-DD induce PDGFR beta
          homodimerization. PDGFR signaling plays many roles in
          normal embryonic development and adult physiology.
          PDGFR beta signaling leads to a variety of cellular
          effects including the stimulation of cell growth and
          chemotaxis, as well as the inhibition of apoptosis and
          GAP junctional communication. It is critical in normal
          angiogenesis as it is involved in the recruitment of
          pericytes and smooth muscle cells essential for vessel
          stability. Aberrant PDGFR beta expression is associated
          with some human cancers. The continuously-active fusion
          proteins of PDGFR beta with COL1A1 and TEL are
          associated with dermatofibrosarcoma protuberans (DFSP)
          and a subset of chronic myelomonocytic leukemia (CMML),
          respectively.
          Length = 401

 Score = 35.0 bits (80), Expect = 0.002
 Identities = 21/45 (46%), Positives = 27/45 (60%), Gaps = 6/45 (13%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWE----GLWNN--TTPVAIKTLK 86
          WE+ R++L   R LGSG FG V E    GL ++  T  VA+K LK
Sbjct: 32 WEMPRDNLVLGRTLGSGAFGRVVEATAHGLSHSQSTMKVAVKMLK 76


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c)
          domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The STE family
          is part of a larger superfamily that includes the
          catalytic domains of other protein serine/threonine
          kinases (STKs), protein tyrosine kinases (PTKs), RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase (PI3K). This
          family is composed of STKs, and some dual-specificity
          PKs that phosphorylate both threonine and tyrosine
          residues of target proteins. Most members are kinases
          involved in mitogen-activated protein kinase (MAPK)
          signaling cascades, acting as MAPK kinases (MAPKKs),
          MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase
          kinases (MAP4Ks). The MAPK signaling pathways are
          important mediators of cellular responses to
          extracellular signals. The pathways involve a triple
          kinase core cascade comprising of the MAPK, which is
          phosphorylated and activated by a MAPKK, which itself
          is phosphorylated and activated by a MAPKKK. Each MAPK
          cascade is activated either by a small GTP-binding
          protein or by an adaptor protein, which transmits the
          signal either directly to a MAPKKK to start the triple
          kinase core cascade or indirectly through a mediator
          kinase, a MAP4K. Other STE family members include
          p21-activated kinases (PAKs) and class III myosins,
          among others. PAKs are Rho family GTPase-regulated
          kinases that serve as important mediators in the
          function of Cdc42 (cell division cycle 42) and Rac.
          Class III myosins are motor proteins containing an
          N-terminal kinase catalytic domain and a C-terminal
          actin-binding domain, which can phosphorylate several
          cytoskeletal proteins, conventional myosin regulatory
          light chains, as well as autophosphorylate the
          C-terminal motor domain. They play an important role in
          maintaining the structural integrity of photoreceptor
          cell microvilli.
          Length = 253

 Score = 34.9 bits (81), Expect = 0.002
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 56 KFVRKLGSGQFGEVWEGLWNNT-TPVAIKTLK 86
          + + K+G G FGEV++     T   VAIK +K
Sbjct: 3  EILEKIGKGGFGEVYKARHKRTGKEVAIKVIK 34


>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine
          Kinase, Insulin-like Growth Factor-1 Receptor.  Protein
          Tyrosine Kinase (PTK) family; Insulin-like Growth
          Factor-1 Receptor (IGF-1R); catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. IGF-1R
          is a receptor tyr kinases (RTK) that is composed of two
          alphabeta heterodimers. Binding of the ligand (IGF-1 or
          IGF-2) to the extracellular alpha subunit activates the
          intracellular tyr kinase domain of the transmembrane
          beta subunit. Receptor activation leads to
          autophosphorylation, which stimulates downstream kinase
          activities and biological function. IGF-1R signaling is
          important in the differentiation, growth, and survival
          of normal cells. In cancer cells, where it is
          frequently overexpressed, IGF-1R is implicated in
          proliferation, the suppression of apoptosis, invasion,
          and metastasis. IGF-1R is being developed as a
          therapeutic target in cancer treatment.
          Length = 277

 Score = 35.0 bits (80), Expect = 0.002
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 6/44 (13%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNT------TPVAIKTL 85
          WE+ R  +   R+LG G FG V+EG+          T VAIKT+
Sbjct: 1  WEVAREKITMSRELGQGSFGMVYEGIAKGVVKDEPETRVAIKTV 44


>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine
          Kinase, Muscle-specific kinase.  Protein Tyrosine
          Kinase (PTK) family; Muscle-specific kinase (Musk);
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. Musk is a receptor tyr
          kinase (RTK) containing an extracellular region with
          four immunoglobulin-like domains and a cysteine-rich
          cluster, a transmembrane segment, and an intracellular
          catalytic domain. Musk is expressed and concentrated in
          the postsynaptic membrane in skeletal muscle. It is
          essential for the establishment of the neuromuscular
          junction (NMJ), a peripheral synapse that conveys
          signals from motor neurons to muscle cells. Agrin, a
          large proteoglycan released from motor neurons,
          stimulates Musk autophosphorylation and activation,
          leading to the clustering of acetylcholine receptors
          (AChRs). To date, there is no evidence to suggest that
          agrin binds directly to Musk. Mutations in AChR, Musk
          and other partners are responsible for diseases of the
          NMJ, such as the autoimmune syndrome myasthenia gravis.
          Length = 288

 Score = 34.8 bits (80), Expect = 0.003
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 6/47 (12%)

Query: 49 EIDRNSLKFVRKLGSGQFGEVWE----GL--WNNTTPVAIKTLKMGS 89
          E  RN++++VR +G G FG V++    GL  +   T VA+K LK  +
Sbjct: 1  EYPRNNIEYVRDIGQGAFGRVFQARAPGLLPYEPFTMVAVKMLKEEA 47


>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine
          Kinase, Ephrin Receptor A10.  Protein Tyrosine Kinase
          (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10
          receptor; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). In general, class EphA receptors bind
          GPI-anchored ephrin-A ligands. There are ten vertebrate
          EphA receptors (EphA1-10), which display promiscuous
          interactions with six ephrin-A ligands. EphRs contain
          an ephrin binding domain and two fibronectin repeats
          extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling). EphA10,
          which contains an inactive tyr kinase domain, may
          function to attenuate signals of co-clustered active
          receptors. EphA10 is mainly expressed in the testis.
          Ephrin/EphR interaction results in cell-cell repulsion
          or adhesion, making it important in neural development
          and plasticity, cell morphogenesis, cell-fate
          determination, embryonic development, tissue
          patterning, and angiogenesis.
          Length = 266

 Score = 34.5 bits (79), Expect = 0.003
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 49 EIDRNSLKFVRKLGSGQFGEVWEGLWN----NTTPVAIKTLKMGSID 91
          E+D  S+K  R LG+G+FGE+  G          PVAI TL+ G  D
Sbjct: 1  ELDNKSIKIERILGTGRFGELCRGCLKLPSKRELPVAIHTLRAGCSD 47


>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine
          Kinase, Ephrin Receptor A2.  Protein Tyrosine Kinase
          (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2
          receptor; catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). In general, class EphA receptors bind
          GPI-anchored ephrin-A ligands. There are ten vertebrate
          EphA receptors (EphA1-10), which display promiscuous
          interactions with six ephrin-A ligands. EphRs contain
          an ephrin binding domain and two fibronectin repeats
          extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling).
          Ephrin/EphR interaction mainly results in cell-cell
          repulsion or adhesion, making it important in neural
          development and plasticity, cell morphogenesis,
          cell-fate determination, embryonic development, tissue
          patterning, and angiogenesis. The EphA2 receptor is
          overexpressed in tumor cells and tumor blood vessels in
          a variety of cancers including breast, prostate, lung,
          and colon. As a result, it is an attractive target for
          drug design since its inhibition could affect several
          aspects of tumor progression.
          Length = 268

 Score = 34.6 bits (79), Expect = 0.003
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 4/44 (9%)

Query: 49 EIDRNSLKFVRKLGSGQFGEVWEGLWN----NTTPVAIKTLKMG 88
          EI  + +   + +G+G+FGEV+ G+          VAIKTLK G
Sbjct: 1  EIHPSHITKQKVIGAGEFGEVFRGILKMPGRKEVAVAIKTLKPG 44


>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine
          Kinase, Vascular Endothelial Growth Factor Receptor 3. 
          Protein Tyrosine Kinase (PTK) family; Vascular
          Endothelial Growth Factor Receptor 3 (VEGFR3);
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. VEGFR3 (or Flt4) is a
          member of the VEGFR subfamily of proteins, which are
          receptor tyr kinases (RTKs) containing an extracellular
          ligand-binding region with seven immunoglobulin
          (Ig)-like domains, a transmembrane segment, and an
          intracellular catalytic domain. In VEGFR3, the fifth
          Ig-like domain is replaced by a disulfide bridge. The
          binding of VEGFRs to their ligands, the VEGFs, leads to
          receptor dimerization, activation, and intracellular
          signaling. VEGFR3 preferentially binds the ligands
          VEGFC and VEGFD. VEGFR3 is essential for lymphatic
          endothelial cell (EC) development and function. It has
          been shown to regulate adaptive immunity during corneal
          transplantation. VEGFR3 is upregulated on blood
          vascular ECs in pathological conditions such as
          vascular tumors and the periphery of solid tumors. It
          plays a role in cancer progression and lymph node
          metastasis. Missense mutations in the VEGFR3 gene are
          associated with primary human lymphedema.
          Length = 338

 Score = 33.8 bits (77), Expect = 0.005
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEVWEGLW------NNTTPVAIKTLKMGS 89
          QWE  R+ L+  + LG G FG+V E         ++   VA+K LK G+
Sbjct: 1  QWEFPRDRLRLGKVLGHGAFGKVVEASAFGIDKKSSCNTVAVKMLKEGA 49


>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine
          Kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
          Kinase (PTK) family; Spleen Tyrosine Kinase (Syk)
          subfamily; catalytic (c) domain. The Syk subfamily is
          composed of Syk, ZAP-70, Shark, and similar proteins.
          The PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Syk
          subfamily kinases are cytoplasmic (or nonreceptor) tyr
          kinases containing two Src homology 2 (SH2) domains
          N-terminal to the catalytic tyr kinase domain. They are
          involved in the signaling downstream of activated
          receptors (including B-cell, T-cell, and Fc receptors)
          that contain ITAMs (immunoreceptor tyr activation
          motifs), leading to processes such as cell
          proliferation, differentiation, survival, adhesion,
          migration, and phagocytosis. Syk is important in B-cell
          receptor (BCR) signaling, while Zap-70 is primarily
          expressed in T-cells and NK cells, and is a crucial
          component in T-cell receptor (TCR) signaling. Syk also
          plays a central role in Fc receptor-mediated
          phagocytosis in the adaptive immune system. Shark is
          exclusively expressed in ectodermally derived
          epithelia, and is localized preferentially to the
          apical surface of the epithelial cells, it may play a
          role in a signaling pathway for epithelial cell
          polarity.
          Length = 257

 Score = 33.5 bits (77), Expect = 0.006
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%)

Query: 59 RKLGSGQFGEVWEGLW----NNTTPVAIKTLKMGSID 91
          ++LG G FG V +G++         VA+KTLK   I 
Sbjct: 1  KELGHGNFGSVVKGVYLMKSGKEVEVAVKTLKQEHIA 37


>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine
          Kinase, HER4.  Protein Tyrosine Kinase (PTK) family;
          HER4 (ErbB4); catalytic (c) domain. The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. HER4 is
          a member of the EGFR (HER, ErbB) subfamily of proteins,
          which are receptor tyr kinases (RTKs) containing an
          extracellular EGF-related ligand-binding region, a
          transmembrane helix, and a cytoplasmic region with a
          tyr kinase domain and a regulatory C-terminal tail.
          Unlike other tyr kinases, phosphorylation of the
          activation loop of EGFR proteins is not critical to
          their activation. Instead, they are activated by
          ligand-induced dimerization, leading to the
          phosphorylation of tyr residues in the C-terminal tail,
          which serve as binding sites for downstream signaling
          molecules. Ligands that bind HER4 fall into two groups,
          the neuregulins (or heregulins) and some EGFR (HER1)
          ligands including betacellulin, HBEGF, and epiregulin.
          All four neuregulins (NRG1-4) interact with HER4. Upon
          ligand binding, HER4 forms homo- or heterodimers with
          other HER proteins. HER4 is essential in embryonic
          development. It is implicated in mammary gland,
          cardiac, and neural development. As a postsynaptic
          receptor of NRG1, HER4 plays an important role in
          synaptic plasticity and maturation. The impairment of
          NRG1/HER4 signaling may contribute to schizophrenia.
          Length = 303

 Score = 33.5 bits (76), Expect = 0.007
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLW-----NNTTPVAIKTL 85
          +    LK V+ LGSG FG V++G+W         PVAIK L
Sbjct: 4  LKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKIL 44


>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine
          Kinases, Class EphB Ephrin Receptors.  Protein Tyrosine
          Kinase (PTK) family; Ephrin Receptor (EphR) subfamily;
          class EphB receptors; catalytic (c) domain. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. EphRs
          comprise the largest subfamily of receptor tyr kinases
          (RTKs). Class EphB receptors bind to transmembrane
          ephrin-B ligands. There are six vertebrate EhpB
          receptors (EphB1-6), which display promiscuous
          interactions with three ephrin-B ligands. One exception
          is EphB2, which also interacts with ephrin A5. EphRs
          contain an ephrin-binding domain and two fibronectin
          repeats extracellularly, a transmembrane segment, and a
          cytoplasmic tyr kinase domain. Binding of the ephrin
          ligand to EphR requires cell-cell contact since both
          are anchored to the plasma membrane. The resulting
          downstream signals occur bidirectionally in both
          EphR-expressing cells (forward signaling) and
          ephrin-expressing cells (reverse signaling).
          Ephrin/EphR interaction mainly results in cell-cell
          repulsion or adhesion. EphBRs play important roles in
          synapse formation and plasticity, spine morphogenesis,
          axon guidance, and angiogenesis. In the intestinal
          epithelium, EphBRs are Wnt signaling target genes that
          control cell compartmentalization. They function as
          suppressors of color cancer progression.
          Length = 269

 Score = 33.3 bits (76), Expect = 0.009
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 4/43 (9%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLWN----NTTPVAIKTLKMG 88
          ID + +K    +G+G+FGEV  G           VAIKTLK G
Sbjct: 1  IDVSCVKIEEVIGAGEFGEVCRGRLKLPGKREIFVAIKTLKSG 43


>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein
          Tyrosine Kinase, Platelet Derived Growth Factor
          Receptor alpha.  Protein Tyrosine Kinase (PTK) family;
          Platelet Derived Growth Factor Receptor (PDGFR) alpha;
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. PDGFR alpha is a
          receptor tyr kinase (RTK) containing an extracellular
          ligand-binding region with five immunoglobulin-like
          domains, a transmembrane segment, and an intracellular
          catalytic domain. The binding to its ligands, the
          PDGFs, leads to receptor dimerization, trans
          phosphorylation and activation, and intracellular
          signaling. PDGFR alpha forms homodimers or heterodimers
          with PDGFR beta, depending on the nature of the PDGF
          ligand. PDGF-AA, PDGF-AB, and PDGF-CC induce PDGFR
          alpha homodimerization. PDGFR signaling plays many
          roles in  normal embryonic development and adult
          physiology. PDGFR alpha signaling is important in the
          formation of lung alveoli, intestinal villi,
          mesenchymal dermis, and hair follicles, as well as in
          the development of oligodendrocytes, retinal
          astrocytes, neural crest cells, and testicular cells.
          Aberrant PDGFR alpha expression is associated with some
          human cancers. Mutations in PDGFR alpha have been found
          within a subset of gastrointestinal stromal tumors
          (GISTs). An active fusion protein FIP1L1-PDGFR alpha,
          derived from interstitial deletion, is associated with
          idiopathic hypereosinophilic syndrome (HES) and chronic
          eosinophilic leukemia (CEL).
          Length = 400

 Score = 33.1 bits (75), Expect = 0.012
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 6/46 (13%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEVWEGL---WNNTTP---VAIKTLK 86
          +WE  R+ L   R LGSG FG+V EG     + + P   VA+K LK
Sbjct: 31 RWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLK 76


>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine
          Kinase, Vascular Endothelial Growth Factor Receptor 2. 
          Protein Tyrosine Kinase (PTK) family; Vascular
          Endothelial Growth Factor Receptor 2 (VEGFR2);
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. VEGFR2 (or Flk1) is a
          member of the VEGFR subfamily of proteins, which are
          receptor tyr kinases (RTKs) containing an extracellular
          ligand-binding region with seven immunoglobulin
          (Ig)-like domains, a transmembrane segment, and an
          intracellular catalytic domain. The binding of VEGFRs
          to their ligands, the VEGFs, leads to receptor
          dimerization, activation, and intracellular signaling.
          The carboxyl terminus of VEGFR2 plays an important role
          in its autophosphorylation and activation. VEGFR2 binds
          the ligands VEGFA, VEGFC, VEGFD and VEGFE. VEGFR2
          signaling is implicated in all aspects of normal and
          pathological vascular endothelial cell biology. It
          induces a variety of cellular effects including
          migration, survival, and proliferation. It is critical
          in regulating embryonic vascular development and
          angiogenesis. VEGFR2 is the major signal transducer in
          pathological angiogenesis including cancer and diabetic
          retinopathy, and is a target for inhibition in cancer
          therapy.
          Length = 343

 Score = 32.7 bits (74), Expect = 0.013
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEVWE----GLWNNTT--PVAIKTLKMGS 89
          +WE  R+ LK  + LG G FG+V E    G+    T   VA+K LK G+
Sbjct: 1  KWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGA 49


>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain
          Receptor-like Protein Tyrosine Kinases.  Protein
          Tyrosine Kinase (PTK) family; Discoidin Domain Receptor
          (DDR)-like proteins; catalytic (c) domain. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. DDR-like
          proteins are members of the DDR subfamily, which are
          receptor tyr kinases (RTKs) containing an extracellular
          discoidin homology domain, a transmembrane segment, an
          extended juxtamembrane region, and an intracellular
          catalytic domain. The binding of the ligand, collagen,
          to DDRs results in a slow but sustained receptor
          activation. DDRs regulate cell adhesion, proliferation,
          and extracellular matrix remodeling. They have been
          linked to a variety of human cancers including breast,
          colon, ovarian, brain, and lung. There is no evidence
          showing that DDRs act as transforming oncogenes. They
          are more likely to play a role in the regulation of
          tumor growth and metastasis.
          Length = 295

 Score = 31.9 bits (72), Expect = 0.027
 Identities = 12/21 (57%), Positives = 13/21 (61%)

Query: 49 EIDRNSLKFVRKLGSGQFGEV 69
          E  R  L+   KLG GQFGEV
Sbjct: 1  EFPRQQLRLKEKLGEGQFGEV 21


>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division
          control protein 7-like Protein Serine/Threonine
          Kinases.  Serine/threonine kinases (STKs),  (Cdc7)-like
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Cdc7-like subfamily is part of a larger superfamily
          that includes the catalytic domains of other protein
          STKs, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Members of this subfamily
          include Schizosaccharomyces pombe Cdc7, Saccharomyces
          cerevisiae Cdc15, Arabidopsis thaliana
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK) epsilon, and related proteins. MAPKKKs
          phosphorylate and activate MAPK kinases (MAPKKs or MKKs
          or MAP2Ks), which in turn phosphorylate and activate
          MAPKs during signaling cascades that are important in
          mediating cellular responses to extracellular signals.
          Fission yeast Cdc7 is essential for cell division by
          playing a key role in the initiation of septum
          formation and cytokinesis. Budding yeast Cdc15
          functions to coordinate mitotic exit with cytokinesis.
          Arabidopsis MAPKKK epsilon is required for pollen
          development in the plasma membrane.
          Length = 254

 Score = 31.8 bits (73), Expect = 0.027
 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 60 KLGSGQFGEVWEGL-WNNTTPVAIKTLKMGSID 91
           +G G FG V++GL       VAIK + +  I 
Sbjct: 7  LIGRGAFGVVYKGLNLETGDFVAIKQISLEKIK 39


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
          Serine/Threonine Kinases, Mammalian Ste20-like protein
          kinase 1 and 2.  Serine/threonine kinases (STKs),
          mammalian Ste20-like protein kinase 1 (MST1) and MST2
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MST1/2 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of MST1, MST2, and related proteins including
          Drosophila Hippo and Dictyostelium discoideum Krs1
          (kinase responsive to stress 1). MST1/2 and Hippo are
          involved in a conserved pathway that governs cell
          contact inhibition, organ size control, and tumor
          development. MST1 activates the mitogen-activated
          protein kinases (MAPKs) p38 and c-Jun N-terminal kinase
          (JNK) through MKK7 (a MAPK kinase) and MEKK1 (a MAPK
          kinase kinase) by acting as a MAPK kinase kinase kinase
          (MAPKKKK). Activation of JNK by MST1 leads to caspase
          activation and apoptosis. MST1 has also been implicated
          in cell proliferation and differentiation. Krs1 may
          regulate cell growth arrest and apoptosis in response
          to cellular stress.
          Length = 256

 Score = 31.9 bits (73), Expect = 0.030
 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 57 FVRKLGSGQFGEVWEGLWNNT-TPVAIKTLKMGS 89
           + KLG G +G V++ +   T   VAIK + +  
Sbjct: 7  ILEKLGEGSYGSVYKAIHKETGQVVAIKVVPVEE 40


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
          protein Kinase-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase (CDK)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. CDKs are partly regulated by their
          subcellular localization, which defines substrate
          phosphorylation and the resulting specific function.
          CDK1, CDK2, CDK4, and CDK6 have well-defined functions
          in the cell cycle, such as the regulation of the early
          G1 phase by CDK4 or CDK6, the G1/S phase transition by
          CDK2, or the entry of mitosis by CDK1. They also
          exhibit overlapping cyclin specificity and functions in
          certain conditions. Knockout mice with a single CDK
          deleted remain viable with specific phenotypes, showing
          that some CDKs can compensate for each other. For
          example, CDK4 can compensate for the loss of CDK6,
          however, double knockout mice with both CDK4 and CDK6
          deleted die in utero. CDK8 and CDK9 are mainly involved
          in transcription while CDK5 is implicated in neuronal
          function. CDK7 plays essential roles in both the cell
          cycle as a CDK-Activating Kinase (CAK) and in
          transcription as a component of the general
          transcription factor TFIIH.
          Length = 282

 Score = 31.3 bits (72), Expect = 0.039
 Identities = 10/32 (31%), Positives = 19/32 (59%), Gaps = 3/32 (9%)

Query: 58 VRKLGSGQFGEVWEGLWNNTT--PVAIKTLKM 87
          + KLG G +G V++   +  T   VA+K +++
Sbjct: 4  LEKLGEGTYGVVYKA-RDKKTGEIVALKKIRL 34


>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine
          Kinase, Discoidin Domain Receptor 2.  Protein Tyrosine
          Kinase (PTK) family; mammalian Discoidin Domain
          Receptor 2 (DDR2) and homologs; catalytic (c) domain.
          The PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. DDR2 is
          a member of the DDR subfamily, which are receptor tyr
          kinases (RTKs) containing an extracellular discoidin
          homology domain, a transmembrane segment, an extended
          juxtamembrane region, and an intracellular catalytic
          domain. The binding of the ligand, collagen, to DDRs
          results in a slow but sustained receptor activation.
          DDR2 binds mostly to fibrillar collagens. More
          recently, it has been reported to also bind collagen X.
          DDR2 is widely expressed in many tissues with the
          highest levels found in skeletal muscle, skin, kidney
          and lung. It is important in cell proliferation and
          development. Mice, with a deletion of DDR2, suffer from
          dwarfism and delayed healing of epidermal wounds. DDR2
          also contributes to collagen (type I) regulation by
          inhibiting fibrillogenesis and altering the morphology
          of collagen fibers. It is also expressed in immature
          dendritic cells (DCs), where it plays a role in DC
          activation and function.
          Length = 296

 Score = 31.0 bits (70), Expect = 0.048
 Identities = 13/21 (61%), Positives = 13/21 (61%)

Query: 49 EIDRNSLKFVRKLGSGQFGEV 69
          E  R  L F  KLG GQFGEV
Sbjct: 1  EFPRKRLTFKEKLGEGQFGEV 21


>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like
          protein kinase 3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), mammalian Ste20-like
          protein kinase 3 (MST3)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MST3-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. This subfamily is composed
          of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1
          and Sid1, Saccharomyces cerevisiae sporulation-specific
          protein 1 (SPS1), and related proteins. Nak1 is
          required by fission yeast for polarizing the tips of
          actin cytoskeleton and is involved in cell growth, cell
          separation, cell morphology and cell-cycle progression.
          Sid1 is a component in the septation initiation network
          (SIN) signaling pathway, and plays a role in
          cytokinesis. SPS1 plays a role in regulating proteins
          required for spore wall formation. MST4 plays a role in
          mitogen-activated protein kinase (MAPK) signaling
          during cytoskeletal rearrangement, morphogenesis, and
          apoptosis. MST3 phosphorylates the STK NDR and may play
          a role in cell cycle progression and cell morphology.
          STK25 may play a role in the regulation of cell
          migration and polarization.
          Length = 274

 Score = 30.7 bits (70), Expect = 0.076
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%)

Query: 59 RKLGSGQFGEVWEGLWNNT-TPVAIK 83
            +G G FGEV++ +   T   VAIK
Sbjct: 7  ECIGKGSFGEVYKAIDKRTNQVVAIK 32


>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine
          Kinase, Fungal Cyclin-Dependent protein Kinase Bypass
          UAS Requirement 1 and similar proteins.
          Serine/Threonine Kinases (STKs), Bypass UAS Requirement
          1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          BUR1 subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. BUR1, also called SGV1, is a yeast
          Cyclin-Dependent protein Kinase (CDK) that is
          functionally equivalent to mammalian CDK9. It
          associates with the cyclin BUR2. BUR genes were
          orginally identified in a genetic screen as factors
          involved in general transcription. The BUR1/BUR2
          complex phosphorylates the C-terminal domain of RNA
          polymerase II. In addition, this complex regulates
          histone modification by phosporylating Rad6 and
          mediating the association of the Paf1 complex with
          chromatin.
          Length = 311

 Score = 30.4 bits (69), Expect = 0.078
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 56 KFVRKLGSGQFGEVWEGLWNNT-TPVAIKTLKM 87
          + + KLG G FGEV++     T   VA+K + M
Sbjct: 11 EILGKLGEGTFGEVYKARQIKTGRVVALKKILM 43


>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine
          Kinase, HER3.  Protein Tyrosine Kinase (PTK) family;
          HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic
          domain) family to which this subfamily belongs, is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. HER3 is
          a member of the EGFR (HER, ErbB) subfamily of proteins,
          which are receptor tyr kinases (RTKs) containing an
          extracellular EGF-related ligand-binding region, a
          transmembrane helix, and a cytoplasmic region with a
          tyr kinase domain and a regulatory C-terminal tail.
          Unlike other tyr kinases, phosphorylation of the
          activation loop of EGFR proteins is not critical to
          their activation. Instead, they are activated by
          ligand-induced dimerization, leading to the
          phosphorylation of tyr residues in the C-terminal tail,
          which serve as binding sites for downstream signaling
          molecules. HER3 binds the neuregulin ligands, NRG1 and
          NRG2. HER3 contains an impaired tyr kinase domain and
          relies on its heterodimerization partners for activity
          following ligand binding. The HER2-HER3 heterodimer
          constitutes a high affinity co-receptor capable of
          potent mitogenic signaling. HER3 participates in a
          signaling pathway involved in the proliferation,
          survival, adhesion, and motility of tumor cells.
          Length = 279

 Score = 30.3 bits (68), Expect = 0.086
 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 5/37 (13%)

Query: 55 LKFVRKLGSGQFGEVWEGLW-----NNTTPVAIKTLK 86
          L+ ++ LGSG FG V +G+W     +   PVAIKT++
Sbjct: 9  LRKLKLLGSGVFGTVHKGIWIPEGDSIKIPVAIKTIQ 45


>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine
          Kinase, Discoidin Domain Receptor 1.  Protein Tyrosine
          Kinase (PTK) family; mammalian Discoidin Domain
          Receptor 1 (DDR1) and homologs; catalytic (c) domain.
          The PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. DDR1 is
          a member of the DDR subfamily, which are receptor tyr
          kinases (RTKs) containing an extracellular discoidin
          homology domain, a transmembrane segment, an extended
          juxtamembrane region, and an intracellular catalytic
          domain. The binding of the ligand, collagen, to DDRs
          results in a slow but sustained receptor activation.
          DDR1 binds to all collagens tested to date (types
          I-IV). It is widely expressed in many tissues. It is
          abundant in the brain and is also found in
          keratinocytes, colonic mucosa epithelium, lung
          epithelium, thyroid follicles, and the islets of
          Langerhans. During embryonic development, it is found
          in the developing neuroectoderm. DDR1 is a key
          regulator of cell morphogenesis, differentiation and
          proliferation. It is important in the development of
          the mammary gland, the vasculator and the kidney. DDR1
          is also found in human leukocytes, where it facilitates
          cell adhesion, migration, maturation, and cytokine
          production.
          Length = 304

 Score = 30.3 bits (68), Expect = 0.092
 Identities = 12/21 (57%), Positives = 13/21 (61%)

Query: 49 EIDRNSLKFVRKLGSGQFGEV 69
          +  R  L F  KLG GQFGEV
Sbjct: 1  KFPRGHLLFKEKLGEGQFGEV 21


>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic
          subunit; Provisional.
          Length = 340

 Score = 29.9 bits (67), Expect = 0.12
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 41 SHSTRDQWEIDRNSLKFVRKLGSGQFGEVWEGLWNNTT--PVAIKTLKMGSI 90
          +   + + ++      F+R LG+G FG V    + N    PVAIK  +   I
Sbjct: 18 TKEPKRKNKMKYEDFNFIRTLGTGSFGRVILATYKNEDFPPVAIKRFEKSKI 69


>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein
          Serine/Threonine Kinase, cAMP-dependent protein kinase.
           Serine/Threonine Kinases (STKs), cAMP-dependent
          protein kinase (PKA) subfamily, catalytic (c) subunit.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The PKA subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase (PI3K). This
          subfamily is composed of the cAMP-dependent proteins
          kinases, PKA and PRKX. The inactive PKA holoenzyme is a
          heterotetramer composed of two phosphorylated and
          active catalytic (C) subunits with a dimer of
          regulatory (R) subunits. Activation is achieved through
          the binding of the important second messenger cAMP to
          the R subunits, which leads to the dissociation of PKA
          into the R dimer and two active C subunits. PKA is
          present ubiquitously in cells and interacts with many
          different downstream targets. It plays a role in the
          regulation of diverse processes such as growth,
          development, memory, metabolism, gene expression,
          immunity, and lipolysis.
          Length = 290

 Score = 29.8 bits (68), Expect = 0.15
 Identities = 10/35 (28%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 53 NSLKFVRKLGSGQFGEVWEGLWNNTTPV-AIKTLK 86
          +  +F++ LG+G FG V       +    A+K L 
Sbjct: 1  DDFEFIKTLGTGSFGRVMLVRHKGSGKYYALKILS 35


>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine
          Kinase, C-terminal Src kinase.  Protein Tyrosine Kinase
          (PTK) family; C-terminal Src kinase (Csk); catalytic
          (c) domain. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. The Csk subfamily kinases are cytoplasmic
          (or nonreceptor) tyr kinases containing the Src
          homology domains, SH3 and SH2, N-terminal to the
          catalytic tyr kinase domain. They negatively regulate
          the activity of Src kinases that are anchored to the
          plasma membrane. To inhibit Src kinases, Csk is
          translocated to the membrane via binding to specific
          transmembrane proteins, G-proteins, or adaptor proteins
          near the membrane. Csk catalyzes the tyr
          phosphorylation of the regulatory C-terminal tail of
          Src kinases, resulting in their inactivation. Csk is
          expressed in a wide variety of tissues. As a negative
          regulator of Src, Csk plays a role in cell
          proliferation, survival, and differentiation, and
          consequently, in cancer development and progression. In
          addition, Csk also shows Src-independent functions. It
          is a critical component in G-protein signaling, and
          plays a role in cytoskeletal reorganization and cell
          migration.
          Length = 256

 Score = 29.6 bits (66), Expect = 0.16
 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLK 86
          W ++   LK ++ +G G+FG+V  G +     VA+K +K
Sbjct: 1  WALNMKELKLLQTIGKGEFGDVMLGDYRGNK-VAVKCIK 38


>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine
          Kinase, Fibroblast Growth Factor Receptor 1.  Protein
          Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
          Receptor 1 (FGFR1); catalytic (c) domain. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. FGFR1 is
          part of the FGFR subfamily, which are receptor tyr
          kinases (RTKs) containing an extracellular
          ligand-binding region with three immunoglobulin-like
          domains, a transmembrane segment, and an intracellular
          catalytic domain. The binding of FGFRs to their
          ligands, the FGFs, results in receptor dimerization and
          activation, and intracellular signaling. The binding of
          FGFs to FGFRs is promiscuous, in that a receptor may be
          activated by several ligands and a ligand may bind to
          more that one type of receptor. Alternative splicing of
          FGFR1 transcripts produces a variety of isoforms, which
          are differentially expressed in cells. FGFR1 binds the
          ligands, FGF1 and FGF2, with high affinity and has also
          been reported to bind FGF4, FGF6, and FGF9. FGFR1
          signaling is critical in the control of cell migration
          during embryo development. It promotes cell
          proliferation in fibroblasts. Nuclear FGFR1 plays a
          role in the regulation of transcription. Mutations,
          insertions or deletions of FGFR1 have been identified
          in patients with Kallman's syndrome (KS), an inherited
          disorder characterized by hypogonadotropic hypogonadism
          and loss of olfaction. Aberrant FGFR1 expression has
          been found in some human cancers including 8P11
          myeloproliferative syndrome (EMS), breast cancer, and
          pancreatic adenocarcinoma.
          Length = 307

 Score = 29.6 bits (66), Expect = 0.19
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 8/48 (16%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEVW--EGLW------NNTTPVAIKTLK 86
          +WE+ R+ L   + LG G FG+V   E +       N  T VA+K LK
Sbjct: 12 RWEVPRDRLVLGKPLGEGCFGQVVMAEAIGLDKEKPNRVTKVAVKMLK 59


>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine
          Kinase, Axl.  Protein Tyrosine Kinase (PTK) family;
          Axl; catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. Axl is a member of the
          Axl subfamily, which is composed of receptor tyr
          kinases (RTKs) containing an extracellular
          ligand-binding region with two immunoglobulin-like
          domains followed by two fibronectin type III repeats, a
          transmembrane segment, and an intracellular catalytic
          domain. Binding to their ligands, Gas6 and protein S,
          leads to receptor dimerization, autophosphorylation,
          activation, and intracellular signaling. Axl is widely
          expressed in a variety of organs and cells including
          epithelial, mesenchymal, hematopoietic, as well as
          non-transformed cells. Axl signaling is important in
          many cellular functions such as survival,
          anti-apoptosis, proliferation, migration, and adhesion.
          Axl was originally isolated from patients with chronic
          myelogenous leukemia and a chronic myeloproliferative
          disorder. Axl is overexpressed in many human cancers
          including colon, squamous cell, thyroid, breast, and
          lung carcinomas.
          Length = 272

 Score = 29.6 bits (66), Expect = 0.19
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 59 RKLGSGQFGEVWEGLWNN---TTPVAIKTLKMG 88
          + LG G+FG V EG  N       VA+KT+K+ 
Sbjct: 5  KTLGEGEFGSVMEGQLNQDDSILKVAVKTMKIA 37


>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase (MAPK) subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The MAPK subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation. Typical MAPK pathways involve a triple
          kinase core cascade comprising of the MAPK, which is
          phosphorylated and activated by a MAPK kinase (MAP2K or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAP3K or MKKK). Each cascade is
          activated either by a small GTP-binding protein or by
          an adaptor protein, which transmits the signal either
          directly to a MAP3K to start the triple kinase core
          cascade or indirectly through a mediator kinase, a
          MAP4K. There are three main typical MAPK subfamilies:
          Extracellular signal-Regulated Kinase (ERK), c-Jun
          N-terminal Kinase (JNK), and p38. Some MAPKs are
          atypical in that they are not regulated by MAP2Ks.
          These include MAPK4, MAPK6, NLK, and ERK7.
          Length = 330

 Score = 29.4 bits (67), Expect = 0.20
 Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 1/29 (3%)

Query: 56 KFVRKLGSGQFGEVWEGLWNNT-TPVAIK 83
          + ++ +GSG +G V   +   T   VAIK
Sbjct: 3  ELLKPIGSGAYGVVCSAVDKRTGRKVAIK 31


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mitogen-Activated Protein
          Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
          mitogen-activated protein kinase (MAPK) kinase kinase
          (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          MAPKKK subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks)
          are also called MAP/ERK kinase kinases (MEKKs) in some
          cases. They phosphorylate and activate MAPK kinases
          (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
          and activate MAPKs during signaling cascades that are
          important in mediating cellular responses to
          extracellular signals. This subfamily is composed of
          the Apoptosis Signal-regulating Kinases ASK1 (or
          MAPKKK5) and ASK2 (or MAPKKK6), MEKK1, MEKK2, MEKK3,
          MEKK4, as well as plant and fungal MAPKKKs. Also
          included in this subfamily are the cell division
          control proteins Schizosaccharomyces pombe Cdc7 and
          Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 29.1 bits (66), Expect = 0.22
 Identities = 10/35 (28%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 58 VRKLGSGQFGEVWEGLWNNTTP-VAIKTLKMGSID 91
             LG G FG V+  L  +T   +A+K++++    
Sbjct: 5  GELLGRGSFGSVYLALDKDTGELMAVKSVELSGDS 39


>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine
          Kinase, Tropomyosin Related Kinase B.  Protein Tyrosine
          Kinase (PTK) family; Tropomyosin Related Kinase B
          (TrkB); catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. TrkB is
          a member of the Trk subfamily of proteins, which are
          receptor tyr kinases (RTKs) containing an extracellular
          region with arrays of leucine-rich motifs flanked by
          two cysteine-rich clusters followed by two
          immunoglobulin-like domains, a transmembrane segment,
          and an intracellular catalytic domain. Binding of TrkB
          to its ligands, brain-derived neurotrophic factor
          (BDNF) or neurotrophin 4 (NT4), results in receptor
          oligomerization and activation of the catalytic domain.
          TrkB is broadly expressed in the nervous system and in
          some non-neural tissues. It plays important roles in
          cell proliferation, differentiation, and survival.
          BDNF/Trk signaling plays a key role in regulating
          activity-dependent synaptic plasticity. TrkB also
          contributes to protection against gp120-induced
          neuronal cell death. TrkB overexpression is associated
          with poor prognosis in neuroblastoma (NB) and other
          human cancers. It acts as a suppressor of anoikis
          (detachment-induced apoptosis) and contributes to tumor
          metastasis.
          Length = 288

 Score = 29.3 bits (65), Expect = 0.24
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLWNNTTP------VAIKTLKMGS 89
          I R+++   R+LG G FG+V+     N  P      VA+KTLK  S
Sbjct: 2  IKRHNIVLKRELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDAS 47


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
          Serine/Threonine Kinase, Phosphoinositide-dependent
          kinase 1.  Serine/Threonine Kinases (STKs),
          Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
          catalytic (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The PDK1 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase (PI3K). PDK1 carries an
          N-terminal catalytic domain and a C-terminal pleckstrin
          homology (PH) domain that binds phosphoinositides. It
          phosphorylates the activation loop of AGC kinases that
          are regulated by PI3K such as PKB, SGK, and PKC, among
          others, and is crucial for their activation. Thus, it
          contributes in regulating many processes including
          metabolism, growth, proliferation, and survival. PDK1
          also has the ability to autophosphorylate and is
          constitutively active in mammalian cells. PDK1 is
          essential for normal embryo development and is
          important in regulating cell volume.
          Length = 280

 Score = 28.7 bits (65), Expect = 0.30
 Identities = 13/45 (28%), Positives = 17/45 (37%), Gaps = 7/45 (15%)

Query: 56 KFVRKLGSGQFGEVWEGLWNNT-TPVAIKTL------KMGSIDFV 93
          KF + +G G F  V       T    AIK L      K   + +V
Sbjct: 4  KFGKIIGEGSFSTVVLAKEKETNKEYAIKILDKRQLIKEKKVKYV 48


>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mammalian Ste20-like protein
          kinase 4.  Serine/threonine kinases (STKs), mammalian
          Ste20-like protein kinase 4 (MST4) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MST4 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MST4 is sometimes referred
          to as MASK (MST3 and SOK1-related kinase). It plays a
          role in mitogen-activated protein kinase (MAPK)
          signaling during cytoskeletal rearrangement,
          morphogenesis, and apoptosis. It influences cell growth
          and transformation by modulating the extracellular
          signal-regulated kinase (ERK) pathway. MST4 may also
          play a role in tumor formation and progression. It
          localizes in the Golgi apparatus by interacting with
          the Golgi matrix protein GM130 and may play a role in
          cell migration.
          Length = 277

 Score = 28.9 bits (64), Expect = 0.33
 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 60 KLGSGQFGEVWEGLWNNTTP-VAIKTLKM 87
          ++G G FGEV++G+ N T   VAIK + +
Sbjct: 11 RIGKGSFGEVFKGIDNRTQQVVAIKIIDL 39


>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine
          Kinase, Fes.  Protein Tyrosine Kinase (PTK) family; Fes
          (or Fps) kinase subfamily; catalytic (c) domain. The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Fes
          subfamily proteins are cytoplasmic (or nonreceptor) tyr
          kinases containing an N-terminal region with FCH
          (Fes/Fer/CIP4 homology) and coiled-coil domains,
          followed by a SH2 domain, and a C-terminal catalytic
          domain. The genes for Fes (feline sarcoma) and Fps
          (Fujinami poultry sarcoma) were first isolated from
          tumor-causing retroviruses. The viral oncogenes encode
          chimeric Fes proteins consisting of Gag sequences at
          the N-termini, resulting in unregulated tyr kinase
          activity. Fes kinase is expressed in myeloid, vascular
          endothelial, epithelial, and neuronal cells. It plays
          important roles in cell growth and differentiation,
          angiogenesis, inflammation and immunity, and
          cytoskeletal regulation. A recent study implicates Fes
          kinase as a tumor suppressor in colorectal cancer.
          Length = 252

 Score = 28.8 bits (64), Expect = 0.34
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 1/28 (3%)

Query: 60 KLGSGQFGEVWEG-LWNNTTPVAIKTLK 86
          ++G G FGEV+ G L  + TPVA+K+ +
Sbjct: 2  RIGRGNFGEVFSGRLRADNTPVAVKSCR 29


>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity
          Protein Kinase, MAP kinase kinase 7.  Protein kinases
          (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic
          (c) domain. PKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine or
          tyrosine residues on protein substrates. The MKK7
          subfamily is part of a larger superfamily that includes
          the catalytic domains of other protein serine/threonine
          kinases, protein tyrosine kinases, RIO kinases,
          aminoglycoside phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The mitogen-activated
          protein (MAP) kinase signaling pathways are important
          mediators of cellular responses to extracellular
          signals. The pathways involve a triple kinase core
          cascade comprising the MAP kinase (MAPK), which is
          phosphorylated and activated by a MAPK kinase (MAPKK or
          MKK), which itself is phosphorylated and activated by a
          MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a
          dual-specificity PK that phosphorylates and activates
          its downstream target, c-Jun N-terminal kinase (JNK),
          on specific threonine and tyrosine residues. Although
          MKK7 is capable of dual phosphorylation, it prefers to
          phosphorylate the threonine residue of JNK. Thus,
          optimal activation of JNK requires both MKK4 (not
          included in this subfamily) and MKK7. MKK7 is primarily
          activated by cytokines. MKK7 is essential for liver
          formation during embryogenesis. It plays roles in G2/M
          cell cycle arrest and cell growth. In addition, it is
          involved in the control of programmed cell death, which
          is crucial in oncogenesis, cancer chemoresistance, and
          antagonism to TNFalpha-induced killing, through its
          inhibition by Gadd45beta and the subsequent suppression
          of the JNK cascade.
          Length = 296

 Score = 28.9 bits (65), Expect = 0.34
 Identities = 12/44 (27%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPV-AIKTLKMGS 89
          ++  D N L+ + ++GSG  G+V++  +  T  V A+K ++   
Sbjct: 9  KYPADLNDLENLGEIGSGTCGQVYKMRFKKTGHVMAVKQMRRTG 52


>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein
          Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
          family; Axl subfamily; catalytic (c) domain. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). The Axl subfamily
          consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and
          similar proteins. PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. Axl subfamily members
          are receptor tyr kinases (RTKs) containing an
          extracellular ligand-binding region with two
          immunoglobulin-like domains followed by two fibronectin
          type III repeats, a transmembrane segment, and an
          intracellular catalytic domain. Binding to their
          ligands, Gas6 and protein S, leads to receptor
          dimerization, autophosphorylation, activation, and
          intracellular signaling. Axl subfamily members are
          implicated in a variety of cellular effects including
          survival, proliferation, migration, and phagocytosis.
          They are also associated with several types of cancer
          as well as inflammatory, autoimmune, vascular, and
          kidney diseases. Mer is named after its original
          reported expression pattern (monocytes, epithelial, and
          reproductive tissues). It is required for the ingestion
          of apoptotic cells by phagocytes such as macrophages,
          retinal pigment epithelial cells, and dendritic cells.
          Mer is also important in maintaining immune
          homeostasis.
          Length = 273

 Score = 28.6 bits (64), Expect = 0.40
 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 55 LKFVRKLGSGQFGEVWEGLWN--NTTP--VAIKTLKM 87
          LK  + LG G+FG V EG  +  + +   VA+KT+K+
Sbjct: 1  LKLGKILGEGEFGSVMEGQLSQDDGSQLKVAVKTMKL 37


>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein
          Serine/Threonine Kinase, Mammalian Ste20-like protein
          kinase 3.  Serine/threonine kinases (STKs), mammalian
          Ste20-like protein kinase 3 (MST3) subfamily, catalytic
          (c) domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MST3 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MST3 phosphorylates the STK
          NDR and may play a role in cell cycle progression and
          cell morphology. It may also regulate paxillin and
          consequently, cell migration. MST3 is present in human
          placenta, where it plays an essential role in the
          oxidative stress-induced apoptosis of trophoblasts in
          normal spontaneous delivery. Dysregulation of
          trophoblast apoptosis may result in pregnancy
          complications such as preeclampsia and intrauterine
          growth retardation.
          Length = 277

 Score = 28.5 bits (63), Expect = 0.46
 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%)

Query: 58 VRKLGSGQFGEVWEGLWNNTTP-VAIKTLKM 87
          + K+G G FGEV++G+ N T   VAIK + +
Sbjct: 9  LEKIGKGSFGEVFKGIDNRTQKVVAIKIIDL 39


>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the
          Protein Tyrosine Kinases, Janus kinases 2 and 3.
          Protein Tyrosine Kinase (PTK) family; Janus kinase 2
          (Jak2) and Jak3; catalytic (c) domain (repeat 2). The
          PTKc family is part of a larger superfamily that
          includes the catalytic domains of other kinases such as
          protein serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Jak2 and
          Jak3 are members of the Janus kinase (Jak) subfamily of
          proteins, which are cytoplasmic (or nonreceptor) tyr
          kinases containing an N-terminal FERM domain, followed
          by a Src homology 2 (SH2) domain, a pseudokinase
          domain, and a C-terminal catalytic tyr kinase domain.
          Jaks are crucial for cytokine receptor signaling. They
          are activated by autophosphorylation upon
          cytokine-induced receptor aggregation, and subsequently
          trigger downstream signaling events such as the
          phosphorylation of signal transducers and activators of
          transcription (STATs). Jak2 is widely expressed in many
          tissues while Jak3 is expressed only in hematopoietic
          cells. Jak2 is essential for the signaling of
          hormone-like cytokines such as growth hormone,
          erythropoietin, thrombopoietin, and prolactin, as well
          as some IFNs and cytokines that signal through the IL-3
          and gp130 receptors. Jak3 binds the shared receptor
          subunit common gamma chain and thus, is essential in
          the signaling of cytokines that use it such as IL-2,
          IL-4, IL-7, IL-9, IL-15, and IL-21. Disruption of Jak2
          in mice results in an embryonic lethal phenotype with
          multiple defects including erythropoietic and cardiac
          abnormalities. It is the only Jak gene that results in
          a lethal phenotype when disrupted in mice. A mutation
          in the pseudokinase domain of Jak2, V617F, is present
          in many myeloproliferative diseases, including almost
          all patients with polycythemia vera, and 50% of
          patients with essential thrombocytosis and
          myelofibrosis. Jak3 is important in lymphoid
          development and myeloid cell differentiation.
          Inactivating mutations in Jak3 have been reported in
          humans with severe combined immunodeficiency (SCID).
          Length = 284

 Score = 28.2 bits (63), Expect = 0.50
 Identities = 16/40 (40%), Positives = 25/40 (62%), Gaps = 5/40 (12%)

Query: 55 LKFVRKLGSGQFGEV----WEGLWNNTTP-VAIKTLKMGS 89
          LKF+++LG G FG V    ++ L +NT   VA+K L+  +
Sbjct: 6  LKFIQQLGKGNFGSVELCRYDPLQDNTGEVVAVKKLQHST 45


>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine
          Kinase, Tropomyosin Related Kinase C.  Protein Tyrosine
          Kinase (PTK) family; Tropomyosin Related Kinase C
          (TrkC); catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. TrkC is
          a member of the Trk subfamily of proteins, which are
          receptor tyr kinases (RTKs) containing an extracellular
          region with arrays of leucine-rich motifs flanked by
          two cysteine-rich clusters followed by two
          immunoglobulin-like domains, a transmembrane segment,
          and an intracellular catalytic domain. Binding of TrkC
          to its ligand, neurotrophin 3 (NT3), results in
          receptor oligomerization and activation of the
          catalytic domain. TrkC is broadly expressed in the
          nervous system and in some non-neural tissues including
          the developing heart. NT3/TrkC signaling plays an
          important role in the innervation of the cardiac
          conducting system and the development of smooth muscle
          cells. Mice deficient with NT3 and TrkC have multiple
          heart defects. NT3/TrkC signaling is also critical for
          the development and maintenance of enteric neurons that
          are important for the control of gut peristalsis.
          Length = 291

 Score = 28.0 bits (62), Expect = 0.54
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 6/43 (13%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLWNNTTP------VAIKTLK 86
          I R  +   R+LG G FG+V+     N +P      VA+K LK
Sbjct: 2  IKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALK 44


>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family
          Serine/Threonine Kinases.  Serine/Threonine Kinases
          (STKs), CMGC family, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The CMGC family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. The CMGC family
          consists of Cyclin-Dependent protein Kinases (CDKs),
          Mitogen-activated protein kinases (MAPKs) such as
          Extracellular signal-regulated kinase (ERKs), c-Jun
          N-terminal kinases (JNKs), and p38, and similar
          proteins. CDKs belong to a large subfamily of STKs that
          are regulated by their cognate cyclins. Together, they
          are involved in the control of cell-cycle progression,
          transcription, and neuronal function. MAPKs serve as
          important mediators of cellular responses to
          extracellular signals. They control critical cellular
          functions including differentiation, proliferation,
          migration, and apoptosis. They are also implicated in
          the pathogenesis of many diseases including multiple
          types of cancer, stroke, diabetes, and chronic
          inflammation.
          Length = 283

 Score = 28.1 bits (63), Expect = 0.62
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 58 VRKLGSGQFGEVWEGLWNNTTP-VAIKTLKMG 88
          + K+G G +G V++     T   VAIK +K+ 
Sbjct: 4  LGKIGEGTYGVVYKARDKLTGEIVAIKKIKLR 35


>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein
          Serine/Threonine Kinase, STK25 or Yeast
          Sps1/Ste20-related kinase 1.  Serine/threonine kinases
          (STKs), STK25 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The STK25 subfamily is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. STK25 is also
          called Ste20/oxidant stress response kinase 1 (SOK1) or
          yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is
          localized in the Golgi apparatus through its
          interaction with the Golgi matrix protein GM130. It may
          play a role in the regulation of cell migration and
          polarization. STK25 binds and phosphorylates CCM3
          (cerebral cavernous malformation 3), also called PCD10
          (programmed cell death 10), and may play a role in
          apoptosis. Human STK25 is a candidate gene responsible
          for pseudopseudohypoparathyroidism (PPHP), a disease
          that shares features with the Albright hereditary
          osteodystrophy (AHO) phenotype.
          Length = 277

 Score = 27.7 bits (61), Expect = 0.72
 Identities = 13/29 (44%), Positives = 20/29 (68%), Gaps = 1/29 (3%)

Query: 60 KLGSGQFGEVWEGLWNNTTP-VAIKTLKM 87
          ++G G FGEV++G+ N T   VAIK + +
Sbjct: 11 RIGKGSFGEVYKGIDNRTKEVVAIKIIDL 39


>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the
          Protein Tyrosine Kinase, Janus kinase 1.  Protein
          Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1);
          catalytic (c) domain (repeat 2). The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Jak1 is
          a member of the Janus kinase (Jak) subfamily of
          proteins, which are cytoplasmic (or nonreceptor) tyr
          kinases containing an N-terminal FERM domain, followed
          by a Src homology 2 (SH2) domain, a pseudokinase
          domain, and a C-terminal tyr kinase domain. Jaks are
          crucial for cytokine receptor signaling. They are
          activated by autophosphorylation upon cytokine-induced
          receptor aggregation, and subsequently trigger
          downstream signaling events such as the phosphorylation
          of signal transducers and activators of transcription
          (STATs). Jak1 is widely expressed in many tissues. Many
          cytokines are dependent on Jak1 for signaling,
          including those that use the shared receptor subunits
          common gamma chain (IL-2, IL-4, IL-7, IL-9, IL-15,
          IL-21) and gp130 (IL-6, IL-11, oncostatin M, G-CSF, and
          IFNs, among others). The many varied interactions of
          Jak1 and its ubiquitous expression suggest many
          biological roles. Jak1 is important in neurological
          development, as well as in lymphoid development and
          function. It also plays a role in the pathophysiology
          of cardiac hypertrophy and heart failure. A mutation in
          the ATP-binding site of Jak1 was identified in a human
          uterine leiomyosarcoma cell line, resulting in
          defective cytokine induction and antigen presentation,
          thus allowing the tumor to evade the immune system.
          Length = 284

 Score = 27.6 bits (61), Expect = 0.74
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 5/40 (12%)

Query: 55 LKFVRKLGSGQFGEV----WEGLWNNTTP-VAIKTLKMGS 89
          LK +R LG G FG+V    ++   +NT   VA+K+LK  S
Sbjct: 6  LKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPES 45


>gnl|CDD|223216 COG0138, PurH, AICAR transformylase/IMP cyclohydrolase PurH (only
           IMP cyclohydrolase domain in Aful) [Nucleotide transport
           and metabolism].
          Length = 515

 Score = 27.6 bits (62), Expect = 0.75
 Identities = 13/27 (48%), Positives = 14/27 (51%)

Query: 34  KPVTGGLSHSTRDQWEIDRNSLKFVRK 60
           K V+GGL    RD   ID   LK V K
Sbjct: 366 KRVSGGLLVQERDDGMIDEAELKVVTK 392


>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine
          Kinase, Fibroblast Growth Factor Receptor 3.  Protein
          Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
          Receptor 3 (FGFR3); catalytic (c) domain. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. FGFR3 is
          part of the FGFR subfamily, which are receptor tyr
          kinases (RTKs) containing an extracellular
          ligand-binding region with three immunoglobulin-like
          domains, a transmembrane segment, and an intracellular
          catalytic domain. The binding of FGFRs to their
          ligands, the FGFs, results in receptor dimerization and
          activation, and intracellular signaling. The binding of
          FGFs to FGFRs is promiscuous, in that a receptor may be
          activated by several ligands and a ligand may bind to
          more that one type of receptor. Many FGFR3 splice
          variants have been reported with the IIIb and IIIc
          isoforms being the predominant forms. FGFR3 IIIc is the
          isoform expressed in chondrocytes, the cells affected
          in dwarfism, while IIIb is expressed in epithelial
          cells. FGFR3 ligands include FGF1, FGF2, FGF4, FGF8,
          FGF9, and FGF23. It is a negative regulator of long
          bone growth. In the cochlear duct and in the lens,
          FGFR3 is involved in differentiation while it appears
          to have a role in cell proliferation in epithelial
          cells. Germline mutations in FGFR3 are associated with
          skeletal disorders including several forms of dwarfism.
          Some missense mutations are associated with multiple
          myeloma and carcinomas of the bladder and cervix.
          Overexpression of FGFR3 is found in thyroid carcinoma.
          Length = 334

 Score = 27.7 bits (61), Expect = 0.79
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 8/53 (15%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEVW--------EGLWNNTTPVAIKTLKMGSID 91
          +WE+ R  L   + LG G FG+V         +   N    VA+K LK  + D
Sbjct: 6  KWELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDKPNKPVTVAVKMLKDDATD 58


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase (Nek)
          family, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. The Nek family is composed
          of 11 different mammalian members (Nek1-11) with
          similarity to the catalytic domain of Aspergillus
          nidulans NIMA kinase, the founding member of the Nek
          family which was identified in a screen for cell cycle
          mutants that were prevented from entering mitosis. Neks
          contain a conserved N-terminal catalytic domain and a
          more divergent C-terminal regulatory region of various
          sizes and structures. They are involved in the
          regulation of downstream processes following the
          activation of Cdc2, and many of their functions are
          cell cycle-related. They play critical roles in
          microtubule dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 27.5 bits (62), Expect = 0.83
 Identities = 5/13 (38%), Positives = 11/13 (84%)

Query: 58 VRKLGSGQFGEVW 70
          ++++G G FG+V+
Sbjct: 5  IKQIGKGSFGKVY 17


>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine
          Kinase, Mitogen-Activated Protein Kinase 15.
          Serine/Threonine Kinases (STKs), Mitogen-Activated
          Protein Kinase 15 (MAPK15) subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The MAPK15 subfamily is
          part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. MAPKs are important
          mediators of cellular responses to extracellular
          signals. Human MAPK15 is also called Extracellular
          signal Regulated Kinase 8 (ERK8) while the rat protein
          is called ERK7. ERK7 and ERK8 display both similar and
          different biochemical properties. They
          autophosphorylate and activate themselves and do not
          require upstream activating kinases. ERK7 is
          constitutively active and is not affected by
          extracellular stimuli whereas ERK8 shows low basal
          activity and is activated by DNA-damaging agents. ERK7
          and ERK8 also have different substrate profiles. Genome
          analysis shows that they are orthologs with similar
          gene structures. ERK7 and ERK 8 may be involved in the
          signaling of some nuclear receptor transcription
          factors. ERK7 regulates hormone-dependent degradation
          of estrogen receptor alpha while ERK8 down-regulates
          the transcriptional co-activation androgen and
          glucocorticoid receptors.
          Length = 337

 Score = 27.5 bits (62), Expect = 0.92
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 4/38 (10%)

Query: 50 IDRNSLK---FVRKLGSGQFGEVWEGLWNNT-TPVAIK 83
          ID++ L+    ++KLG G +G VW+ +   T   VA+K
Sbjct: 1  IDKHILRKYEILQKLGKGAYGIVWKAIDRRTKEVVALK 38


>gnl|CDD|214518 smart00105, ArfGap, Putative GTP-ase activating proteins for the
          small GTPase, ARF.  Putative zinc fingers with GTPase
          activating proteins (GAPs) towards the small GTPase,
          Arf. The GAP of ARD1 stimulates GTPase hydrolysis for
          ARD1 but not ARFs.
          Length = 119

 Score = 26.5 bits (59), Expect = 1.3
 Identities = 8/32 (25%), Positives = 13/32 (40%), Gaps = 2/32 (6%)

Query: 42 HSTRDQWEIDRNSLKFVRKLGSGQFGEVWEGL 73
            T D W      L+ ++K G+     +WE  
Sbjct: 52 SLTLDTWT--EEELRLLQKGGNENANSIWESN 81


>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 7.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek7 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek7 is required for mitotic
          spindle formation and cytokinesis. It is enriched in
          the centrosome and is critical for microtubule
          nucleation. Nek7 is activated by Nek9 during mitosis,
          and may regulate the p70 ribosomal S6 kinase.
          Length = 267

 Score = 26.9 bits (59), Expect = 1.5
 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 59 RKLGSGQFGEVWEGLWN-NTTPVAIKTLKM 87
          +K+G GQF EV+      +  PVA+K +++
Sbjct: 8  KKIGRGQFSEVYRATCLLDGVPVALKKVQI 37


>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine
          Kinase, Spleen tyrosine kinase.  Protein Tyrosine
          Kinase (PTK) family; Spleen tyrosine kinase (Syk);
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. Syk, together with
          Zap-70, form the Syk subfamily of kinases which are
          cytoplasmic (or nonreceptor) tyr kinases containing two
          Src homology 2 (SH2) domains N-terminal to the
          catalytic tyr kinase domain. Syk was first cloned from
          the spleen, and its function in hematopoietic cells is
          well-established. Syk is involved in the signaling
          downstream of activated receptors (including B-cell and
          Fc receptors) that contain ITAMs (immunoreceptor tyr
          activation motifs), leading to processes such as cell
          proliferation, differentiation, survival, adhesion,
          migration, and phagocytosis. More recently, Syk
          expression has been detected in other cell types
          (including epithelial cells, vascular endothelial
          cells, neurons, hepatocytes, and melanocytes),
          suggesting a variety of biological functions in
          non-immune cells. Syk plays a critical role in
          maintaining vascular integrity and in wound healing
          during embryogenesis. It also regulates Vav3, which is
          important in osteoclast function including bone
          development. In breast epithelial cells, where Syk acts
          as a negative regulator for epidermal growth factor
          receptor (EGFR) signaling, loss of Syk expression is
          associated with abnormal proliferation during cancer
          development suggesting a potential role as a tumor
          suppressor. In mice, Syk has been shown to inhibit
          malignant transformation of mammary epithelial cells
          induced with murine mammary tumor virus (MMTV).
          Length = 257

 Score = 26.8 bits (59), Expect = 1.5
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 3/30 (10%)

Query: 60 KLGSGQFGEVWEGLWN---NTTPVAIKTLK 86
          +LGSG FG V +G++    +   VA+K LK
Sbjct: 2  ELGSGNFGTVKKGMYKMKKSEKTVAVKILK 31


>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine
          Kinase, Receptor tyrosine kinase-like Orphan Receptor
          1.  Protein Tyrosine Kinase (PTK) family; Receptor
          tyrosine kinase-like Orphan Receptor 1 (Ror1);
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. Ror proteins are orphan
          receptor tyr kinases (RTKs) containing an extracellular
          region with immunoglobulin-like, cysteine-rich, and
          kringle domains, a transmembrane segment, and an
          intracellular catalytic domain. Ror RTKs are unrelated
          to the nuclear receptor subfamily called
          retinoid-related orphan receptors (RORs). RTKs are
          usually activated through ligand binding, which causes
          dimerization and autophosphorylation of the
          intracellular tyr kinase catalytic domain. Ror kinases
          are expressed in many tissues during development. Avian
          Ror1 was found to be involved in late limb development.
          Studies in mice reveal that Ror1 is important in the
          regulation of neurite growth in central neurons, as
          well as in respiratory development. Loss of Ror1 also
          enhances the heart and skeletal abnormalities found in
          Ror2-deficient mice.
          Length = 283

 Score = 26.9 bits (59), Expect = 1.7
 Identities = 15/43 (34%), Positives = 29/43 (67%), Gaps = 5/43 (11%)

Query: 49 EIDRNSLKFVRKLGSGQFGEVWEG-LW----NNTTPVAIKTLK 86
          E+  ++++F+ +LG   FG++++G L+    ++   VAIKTLK
Sbjct: 1  ELPLSAVRFMEELGECAFGKIYKGHLYLPGMDHAQLVAIKTLK 43


>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the
          Protein Tyrosine Kinase, Tyrosine kinase 2.  Protein
          Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2);
          catalytic (c) domain (repeat 2). The PTKc family is
          part of a larger superfamily that includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Tyk2 is
          a member of the Janus kinase (Jak) subfamily of
          proteins, which are cytoplasmic (or nonreceptor) tyr
          kinases containing an N-terminal FERM domain, followed
          by a Src homology 2 (SH2) domain, a pseudokinase
          domain, and a C-terminal tyr kinase catalytic domain.
          Jaks are crucial for cytokine receptor signaling. They
          are activated by autophosphorylation upon
          cytokine-induced receptor aggregation, and subsequently
          trigger downstream signaling events such as the
          phosphorylation of signal transducers and activators of
          transcription (STATs). Tyk2 is widely expressed in many
          tissues. It is involved in signaling via the cytokine
          receptors IFN-alphabeta, IL-6, IL-10, IL-12, IL-13, and
          IL-23. It mediates cell surface urokinase receptor
          (uPAR) signaling and plays a role in modulating
          vascular smooth muscle cell (VSMC) functional behavior
          in response to injury. Tyk2 is also important in
          dendritic cell function and T helper (Th)1 cell
          differentiation. A homozygous mutation of Tyk2 was
          found in a patient with hyper-IgE syndrome (HIES), a
          primary immunodeficiency characterized by recurrent
          skin abscesses, pneumonia, and elevated serum IgE. This
          suggests that Tyk2 may play important roles in multiple
          cytokine signaling involved in innate and adaptive
          immunity.
          Length = 283

 Score = 26.4 bits (58), Expect = 2.2
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 9/41 (21%)

Query: 55 LKFVRKLGSGQFGEVWEGLW-----NNTTP--VAIKTLKMG 88
          LK +R LG G FG+V   L+     N+ T   VA+KTLK  
Sbjct: 6  LKKIRVLGEGHFGKV--SLYCYDPANDGTGEMVAVKTLKRE 44


>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent
          protein Kinase 9-like Serine/Threonine Kinases.
          Serine/Threonine Kinases (STKs), Cyclin-Dependent
          protein Kinase 9 (CDK9)-like subfamily, catalytic (c)
          domain. STKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to serine/threonine
          residues on protein substrates. The CDK9-like subfamily
          is part of a larger superfamily that includes the
          catalytic domains of other protein STKs, protein
          tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. CDKs belong to a large
          family of STKs that are regulated by their cognate
          cyclins. Together, they are involved in the control of
          cell-cycle progression, transcription, and neuronal
          function. This subfamily is composed of CDK9 and CDK12
          from higher eukaryotes, yeast BUR1, C-type plant CDKs
          (CdkC), and similar proteins. CDK9, BUR1, and CdkC are
          functionally equivalent. They act as a kinase for the
          C-terminal domain of RNA polymerase II and participate
          in regulating mutliple steps of gene expression
          including transcription elongation and RNA processing.
          CDK9 and CdkC associate with T-type cyclins while BUR1
          associates with the cyclin BUR2. CDK12 is a unique CDK
          that contains an arginine/serine-rich (RS) domain,
          which is predominantly found in splicing factors. CDK12
          interacts with cyclins L1 and L2, and participates in
          regulating transcription and alternative splicing.
          Length = 287

 Score = 26.4 bits (59), Expect = 2.3
 Identities = 10/32 (31%), Positives = 20/32 (62%), Gaps = 3/32 (9%)

Query: 58 VRKLGSGQFGEVWEGLWNNTT--PVAIKTLKM 87
          + ++G G +G+V++   N  T   VA+K ++M
Sbjct: 4  IAQIGEGTYGQVYKAR-NKKTGELVALKKIRM 34


>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine
          Kinase, Fibroblast Growth Factor Receptor 2.  Protein
          Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
          Receptor 2 (FGFR2); catalytic (c) domain. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. FGFR2 is
          part of the FGFR subfamily, which are receptor tyr
          kinases (RTKs) containing an extracellular
          ligand-binding region with three immunoglobulin-like
          domains, a transmembrane segment, and an intracellular
          catalytic domain. The binding of FGFRs to their
          ligands, the FGFs, results in receptor dimerization and
          activation, and intracellular signaling. The binding of
          FGFs to FGFRs is promiscuous, in that a receptor may be
          activated by several ligands and a ligand may bind to
          more that one type of receptor. There are many splice
          variants of FGFR2 which show differential expression
          and binding to FGF ligands. Disruption of either FGFR2
          or FGFR2b is lethal in mice, due to defects in the
          placenta or severe impairment of tissue development
          including lung, limb, and thyroid, respectively.
          Disruption of FGFR2c in mice results in defective bone
          and skull development. Genetic alterations of FGFR2 are
          associated with many human skeletal disorders including
          Apert syndrome, Crouzon syndrome, Jackson-Weiss
          syndrome, and Pfeiffer syndrome.
          Length = 304

 Score = 26.5 bits (58), Expect = 2.3
 Identities = 10/23 (43%), Positives = 14/23 (60%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEV 69
          +WE  R+ L   + LG G FG+V
Sbjct: 9  RWEFSRDKLTLGKPLGEGCFGQV 31


>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein
          Serine/Threonine Kinase, Never In Mitosis gene
          A-related kinase 6.  Serine/Threonine Kinases (STKs),
          Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6)
          subfamily, catalytic (c) domain. STKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          Nek6 subfamily is one of a family of 11 different Neks
          (Nek1-11) that are involved in cell cycle control. The
          Nek family is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. Nek6 is required for the
          transition from metaphase to anaphase. It also plays
          important roles in mitotic spindle formation and
          cytokinesis.  Activated by Nek9 during mitosis, Nek6
          phosphorylates Eg5, a kinesin that is important for
          spindle bipolarity. Nek6 localizes to spindle
          microtubules during metaphase and anaphase, and to the
          midbody during cytokinesis.
          Length = 267

 Score = 26.1 bits (57), Expect = 2.4
 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 54 SLKFVRKLGSGQFGEVWEGLWN-NTTPVAIKTLKM 87
          + +  +K+G GQF EV+      +  PVA+K +++
Sbjct: 3  NFQIEKKIGRGQFSEVYRATCLLDRKPVALKKVQI 37


>gnl|CDD|234569 PRK00007, PRK00007, elongation factor G; Reviewed.
          Length = 693

 Score = 26.2 bits (59), Expect = 2.5
 Identities = 8/16 (50%), Positives = 11/16 (68%), Gaps = 1/16 (6%)

Query: 56  KFVRKL-GSGQFGEVW 70
           KFV++  G GQ+G V 
Sbjct: 496 KFVKQSGGRGQYGHVV 511


>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine
          Kinase, Colon Carcinoma Kinase 4.  Protein Tyrosine
          Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4);
          pseudokinase domain. The PTKc (catalytic domain)
          family, to which this subfamily belongs, includes the
          catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. CCK4,
          also called protein tyrosine kinase 7 (PTK7), is an
          orphan receptor tyr kinase (RTK) containing an
          extracellular region with seven immunoglobulin domains,
          a transmembrane segment, and an intracellular inactive
          pseudokinase domain. Studies in mice reveal that CCK4
          is essential for neural development. Mouse embryos
          containing a truncated CCK4 die perinatally and display
          craniorachischisis, a severe form of neural tube
          defect. The mechanism of action of the CCK4
          pseudokinase is still unknown. Other pseudokinases such
          as HER3 rely on the activity of partner RTKs.
          Length = 275

 Score = 26.3 bits (58), Expect = 2.7
 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 6/40 (15%)

Query: 52 RNSLKFVRKLGSGQFGEVWEG------LWNNTTPVAIKTL 85
          R++L+ +  LG G+FGEV+             T V +K L
Sbjct: 4  RSNLQEITTLGRGEFGEVFLAKAKGIEEEGGETLVLVKAL 43


>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein
          Serine/Threonine Kinases, Never In Mitosis gene
          A-related kinase 6 and 7.  Serine/Threonine Kinases
          (STKs), Never In Mitosis gene A (NIMA)-related kinase 6
          (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to serine/threonine residues on protein
          substrates. The Nek6/7 subfamily is part of a family of
          11 different Neks (Nek1-11) that are involved in cell
          cycle control. The Nek family is part of a larger
          superfamily that includes the catalytic domains of
          other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. Nek6 and Nek7
          are the shortest Neks, consisting only of the catalytic
          domain and a very short N-terminal extension. They show
          distinct expression patterns and both appear to be
          downstream substrates of Nek9. They are required for
          mitotic spindle formation and cytokinesis. They may
          also be regulators of the p70 ribosomal S6 kinase.
          Length = 267

 Score = 25.9 bits (57), Expect = 3.6
 Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 59 RKLGSGQFGEVWEG--LWNNTTPVAIKTLKM 87
          +K+G GQF  V++   L +    VA+K +++
Sbjct: 8  KKIGKGQFSVVYKAICLLDG-RVVALKKVQI 37


>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine
          Kinase, Fibroblast Growth Factor Receptor 4.  Protein
          Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
          Receptor 4 (FGFR4); catalytic (c) domain. The PTKc
          family is part of a larger superfamily that includes
          the catalytic domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. FGFR4 is
          part of the FGFR subfamily, which are receptor tyr
          kinases (RTKs) containing an extracellular
          ligand-binding region with three immunoglobulin-like
          domains, a transmembrane segment, and an intracellular
          catalytic domain. The binding of FGFRs to their
          ligands, the FGFs, results in receptor dimerization and
          activation, and intracellular signaling. The binding of
          FGFs to FGFRs is promiscuous, in that a receptor may be
          activated by several ligands and a ligand may bind to
          more that one type of receptor. Unlike other FGFRs,
          there is only one splice form of FGFR4. It binds FGF1,
          FGF2, FGF6, FGF19, and FGF23. FGF19 is a selective
          ligand for FGFR4. Although disruption of FGFR4 in mice
          causes no obvious phenotype, in vivo inhibition of
          FGFR4 in cultured skeletal muscle cells resulted in an
          arrest of muscle progenitor differentiation. FGF6 and
          FGFR4 are uniquely expressed in myofibers and satellite
          cells. FGF6/FGFR4 signaling appears to play a key role
          in the regulation of muscle regeneration. A
          polymorphism in FGFR4 is found in head and neck
          squamous cell carcinoma.
          Length = 314

 Score = 25.7 bits (56), Expect = 3.6
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 8/53 (15%)

Query: 47 QWEIDRNSLKFVRKLGSGQFGEV-------WEGLW-NNTTPVAIKTLKMGSID 91
          +WE  R+ L   + LG G FG+V        +    + T  VA+K LK  + D
Sbjct: 6  KWEFPRDRLVLGKPLGEGCFGQVVRAEAYGIDKSRPDQTVTVAVKMLKDNATD 58


>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine
          Kinase, Zeta-chain-associated protein of 70kDa.
          Protein Tyrosine Kinase (PTK) family;
          Zeta-chain-associated protein of 70kDa (Zap-70);
          catalytic (c) domain. The PTKc family is part of a
          larger superfamily that includes the catalytic domains
          of other kinases such as protein serine/threonine
          kinases, RIO kinases, and phosphoinositide 3-kinase
          (PI3K). PTKs catalyze the transfer of the
          gamma-phosphoryl group from ATP to tyrosine (tyr)
          residues in protein substrates. Zap-70 is a member of
          the Syk subfamily of kinases, which are cytoplasmic (or
          nonreceptor) tyr kinases containing two Src homology 2
          (SH2) domains N-terminal to the catalytic tyr kinase
          domain. Zap-70 is primarily expressed in T-cells and NK
          cells, and is a crucial component in T-cell receptor
          (TCR) signaling. Zap-70 binds the phosphorylated ITAM
          (immunoreceptor tyr activation motif) sequences of the
          activated TCR zeta-chain through its SH2 domains,
          leading to its phosphorylation and activation. It then
          phosphorylates target proteins, which propagate the
          signals to downstream pathways. Zap-70 is hardly
          detected in normal peripheral B-cells, but is present
          in some B-cell malignancies. It is used as a diagnostic
          marker for chronic lymphocytic leukemia (CLL) as it is
          associated with the more aggressive subtype of the
          disease.
          Length = 257

 Score = 25.7 bits (56), Expect = 3.6
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 60 KLGSGQFGEVWEGLW---NNTTPVAIKTLKMGS 89
          +LGSG FG V +G++        VAIK LK  +
Sbjct: 2  ELGSGNFGCVKKGVYKMRKKQIDVAIKVLKNEN 34


>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to
          tyrosine kinase).  Protein Tyrosine Kinase (PTK)
          family; Receptor related to tyrosine kinase (Ryk);
          pseudokinase domain. The PTKc (catalytic domain) family
          to which this subfamily belongs, is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. Ryk is a receptor tyr kinase (RTK)
          containing an extracellular region with two
          leucine-rich motifs, a transmembrane segment, and an
          intracellular inactive pseudokinase domain. The
          extracellular region of Ryk shows homology to the
          N-terminal domain of Wnt inhibitory factor-1 (WIF) and
          serves as the ligand (Wnt) binding domain of Ryk. Ryk
          is expressed in many different tissues both during
          development and in adults, suggesting a widespread
          function. It acts as a chemorepulsive axon guidance
          receptor of Wnt glycoproteins and is responsible for
          the establishment of axon tracts during the development
          of the central nervous system. In addition, studies in
          mice reveal that Ryk is essential in skeletal,
          craniofacial, and cardiac development. Thus, it appears
          Ryk is involved in signal transduction despite its lack
          of kinase activity. Ryk may function as an accessory
          protein that modulates the signals coming from
          catalytically active partner RTKs such as the Eph
          receptors.
          Length = 280

 Score = 25.8 bits (57), Expect = 3.7
 Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 5/31 (16%)

Query: 64 GQFGEVWEGLWNNTTP-----VAIKTLKMGS 89
          G FG ++ G+  +  P     V +KT+K  +
Sbjct: 17 GTFGRIFYGILIDEKPGKEEEVFVKTVKDHA 47


>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein
          Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1.
           Serine/threonine kinases (STKs), plant MAP/ERK kinase
          kinase 1 (MEKK1)-like subfamily, catalytic (c) domain.
          STKs catalyze the transfer of the gamma-phosphoryl
          group from ATP to serine/threonine residues on protein
          substrates. The plant MEKK1 subfamily is part of a
          larger superfamily that includes the catalytic domains
          of other protein STKs, protein tyrosine kinases, RIO
          kinases, aminoglycoside phosphotransferase, choline
          kinase, and phosphoinositide 3-kinase. This subfamily
          is composed of plant mitogen-activated protein kinase
          (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks)
          including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1
          is a MAPKKK that phosphorylates and activates MAPK
          kinases (MAPKKs or MKKs or MAP2Ks), which in turn
          phosphorylate and activate MAPKs during signaling
          cascades that are important in mediating cellular
          responses to extracellular signals. Arabidopsis
          thaliana MEKK1 activates MPK4, a MAPK that regulates
          systemic acquired resistance. MEKK1 also participates
          in the regulation of temperature-sensitive and
          tissue-specific cell death.
          Length = 258

 Score = 25.8 bits (57), Expect = 3.8
 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 3/33 (9%)

Query: 61 LGSGQFGEVWEGLWNNTTP--VAIKTLKMGSID 91
          LGSG FG V+EG  N       A+K + +    
Sbjct: 8  LGSGSFGSVYEG-LNLDDGDFFAVKEVSLADDG 39


>gnl|CDD|235143 PRK03629, tolB, translocation protein TolB; Provisional.
          Length = 429

 Score = 25.5 bits (56), Expect = 4.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 57  FVRKLGSGQFGEVWEGLWNNTTP 79
           +V  L SGQ  +V +G  NNT P
Sbjct: 270 YVMDLASGQIRQVTDGRSNNTEP 292


>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein
          Serine/Threonine Kinase, Large Tumor Suppressor.
          Serine/Threonine Kinases (STKs), Large Tumor Suppressor
          (LATS) subfamily, catalytic (c) domain. STKs catalyze
          the transfer of the gamma-phosphoryl group from ATP to
          serine/threonine residues on protein substrates. The
          LATS subfamily is part of a larger superfamily that
          includes the catalytic domains of other protein STKs,
          protein tyrosine kinases, RIO kinases, aminoglycoside
          phosphotransferase, choline kinase, and
          phosphoinositide 3-kinase. LATS was originally
          identified in Drosophila using a screen for genes whose
          inactivation led to overproliferation of cells. In
          tetrapods, there are two LATS isoforms, LATS1 and
          LATS2. Inactivation of LATS1 in mice results in the
          development of various tumors, including sarcomas and
          ovarian cancer. LATS functions as a tumor suppressor
          and is implicated in cell cycle regulation.
          Length = 376

 Score = 25.5 bits (56), Expect = 4.3
 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 58 VRKLGSGQFGEVWEGLWNNTTPV-AIKTLK 86
          ++ +G G FGEV      +T  + A+KTL+
Sbjct: 6  IKTIGIGAFGEVCLVRKVDTNALYAMKTLR 35


>gnl|CDD|219163 pfam06757, Ins_allergen_rp, Insect allergen related repeat,
           nitrile-specifier detoxification.  This family
           exemplifies a case of novel gene evolution. The case in
           point is the arms-race between plants and their
           infective insective herbivores in the area of the
           glucosinolate-myrosinase system. Brassicas have
           developed the glucosinolate-myrosinase system as
           chemical defence mechanism against the insects, and
           consequently the insects have adapted to produce a
           detoxifying molecule, nitrile-specifier protein (NSP).
           NSP is present in the small white butterfly Pieris
           rapae. NSP is structurally different from and has no
           amino acid homology to any known detoxifying enzymes,
           and it appears to have arisen by a process of domain and
           gene duplication of a sequence of unknown function that
           is widespread in insect species and referred to as
           insect-allergen-repeat protein. Thus this family is
           found either as a single domain or as a multiple
           repeat-domain.
          Length = 181

 Score = 25.3 bits (56), Expect = 4.6
 Identities = 8/21 (38%), Positives = 12/21 (57%)

Query: 56  KFVRKLGSGQFGEVWEGLWNN 76
            F   L S +F ++ E LWN+
Sbjct: 137 AFYEALRSPEFKKLLEALWNS 157


>gnl|CDD|171912 PRK13223, PRK13223, phosphoglycolate phosphatase; Provisional.
          Length = 272

 Score = 25.6 bits (56), Expect = 4.8
 Identities = 16/74 (21%), Positives = 30/74 (40%), Gaps = 7/74 (9%)

Query: 1   MVELGSQAGGESARLVWFPVQDCLGSSARLAVEKPVTGGLSHSTRDQWEIDRNSLKFVRK 60
           ++ELG    G  A   W      +G+ A + V + + G + H   D    ++    F+  
Sbjct: 39  LLELGRPPAGLEAVRHW------VGNGAPVLVRRALAGSIDHDGVDDELAEQALALFMEA 92

Query: 61  LG-SGQFGEVWEGL 73
              S +   V+ G+
Sbjct: 93  YADSHELTVVYPGV 106


>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
          Length = 1021

 Score = 25.5 bits (55), Expect = 5.0
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 43 STRDQWEIDRNSLKFVRKLGSGQFGEVW 70
             D  E   N  + ++K+G+G+FGEV+
Sbjct: 3  GKYDDGESRLNEYEVIKKIGNGRFGEVF 30


>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine
          Kinase, Tyro3.  Protein Tyrosine Kinase (PTK) family;
          Tyro3; catalytic (c) domain. The PTKc family is part of
          a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. Tyro3
          (or Sky) is a member of the Axl subfamily, which is
          composed of receptor tyr kinases (RTKs) containing an
          extracellular ligand-binding region with two
          immunoglobulin-like domains followed by two fibronectin
          type III repeats, a transmembrane segment, and an
          intracellular catalytic domain. Binding to their
          ligands, Gas6 and protein S, leads to receptor
          dimerization, autophosphorylation, activation, and
          intracellular signaling. Tyro3 is predominantly
          expressed in the central nervous system and the brain,
          and functions as a neurotrophic factor. It is also
          expressed in osteoclasts and has a role in bone
          resorption.
          Length = 273

 Score = 25.3 bits (55), Expect = 5.3
 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 4/32 (12%)

Query: 59 RKLGSGQFGEVWEGLW----NNTTPVAIKTLK 86
          R LG G+FG V E        +   VA+K LK
Sbjct: 5  RMLGKGEFGSVREAQLKSEDGSFQKVAVKMLK 36


>gnl|CDD|236763 PRK10797, PRK10797, glutamate and aspartate transporter subunit;
           Provisional.
          Length = 302

 Score = 25.2 bits (55), Expect = 5.3
 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 10/40 (25%)

Query: 11  ESARLVWFPVQDCLGSSARLAVEKPVTGGLSHSTRDQWEI 50
           ES R V F + D L +  R   +KP          D WEI
Sbjct: 195 ESGRAVAFMMDDALLAGERAKAKKP----------DNWEI 224


>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed.
          Length = 668

 Score = 25.1 bits (56), Expect = 6.0
 Identities = 7/9 (77%), Positives = 8/9 (88%)

Query: 62  GSGQFGEVW 70
           G GQFG+VW
Sbjct: 482 GHGQFGDVW 490


>gnl|CDD|185510 PTZ00197, PTZ00197, 60S ribosomal protein L28; Provisional.
          Length = 146

 Score = 24.9 bits (54), Expect = 6.5
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 40 LSHSTRDQWEIDRNSLKFVRKLG 62
          ++HST  QW + R + KF++K  
Sbjct: 1  MTHSTDLQWLLVRQNSKFLQKRN 23


>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine
          Kinase, Csk homologous kinase.  Protein Tyrosine Kinase
          (PTK) family; Csk homologous kinase (Chk); catalytic
          (c) domain. The PTKc family is part of a larger
          superfamily that includes the catalytic domains of
          other kinases such as protein serine/threonine kinases,
          RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs
          catalyze the transfer of the gamma-phosphoryl group
          from ATP to tyrosine (tyr) residues in protein
          substrates. Csk subfamily kinases are cytoplasmic (or
          nonreceptor) tyr kinases containing the Src homology
          domains, SH3 and SH2, N-terminal to the catalytic tyr
          kinase domain. They negatively regulate the activity of
          Src kinases that are anchored to the plasma membrane.
          Chk is also referred to as megakaryocyte-associated
          tyrosine kinase (Matk). To inhibit Src kinases, Chk is
          translocated to the membrane via binding to specific
          transmembrane proteins, G-proteins, or adaptor proteins
          near the membrane. Chk inhibit Src kinases using a
          noncatalytic mechanism by simply binding to them. As a
          negative regulator of Src kinases, Chk may play
          important roles in cell proliferation, survival, and
          differentiation, and consequently, in cancer
          development and progression. Chk is expressed in brain
          and hematopoietic cells. Studies in mice reveal that
          Chk is not functionally redundant with Csk and that it
          plays an important role as a regulator of immune
          responses. Chk also plays a role in neural
          differentiation in a manner independent of Src by
          enhancing Mapk activation via Ras-mediated signaling.
          Length = 254

 Score = 24.9 bits (54), Expect = 7.1
 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 48 WEIDRNSLKFVRKLGSGQFGEVWEGLWNNTTPVAIKTLK 86
          W ++   L     +G G+FG V +G +     VA+K +K
Sbjct: 1  WLLNLQKLTLGEIIGEGEFGAVLQGEYTGQK-VAVKNIK 38


>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine
          Kinase, Tropomyosin Related Kinase A.  Protein Tyrosine
          Kinase (PTK) family; Tropomyosin Related Kinase A
          (TrkA); catalytic (c) domain. The PTKc family is part
          of a larger superfamily that includes the catalytic
          domains of other kinases such as protein
          serine/threonine kinases, RIO kinases, and
          phosphoinositide 3-kinase (PI3K). PTKs catalyze the
          transfer of the gamma-phosphoryl group from ATP to
          tyrosine (tyr) residues in protein substrates. TrkA is
          a member of the Trk subfamily of proteins, which are
          receptor tyr kinases (RTKs) containing an extracellular
          region with arrays of leucine-rich motifs flanked by
          two cysteine-rich clusters followed by two
          immunoglobulin-like domains, a transmembrane segment,
          and an intracellular catalytic domain. Binding of TrkA
          to its ligand, nerve growth factor (NGF), results in
          receptor oligomerization and activation of the
          catalytic domain. TrkA is expressed mainly in
          neural-crest-derived sensory and sympathetic neurons of
          the peripheral nervous system, and in basal forebrain
          cholinergic neurons of the central nervous system. It
          is critical for neuronal growth, differentiation and
          survival. Alternative TrkA splicing has been implicated
          as a pivotal regulator of neuroblastoma (NB) behavior.
          Normal TrkA expression is associated with better NB
          prognosis, while the hypoxia-regulated TrkAIII splice
          variant promotes NB pathogenesis and progression.
          Aberrant TrkA expression has also been demonstrated in
          non-neural tumors including prostate, breast, lung, and
          pancreatic cancers.
          Length = 280

 Score = 25.0 bits (54), Expect = 7.8
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 50 IDRNSLKFVRKLGSGQFGEVWEGLWNNTTP------VAIKTLK 86
          I R  +    +LG G FG+V+    +N  P      VA+K LK
Sbjct: 2  IKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALK 44


>gnl|CDD|226849 COG4425, COG4425, Predicted membrane protein [Function unknown].
          Length = 588

 Score = 24.8 bits (54), Expect = 8.4
 Identities = 15/40 (37%), Positives = 18/40 (45%)

Query: 12  SARLVWFPVQDCLGSSARLAVEKPVTGGLSHSTRDQWEID 51
           S +L WFPV   L  S  +AV   V  G  H    +  ID
Sbjct: 519 SPQLRWFPVVTFLQVSLDMAVATTVPMGHGHVYAPEHYID 558


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.317    0.134    0.416 

Gapped
Lambda     K      H
   0.267   0.0807    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,544,875
Number of extensions: 349625
Number of successful extensions: 384
Number of sequences better than 10.0: 1
Number of HSP's gapped: 371
Number of HSP's successfully gapped: 121
Length of query: 93
Length of database: 10,937,602
Length adjustment: 60
Effective length of query: 33
Effective length of database: 8,276,362
Effective search space: 273119946
Effective search space used: 273119946
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (24.0 bits)