Diaphorina citri psyllid: psy12540


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MLFSALVALCAFLKRKRKSKLIGGPVQAYLSDIGKRHPQALVYPLTVASKSNSSSRRNAANKILQSMCDLSPLLVKLER
cHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHcc
*LFSALVALCAFLKRKRKSKLIGGPVQAYLSDIGKRHPQALVYPLTVA***************LQSMCDLSP*LVK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFSALVALCAFLKRKRKSKLIGGPVQAYLSDIGKRHPQALVYPLTVASKSNSSSRRNAANKILQSMCDLSPLLVKLER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase mTOR Serine/threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals. Functions as part of 2 structurally and functionally distinct signaling complexes mTORC1 and mTORC2 (mTOR complex 1 and 2). Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. This includes phosphorylation of EIF4EBP1 and release of its inhibition toward the elongation initiation factor 4E (eiF4E). Moreover, phosphorylates and activates RPS6KB1 and RPS6KB2 that promote protein synthesis by modulating the activity of their downstream targets including ribosomal protein S6, eukaryotic translation initiation factor EIF4B and the inhibitor of translation initiation PDCD4. Regulates ribosome synthesis by activating RNA polymerase III-dependent transcription through phosphorylation and inhibition of MAF1 a RNA polymerase III-repressor. In parallel to protein synthesis, also regulates lipid synthesis through SREBF1/SREBP1 and LPIN1. To maintain energy homeostasis mTORC1 may also regulate mitochondrial biogenesis through regulation of PPARGC1A. mTORC1 also negatively regulates autophagy through phosphorylation of ULK1. Under nutrient sufficiency, phosphorylates ULK1 at 'Ser-757', disrupting the interaction with AMPK and preventing activation of ULK1. Also prevents autophagy through phosphorylation of the autophagy inhibitor DAP. mTORC1 exerts a feedback control on upstream growth factor signaling that includes phosphorylation and activation of GRB10 a INSR-dependent signaling suppressor. Among other potential targets mTORC1 may phosphorylate CLIP1 and regulate microtubules. As part of the mTORC2 complex MTOR may regulate other cellular processes including survival and organization of the cytoskeleton. Plays a critical role in the phosphorylation at 'Ser-473' of AKT1, a pro-survival effector of phosphoinositide 3-kinase, facilitating its activation by PDK1. mTORC2 may regulate the actin cytoskeleton, through phosphorylation of PRKCA, PXN and activation of the Rho-type guanine nucleotide exchange factors RHOA and RAC1A or RAC1B. mTORC2 also regulates the phosphorylation of SGK1 at 'Ser-422'.confidentQ9JLN9
Phosphatidylinositol 3-kinase tor2 Phosphatidylinositol 3-kinase homolog required for G1 progression.confidentQ9Y7K2
Target of rapamycin Promotes cell and tissue growth, maintains tissue homeostatis and controls responses to environmental stress and aging. Regulates growth during animal development by coupling growth factor signaling to nutrient availability. Central regulators of autophagy. May be involved in atg1 phosphorylation. May also be involved, directly or indirectly, in the control of neuronal function. Phosphorylates S6K/p70S6K, in vitro. May regulate the activity of S6K. Overexpression inhibits growth and reduces cell size. Affects the timing of neuronal cell differentiation. Hyperactivation of the signaling leads to accelerated differentiation, whereas inhibition of the signaling retards differentiation. Thus, in addition to controlling growth of the cell in which it resides, it can also influence growth of distant cells and organs during development via a humoral mechanism. In short, during development, it primarily controls growth, whereas in the adult, where there is relatively little growth, it controls aging and other aspects of nutrient-related physiology. Rag GTPases act as activators of TORC1 in response to amino acid signals.confidentQ9VK45

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted