BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy12540
(79 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2TMK|A Chain A, Yeast Thymidylate Kinase Complexed With 3'-Azido-3'-
Deoxythymidine Monophosphate (Azt-Mp)
pdb|2TMK|B Chain B, Yeast Thymidylate Kinase Complexed With 3'-Azido-3'-
Deoxythymidine Monophosphate (Azt-Mp)
pdb|1TMK|A Chain A, Yeast Thymidylate Kinase Complexed With Thymidine
Monophosphate (Dtmp)
pdb|1TMK|B Chain B, Yeast Thymidylate Kinase Complexed With Thymidine
Monophosphate (Dtmp)
pdb|3TMK|A Chain A, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A
Resolution: Implications For Catalysis And Azt
Activation
pdb|3TMK|B Chain B, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A
Resolution: Implications For Catalysis And Azt
Activation
pdb|3TMK|C Chain C, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A
Resolution: Implications For Catalysis And Azt
Activation
pdb|3TMK|D Chain D, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A
Resolution: Implications For Catalysis And Azt
Activation
pdb|3TMK|E Chain E, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A
Resolution: Implications For Catalysis And Azt
Activation
pdb|3TMK|F Chain F, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A
Resolution: Implications For Catalysis And Azt
Activation
pdb|3TMK|G Chain G, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A
Resolution: Implications For Catalysis And Azt
Activation
pdb|3TMK|H Chain H, Crystal Structure Of Yeast Thymidylate Kinase Complexed
With The Bisubstrate Inhibitor Tp5a At 2.0 A
Resolution: Implications For Catalysis And Azt
Activation
Length = 216
Score = 25.4 bits (54), Expect = 8.0, Method: Compositional matrix adjust.
Identities = 12/32 (37%), Positives = 17/32 (53%)
Query: 1 MLFSALVALCAFLKRKRKSKLIGGPVQAYLSD 32
+L+ L C LK +S IGG + YL+D
Sbjct: 24 ILYKKLQPNCKLLKFPERSTRIGGLINEYLTD 55
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.142 0.411
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,533,054
Number of Sequences: 62578
Number of extensions: 33956
Number of successful extensions: 86
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 85
Number of HSP's gapped (non-prelim): 1
length of query: 79
length of database: 14,973,337
effective HSP length: 48
effective length of query: 31
effective length of database: 11,969,593
effective search space: 371057383
effective search space used: 371057383
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 45 (21.9 bits)