Diaphorina citri psyllid: psy12559

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610

MDSMELERQRGITIQSAATYTLWKDHNINIIDTPGHVDFTVEVERALRVLDGAILVLCAVGGVQSQTLTVNRQMKRYDVPCIAFINKLDRLGADPYRVINQMRQKVGHNAAFLQIPIGLGSETKGIIDLIQRKAIYFEGPLGDNLRIEEIPADLKKEAESKRQELIEHVAEGDEILGEMFLEEKSISEDDIKKAIRRSTLTRKFTPVLVGTALKNKGVQTLLDAVLDYLPNPGEVTNYAIENGQEDKKVVLNPSRDGKHPFIALAFKLEAGKFGQLTYMRCYQGKLRKGEMIYNVRTDKKVRVSRLVRLHSNEMEDVEEVLAGDIFALFGVDCASGDTFVTDKNNSISLESIYVADPVVSMSIKAVNNKDRDNFSKAVQRFTKEDPTFHFFYDPESKETLVSGMGELHLEIYAQRMEREYNCPVVLGKPKVAFKETLVQPFDFDYLHKKQSGGSGQYGRVIGTLEPLPPSANTKLEFIDETVGTNVPKPFLPAIIKGFKQMCEKGCLSGSRVAGVRMVLKDGDNHMVDSNEISFILAAHDPVVSMSIKAVNNKDRDNFSKAVQRFTKEDPTFHFFYDPESKETLVSGMGELHLEIYAQRMEREYNCPVVL

ccccccccccccHHHHHHHHcccccccEEEcccccccccEEEEEEEccccccEEEEEEcccccccccHHHHHHcccccccEEEEEEccccccccHHHHHHHHHHHHcccccCEEEccccccccEEEEEEEEEEEEEEccccccccEEEcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHcccCEEEEcccccccccHHHHHHHHHHHccccccccccEEcccccccCEEEccccccccccEEEEccccccccccEEEEEEEEcEEccccEEECcccccEEEccHHHHccccccccccEEEcccEEEEEcccccccccccccccccEEEEccccccccEEEEEccccccHHHHHHHHHHHHHHcccccEEEccccccccEEcccccHHHHHHHHHccccccccccccccccccEEcccccEEccCEEEccccccccccEEEEEEEccccccccccEEEEccccccccccccHHHHHHHHHHHHcccEECccEEcEEEEEEcccccccccHHHHHHHHccccccHHHHHHHHHcccccccccEEEcccccccccEEECccccccccccccccccEEHHHHHcccccccccc

*DS*ELERQRGITIQSAATYTLWKDHNINIIDTPGHVDFTVEVERALRVLDGAILVLCAVGGVQSQTLTVNRQMKRYDVPCIAFINKLDRLGADPYRVINQMRQKVGHNAAFLQIPIGLGSETKGIIDLIQRKAIYFEGPLGDNLRIEEIPADLKKEAESKRQELIEHVAEGDEILGEMFLEEKSISEDDIKKAIRRSTLTRKFTPVLVGTALKNKGVQTLLDAVLDYLPNPGEVTNYAIENG****KVVLN***DGKHPFIALAFKLEAGKFGQLTYMRCYQGKLRKGEMIYNVRTDKKVRVSRLVRLHSNEMEDVEEVLAGDIFALFGVDCASGDTFVTDKNNSISLESIYVADPVVSMSIKAVNNKDRDNFSKAVQRFTKEDPTFHFFYDPESKETLVSGMGELHLEIYAQRMEREYNCPVVLGKPKVAFKETLVQPFDFDYLHKKQSGGSGQYGRVIGTLEPLPPSANTKLEFIDETVGTNVPKPFLPAIIKGFKQMCEKGCLSGSRVAGVRMVLKDGDNHMVDSNEISFILAAHDPVVSMSIKAVNNKDRDNFSKAVQRFTKEDPTFHFFYDPESKETLVSGMGELHLEIYAQRMEREYNCPVVL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Elongation factor G, mitochondrial	Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.	very confident	Q7Q1K8
Elongation factor G, mitochondrial	Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome (By similarity). Essential during development as it acts as a retrograde signal from mitochondria to the nucleus to slow down cell proliferation if mitochondrial energy output is low.	very confident	Q9VM33
Elongation factor G, mitochondrial	Mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome. Essential during development as it acts as a retrograde signal from mitochondria to the nucleus to slow down cell proliferation if mitochondrial energy output is low.	very confident	Q29N77

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005634 [CC]	nucleus	confident	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003924 [MF]	GTPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0070125 [BP]	mitochondrial translational elongation	probable	GO:0044249, GO:0034645, GO:0044699, GO:0044267, GO:0044260, GO:0071840, GO:0016043, GO:0071704, GO:0010467, GO:0007005, GO:0032543, GO:1901576, GO:0009987, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0006414, GO:0006412
GO:0003746 [MF]	translation elongation factor activity	probable	GO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005525 [MF]	GTP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006184 [BP]	GTP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000003 [BP]	reproduction	probable	GO:0008150
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0046686 [BP]	response to cadmium ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0009570 [CC]	chloroplast stroma	probable	GO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0006898 [BP]	receptor-mediated endocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0048046 [CC]	apoplast	probable	GO:0005575, GO:0005576
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RDO, chain 7
Confidence level:very confident
Coverage over the Query: 14-590
View the alignment between query and template
View the model in PyMOL

Template: 3CB4, chain D
Confidence level:very confident
Coverage over the Query: 539-610
View the alignment between query and template
View the model in PyMOL