Query         psy12567
Match_columns 142
No_of_seqs    202 out of 914
Neff          5.1 
Searched_HMMs 46136
Date          Fri Aug 16 22:39:55 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12567.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12567hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00202 ZnF_GATA Zinc finger D  99.7 1.6E-17 3.5E-22  108.5   3.6   43   80-122     1-44  (54)
  2 smart00401 ZnF_GATA zinc finge  99.6 1.4E-16 3.1E-21  103.1   3.8   48   77-124     2-51  (52)
  3 PF00320 GATA:  GATA zinc finge  99.5 2.2E-15 4.8E-20   90.8   1.1   35   81-115     1-36  (36)
  4 KOG1601|consensus               99.3 3.7E-12 8.1E-17   98.6   5.8  104   21-127   143-249 (340)
  5 cd00202 ZnF_GATA Zinc finger D  99.0 8.6E-11 1.9E-15   76.7   0.5   34   22-55      1-35  (54)
  6 smart00401 ZnF_GATA zinc finge  99.0 1.7E-10 3.8E-15   74.6   1.8   38   19-56      2-40  (52)
  7 PF00320 GATA:  GATA zinc finge  99.0 4.8E-11   1E-15   71.8  -1.2   33   23-55      1-34  (36)
  8 COG5641 GAT1 GATA Zn-finger-co  99.0 9.4E-10   2E-14   98.6   5.8   61   77-137   296-360 (498)
  9 COG5641 GAT1 GATA Zn-finger-co  98.9 4.5E-10 9.7E-15  100.7   2.0   50   78-127   158-213 (498)
 10 KOG1601|consensus               97.7 1.8E-05 3.9E-10   61.2   2.3   36   20-55    199-235 (340)
 11 TIGR01384 TFS_arch transcripti  91.1    0.21 4.7E-06   35.4   2.8   83   22-110     2-101 (104)
 12 KOG3554|consensus               88.5    0.26 5.7E-06   45.2   1.8   37   77-113   385-424 (693)
 13 PF12773 DZR:  Double zinc ribb  86.4    0.84 1.8E-05   28.1   2.8   13   78-90     29-41  (50)
 14 PF08271 TF_Zn_Ribbon:  TFIIB z  85.5     0.4 8.6E-06   29.2   0.9   26   22-49      2-27  (43)
 15 COG5347 GTPase-activating prot  81.7    0.79 1.7E-05   39.6   1.5   29   18-47     18-46  (319)
 16 PRK12286 rpmF 50S ribosomal pr  80.8    0.99 2.1E-05   29.7   1.4   25   19-51     26-50  (57)
 17 PF01412 ArfGap:  Putative GTPa  80.6       1 2.2E-05   32.8   1.6   39   75-114    10-48  (116)
 18 smart00105 ArfGap Putative GTP  79.1     1.8 3.8E-05   31.4   2.4   38   77-115     2-39  (112)
 19 PF01783 Ribosomal_L32p:  Ribos  78.1     1.2 2.6E-05   28.9   1.2   25   19-51     25-49  (56)
 20 PRK14892 putative transcriptio  75.9     1.6 3.5E-05   31.7   1.4   37   75-111    18-54  (99)
 21 COG3529 Predicted nucleic-acid  75.3    0.73 1.6E-05   31.2  -0.5   34   76-109     8-42  (66)
 22 smart00105 ArfGap Putative GTP  74.5     1.6 3.5E-05   31.6   1.1   28   20-48      3-30  (112)
 23 KOG0703|consensus               73.2     1.8 3.9E-05   37.1   1.2   29   18-47     23-51  (287)
 24 PF01412 ArfGap:  Putative GTPa  72.9     1.8 3.9E-05   31.5   1.1   30   18-48     11-40  (116)
 25 COG5347 GTPase-activating prot  72.2     2.3 5.1E-05   36.7   1.7   40   73-113    15-54  (319)
 26 PF06677 Auto_anti-p27:  Sjogre  70.5     2.8 6.1E-05   25.9   1.4   25   20-48     17-41  (41)
 27 COG1594 RPB9 DNA-directed RNA   69.6     3.5 7.6E-05   30.4   2.0   88   21-110     3-111 (113)
 28 TIGR01031 rpmF_bact ribosomal   69.4     2.7 5.8E-05   27.4   1.1   24   20-51     26-49  (55)
 29 PRK03564 formate dehydrogenase  68.7     6.1 0.00013   34.1   3.5   72   18-112   185-265 (309)
 30 PRK00423 tfb transcription ini  68.4     3.5 7.7E-05   34.8   2.0   32   16-49      7-38  (310)
 31 PF11781 RRN7:  RNA polymerase   68.3     2.2 4.8E-05   25.5   0.6   25   79-107     9-33  (36)
 32 PLN03114 ADP-ribosylation fact  67.3     3.8 8.3E-05   36.4   2.0   42   73-115    17-58  (395)
 33 smart00778 Prim_Zn_Ribbon Zinc  66.3     4.9 0.00011   24.3   1.8   29   21-49      4-33  (37)
 34 PF09526 DUF2387:  Probable met  66.0       3 6.4E-05   28.6   0.9   35   20-54      8-43  (71)
 35 KOG3740|consensus               65.6     2.5 5.4E-05   39.9   0.6   32   76-107   460-495 (706)
 36 PLN03114 ADP-ribosylation fact  65.6     3.6 7.9E-05   36.6   1.6   30   18-48     20-49  (395)
 37 PF12760 Zn_Tnp_IS1595:  Transp  65.3     4.6 9.9E-05   24.8   1.6   29   18-48     16-44  (46)
 38 TIGR02443 conserved hypothetic  65.0     3.3 7.1E-05   27.7   0.9   34   20-53      9-43  (59)
 39 TIGR02443 conserved hypothetic  64.9     2.5 5.5E-05   28.2   0.4   34   76-109     7-41  (59)
 40 PF09526 DUF2387:  Probable met  64.2     2.6 5.7E-05   28.9   0.4   35   76-110     6-41  (71)
 41 PRK03988 translation initiatio  63.8     2.6 5.6E-05   32.3   0.3   30   78-107   102-131 (138)
 42 PF07282 OrfB_Zn_ribbon:  Putat  63.6     4.5 9.7E-05   26.3   1.4   37   11-50     19-55  (69)
 43 PRK14559 putative protein seri  63.6     8.3 0.00018   36.3   3.6   18   76-93     39-56  (645)
 44 TIGR01562 FdhE formate dehydro  63.3     8.8 0.00019   33.0   3.5   72   18-112   182-265 (305)
 45 smart00653 eIF2B_5 domain pres  62.1     2.9 6.3E-05   30.8   0.3   30   78-107    80-109 (110)
 46 TIGR00311 aIF-2beta translatio  62.1     2.9 6.4E-05   31.8   0.3   30   78-107    97-126 (133)
 47 PRK14892 putative transcriptio  61.3     6.9 0.00015   28.4   2.1   39   14-52     15-53  (99)
 48 PRK03988 translation initiatio  59.8     4.1 8.9E-05   31.2   0.8   33   19-51    101-133 (138)
 49 TIGR00311 aIF-2beta translatio  57.7     4.8  0.0001   30.6   0.8   33   19-51     96-128 (133)
 50 KOG0706|consensus               56.9     5.6 0.00012   36.1   1.2   44   72-116    17-60  (454)
 51 COG3529 Predicted nucleic-acid  56.8     2.7 5.8E-05   28.5  -0.6   31   20-50     10-41  (66)
 52 KOG1598|consensus               55.7     7.5 0.00016   35.9   1.8   27   21-49      1-27  (521)
 53 PRK08351 DNA-directed RNA poly  55.4     8.1 0.00018   25.9   1.5   15   20-34     15-30  (61)
 54 smart00653 eIF2B_5 domain pres  55.1     4.9 0.00011   29.6   0.5   30   20-49     80-109 (110)
 55 PRK00423 tfb transcription ini  54.5     7.1 0.00015   33.0   1.5   20   76-95     28-54  (310)
 56 PRK06393 rpoE DNA-directed RNA  53.5     9.2  0.0002   25.9   1.6   15   20-34     17-32  (64)
 57 PRK01110 rpmF 50S ribosomal pr  52.2     7.4 0.00016   25.7   0.9   23   20-51     27-49  (60)
 58 PRK12336 translation initiatio  52.2     5.1 0.00011   32.1   0.2   30   78-107    98-127 (201)
 59 KOG0706|consensus               52.1     7.7 0.00017   35.2   1.3   29   18-47     21-49  (454)
 60 PRK14714 DNA polymerase II lar  51.3      14 0.00031   37.6   3.1   22   20-50    667-688 (1337)
 61 PLN03119 putative ADP-ribosyla  50.6     9.9 0.00022   35.8   1.8   29   18-47     21-49  (648)
 62 PF01873 eIF-5_eIF-2B:  Domain   50.6     6.2 0.00013   29.6   0.4   29   79-107    94-122 (125)
 63 PRK12336 translation initiatio  50.2       7 0.00015   31.4   0.7   34   19-52     97-130 (201)
 64 PLN03131 hypothetical protein;  47.9      11 0.00025   35.7   1.7   29   18-47     21-49  (705)
 65 PF13248 zf-ribbon_3:  zinc-rib  47.6      12 0.00026   20.4   1.2   22   79-107     3-24  (26)
 66 smart00661 RPOL9 RNA polymeras  47.5      13 0.00029   22.6   1.5   28   22-51      2-30  (52)
 67 PRK00420 hypothetical protein;  47.0      14  0.0003   27.5   1.8   27   20-50     23-49  (112)
 68 PLN03119 putative ADP-ribosyla  46.9      11 0.00023   35.5   1.4   35   73-108    18-52  (648)
 69 PF04216 FdhE:  Protein involve  46.8     3.1 6.7E-05   34.6  -1.9   71   19-112   171-251 (290)
 70 KOG1598|consensus               46.4      11 0.00024   34.8   1.4   27   79-107     1-27  (521)
 71 KOG2907|consensus               46.4      13 0.00028   28.0   1.5   87   19-108     6-111 (116)
 72 PF14803 Nudix_N_2:  Nudix N-te  45.9     6.2 0.00013   23.3  -0.2   25   80-107     2-30  (34)
 73 COG1499 NMD3 NMD protein affec  42.7      13 0.00029   32.6   1.3   67   18-105     4-71  (355)
 74 PF01873 eIF-5_eIF-2B:  Domain   42.1      11 0.00023   28.3   0.6   29   21-49     94-122 (125)
 75 smart00659 RPOLCX RNA polymera  41.7      12 0.00026   23.2   0.7   25   79-107     3-27  (44)
 76 PRK00222 methionine sulfoxide   41.4      29 0.00064   26.8   2.9   65   31-96     33-110 (142)
 77 PLN03131 hypothetical protein;  41.0      16 0.00036   34.7   1.7   34   74-108    19-52  (705)
 78 PF08273 Prim_Zn_Ribbon:  Zinc-  40.5      12 0.00026   22.9   0.5   26   22-47      5-32  (40)
 79 PHA02942 putative transposase;  40.5      18 0.00039   31.7   1.8   34   14-51    319-352 (383)
 80 COG0333 RpmF Ribosomal protein  40.3      18 0.00038   24.0   1.3   24   20-51     27-50  (57)
 81 PHA00626 hypothetical protein   40.2      18 0.00039   24.2   1.3   31   22-52      2-34  (59)
 82 PF01286 XPA_N:  XPA protein N-  40.1      15 0.00033   21.8   0.9   29   19-47      2-30  (34)
 83 PF09723 Zn-ribbon_8:  Zinc rib  39.8      11 0.00024   22.8   0.2    9   78-86     26-34  (42)
 84 KOG0703|consensus               39.5      13 0.00029   31.8   0.8   38   75-113    22-59  (287)
 85 TIGR00357 methionine-R-sulfoxi  39.4      17 0.00038   27.8   1.3   66   30-96     29-107 (134)
 86 PRK00432 30S ribosomal protein  38.4      21 0.00046   22.6   1.4   27   19-49     19-45  (50)
 87 PF06689 zf-C4_ClpX:  ClpX C4-t  38.2      11 0.00025   22.8   0.1   28   79-107     2-32  (41)
 88 COG1405 SUA7 Transcription ini  37.9      16 0.00035   31.0   1.0   26   80-107     3-28  (285)
 89 TIGR00595 priA primosomal prot  34.7      32  0.0007   31.1   2.5   23   77-107   239-261 (505)
 90 PF04161 Arv1:  Arv1-like famil  34.5      20 0.00044   28.6   1.1   28   80-107     2-32  (208)
 91 PF04810 zf-Sec23_Sec24:  Sec23  33.6      26 0.00056   20.9   1.2   32   20-51      2-34  (40)
 92 COG0675 Transposase and inacti  33.1      24 0.00051   28.3   1.3   28   15-50    304-331 (364)
 93 cd07169 NR_DBD_GCNF_like DNA-b  32.9      34 0.00075   24.0   1.9   33   77-113     5-37  (90)
 94 PF04981 NMD3:  NMD3 family ;    32.8      35 0.00076   27.6   2.2   52   23-95      1-53  (236)
 95 PF03604 DNA_RNApol_7kD:  DNA d  31.9      40 0.00087   19.6   1.8   24   22-49      2-25  (32)
 96 PF02148 zf-UBP:  Zn-finger in   31.1      18  0.0004   23.3   0.3   20   23-50      1-20  (63)
 97 KOG1597|consensus               31.0      28  0.0006   30.2   1.4   30   80-109     2-31  (308)
 98 smart00834 CxxC_CXXC_SSSS Puta  30.7      20 0.00043   20.7   0.3    8  100-107    27-34  (41)
 99 PF02701 zf-Dof:  Dof domain, z  30.5      94   0.002   21.0   3.6   44   76-119     3-50  (63)
100 smart00290 ZnF_UBP Ubiquitin C  30.0      30 0.00064   20.9   1.1   20   22-50      1-20  (50)
101 PF09538 FYDLN_acid:  Protein o  29.9      30 0.00064   25.4   1.2   32   76-111     7-38  (108)
102 TIGR02605 CxxC_CxxC_SSSS putat  29.4      23  0.0005   21.7   0.5    8  100-107    27-34  (52)
103 cd06968 NR_DBD_ROR DNA-binding  29.1      42 0.00092   23.8   1.9   33   77-113     4-36  (95)
104 PRK00085 recO DNA repair prote  28.9      33 0.00071   27.3   1.4   31   18-48    147-177 (247)
105 PRK05580 primosome assembly pr  28.8      45 0.00098   31.3   2.5   23   77-107   407-429 (679)
106 smart00440 ZnF_C2C2 C2C2 Zinc   28.2      18 0.00038   21.8  -0.2   30   80-109     2-38  (40)
107 PRK14873 primosome assembly pr  27.5      44 0.00096   31.5   2.2   22   77-107   409-430 (665)
108 COG5082 AIR1 Arginine methyltr  27.3      78  0.0017   25.7   3.3   33   12-47     52-84  (190)
109 KOG0704|consensus               26.9      33 0.00071   30.6   1.2   28   19-47     18-45  (386)
110 cd07173 NR_DBD_AR DNA-binding   26.9      47   0.001   23.0   1.7   31   79-113     4-34  (82)
111 PF09297 zf-NADH-PPase:  NADH p  26.1      15 0.00032   20.8  -0.8   26   78-107     3-29  (32)
112 PF01096 TFIIS_C:  Transcriptio  25.9      13 0.00029   22.2  -1.0   30   80-109     2-38  (39)
113 TIGR00613 reco DNA repair prot  25.9      49  0.0011   26.1   1.9   32   18-49    145-176 (241)
114 KOG3740|consensus               25.8      27 0.00059   33.3   0.5   33   18-50    460-496 (706)
115 cd07166 NR_DBD_REV_ERB DNA-bin  25.7      30 0.00065   24.2   0.6   31   78-112     3-33  (89)
116 cd07168 NR_DBD_DHR4_like DNA-b  25.5      53  0.0011   23.0   1.8   32   78-113     6-37  (90)
117 cd07172 NR_DBD_GR_PR DNA-bindi  25.0      51  0.0011   22.5   1.7   31   79-113     3-33  (78)
118 cd07171 NR_DBD_ER DNA-binding   24.8      55  0.0012   22.6   1.8   31   79-113     4-34  (82)
119 KOG0909|consensus               24.2      54  0.0012   30.1   2.0   38   19-56    160-209 (500)
120 cd07160 NR_DBD_LXR DNA-binding  24.0      49  0.0011   23.9   1.4   32   78-113    18-49  (101)
121 PF07295 DUF1451:  Protein of u  23.5      50  0.0011   25.4   1.5   12   39-50    110-121 (146)
122 PF10005 DUF2248:  Uncharacteri  23.4 1.1E+02  0.0025   26.9   3.9   31   76-107    51-82  (343)
123 PRK00398 rpoP DNA-directed RNA  23.4      33 0.00072   20.8   0.4   26   79-107     4-29  (46)
124 PRK05508 methionine sulfoxide   23.3      53  0.0012   24.7   1.6   19   31-49     23-41  (119)
125 PF13240 zinc_ribbon_2:  zinc-r  23.0      50  0.0011   17.6   1.0    6   23-28      2-7   (23)
126 KOG0818|consensus               23.0      38 0.00082   31.8   0.8   28   19-47      7-34  (669)
127 COG2816 NPY1 NTP pyrophosphohy  22.7      39 0.00084   28.9   0.8   31   76-110   109-140 (279)
128 PF07754 DUF1610:  Domain of un  22.5      69  0.0015   17.6   1.5   23   23-48      1-23  (24)
129 cd06965 NR_DBD_Ppar DNA-bindin  22.1      36 0.00079   23.5   0.5   29   81-113     2-30  (84)
130 PRK00085 recO DNA repair prote  22.1      50  0.0011   26.2   1.3   31   76-106   147-177 (247)
131 TIGR01385 TFSII transcription   21.6      40 0.00088   28.8   0.7   36   75-110   255-297 (299)
132 smart00531 TFIIE Transcription  21.3      39 0.00085   25.4   0.5   31   18-48     97-130 (147)
133 PF15396 FAM60A:  Protein Famil  20.7      50  0.0011   27.3   1.0   11  101-111    51-61  (213)
134 cd07158 NR_DBD_Ppar_like The D  20.6      60  0.0013   21.6   1.3   28   81-112     1-28  (73)
135 COG3952 Predicted membrane pro  20.6      24 0.00051   26.4  -0.8   20   91-111    76-95  (113)
136 cd07165 NR_DBD_DmE78_like DNA-  20.6      59  0.0013   22.2   1.2   29   81-113     1-29  (81)
137 PF02591 DUF164:  Putative zinc  20.3      36 0.00079   21.4   0.1   31   76-107    20-54  (56)
138 cd07155 NR_DBD_ER_like DNA-bin  20.1      61  0.0013   21.8   1.2   28   81-112     1-28  (75)
139 PRK14714 DNA polymerase II lar  20.0      94   0.002   32.0   2.9   49   20-96    679-728 (1337)

No 1  
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=99.69  E-value=1.6e-17  Score=108.48  Aligned_cols=43  Identities=58%  Similarity=1.202  Sum_probs=40.7

Q ss_pred             cccccCCCCCCccccCCCC-CcccchhhhhHHhcCCCCCCCCCC
Q psy12567         80 ECVNCGAISTPLWRRDGTG-HYLCNACGLYHKMNGMNRPLVKQP  122 (142)
Q Consensus        80 ~C~nC~tt~Tp~WRr~~~G-~~lCNaCGly~k~~~~~RP~~~~k  122 (142)
                      +|+||++++||+||++++| ..|||||||||++++..||+.+++
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~~~   44 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRK   44 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCcccCc
Confidence            5999999999999999965 799999999999999999999988


No 2  
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=99.64  E-value=1.4e-16  Score=103.09  Aligned_cols=48  Identities=54%  Similarity=1.056  Sum_probs=43.8

Q ss_pred             CCccccccCCCCCCccccCCCCC-cccchhhhhHHhcCCC-CCCCCCCCC
Q psy12567         77 EGRECVNCGAISTPLWRRDGTGH-YLCNACGLYHKMNGMN-RPLVKQPRR  124 (142)
Q Consensus        77 ~~~~C~nC~tt~Tp~WRr~~~G~-~lCNaCGly~k~~~~~-RP~~~~k~~  124 (142)
                      ....|+||++++||+||+++.|. .|||||||||++++.. ||+.+.+..
T Consensus         2 ~~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~~~rp~~~~~~~   51 (52)
T smart00401        2 SGRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGGLKRPLSLKKDV   51 (52)
T ss_pred             CCCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCCCCCcccccccC
Confidence            36789999999999999999996 9999999999999998 999887754


No 3  
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=99.52  E-value=2.2e-15  Score=90.83  Aligned_cols=35  Identities=57%  Similarity=1.165  Sum_probs=28.2

Q ss_pred             ccccCCCCCCccccCCCCCc-ccchhhhhHHhcCCC
Q psy12567         81 CVNCGAISTPLWRRDGTGHY-LCNACGLYHKMNGMN  115 (142)
Q Consensus        81 C~nC~tt~Tp~WRr~~~G~~-lCNaCGly~k~~~~~  115 (142)
                      |+||+|++||+||++++|.. |||||||||++++++
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk~~~~   36 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKKYGKM   36 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHHHSS-
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHHhCCC
Confidence            89999999999999999975 999999999998863


No 4  
>KOG1601|consensus
Probab=99.30  E-value=3.7e-12  Score=98.57  Aligned_cols=104  Identities=36%  Similarity=0.544  Sum_probs=74.2

Q ss_pred             cccccCCCCCCCCcccCCCCcccccccccccccccccccccc--cccCCCccccccCCCCccccccCCCCCCccccCCCC
Q psy12567         21 RECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRF--LFASLPVEDIEYFTEGRECVNCGAISTPLWRRDGTG   98 (142)
Q Consensus        21 ~~C~nCgt~~TplWr~~~~g~~lCnacg~~~k~~G~~~~~R~--~~~~~~~~~~~~~~~~~~C~nC~tt~Tp~WRr~~~G   98 (142)
                      .+|.+++...||.|+.+..+++.+..+..+....+   ..+.  .........+........|.+|+++.||+||+++.|
T Consensus       143 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~t~~~r~~~~g  219 (340)
T KOG1601|consen  143 GESVSSLLFPTPLQRRDSSGHYNSINKELKKKSNG---ESSSDLESKPKKSSSASSEQNLRQCSNCGTTKTPLWRRGPEG  219 (340)
T ss_pred             cccccccccccceeccCCCCccccccccccccccc---cccCCccccchhhhhccccccCcccCCCCCCCCcceecCCCC
Confidence            38999999999999999888888888862222222   1111  111111111122122589999999999999999999


Q ss_pred             -CcccchhhhhHHhcCCCCCCCCCCCCccc
Q psy12567         99 -HYLCNACGLYHKMNGMNRPLVKQPRRLRF  127 (142)
Q Consensus        99 -~~lCNaCGly~k~~~~~RP~~~~k~~~~~  127 (142)
                       +.+|||||+|++++++.|++.+.+..+..
T Consensus       220 ~~~~cnacgl~~k~~~~~r~~~~~~~~~~~  249 (340)
T KOG1601|consen  220 PKSLCNACGLRYKKGGVRRPLPEKRPASSP  249 (340)
T ss_pred             CccccccchhhhhhcCccccccccCccccc
Confidence             89999999999999988888776655443


No 5  
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=98.99  E-value=8.6e-11  Score=76.70  Aligned_cols=34  Identities=47%  Similarity=0.891  Sum_probs=30.2

Q ss_pred             ccccCCCCCCCCcccCCC-Cccccccccccccccc
Q psy12567         22 ECVNCGAISTPLWRRDGT-GHYLCNARLFSTSFTG   55 (142)
Q Consensus        22 ~C~nCgt~~TplWr~~~~-g~~lCnacg~~~k~~G   55 (142)
                      +|+||+++.||+||+++. +..||||||+|.+..+
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~   35 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHG   35 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcC
Confidence            599999999999999995 5899999999876665


No 6  
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=98.99  E-value=1.7e-10  Score=74.59  Aligned_cols=38  Identities=47%  Similarity=0.879  Sum_probs=33.2

Q ss_pred             CCcccccCCCCCCCCcccCCCCc-ccccccccccccccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGH-YLCNARLFSTSFTGY   56 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~-~lCnacg~~~k~~G~   56 (142)
                      ..+.|+||+++.||+||+++.|. .||||||++.+..+.
T Consensus         2 ~~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~   40 (52)
T smart00401        2 SGRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGG   40 (52)
T ss_pred             CCCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCC
Confidence            46799999999999999999996 999999988765553


No 7  
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=98.97  E-value=4.8e-11  Score=71.85  Aligned_cols=33  Identities=45%  Similarity=0.853  Sum_probs=25.1

Q ss_pred             cccCCCCCCCCcccCCCCcc-ccccccccccccc
Q psy12567         23 CVNCGAISTPLWRRDGTGHY-LCNARLFSTSFTG   55 (142)
Q Consensus        23 C~nCgt~~TplWr~~~~g~~-lCnacg~~~k~~G   55 (142)
                      |++|+++.||+||+++.|.. ||||||++.+..+
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk~~   34 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKKYG   34 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHHHS
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHHhC
Confidence            89999999999999999976 9999998765443


No 8  
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription]
Probab=98.95  E-value=9.4e-10  Score=98.64  Aligned_cols=61  Identities=30%  Similarity=0.532  Sum_probs=43.7

Q ss_pred             CCccccccCC-CCCCccccCCC-CCcccchhhhhHHhcCCCCCCCCCCCCccc-cc-CCCCCCcc
Q psy12567         77 EGRECVNCGA-ISTPLWRRDGT-GHYLCNACGLYHKMNGMNRPLVKQPRRLRF-DR-GNFNCYER  137 (142)
Q Consensus        77 ~~~~C~nC~t-t~Tp~WRr~~~-G~~lCNaCGly~k~~~~~RP~~~~k~~~~~-~R-~~~n~~~~  137 (142)
                      ....+.+|.+ +.||+||+... +-++||||+++-+.++..||+..+-+.... .+ -.|||++-
T Consensus       296 s~~~~s~~~~~~~tp~~~r~~~~~s~~~n~~~~~~~~~~~~~p~~pk~d~n~~~~~~~~~N~s~~  360 (498)
T COG5641         296 SDKKRSTLTTSTATPLWRRTSDKSSFSCNASGSALKPPGSKRPLLPKPDPNSKRSNATCMNCSST  360 (498)
T ss_pred             hhcCcccccccccCcccccccccccccccccccccCCcccccccCCCCChhhhhhhheecccccc
Confidence            3567888887 77888888765 579999999999999999999764332111 00 34777654


No 9  
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription]
Probab=98.91  E-value=4.5e-10  Score=100.69  Aligned_cols=50  Identities=46%  Similarity=0.979  Sum_probs=44.9

Q ss_pred             CccccccCCCCCCccccCCC-----CCcccchhhhhHHhcCCCC-CCCCCCCCccc
Q psy12567         78 GRECVNCGAISTPLWRRDGT-----GHYLCNACGLYHKMNGMNR-PLVKQPRRLRF  127 (142)
Q Consensus        78 ~~~C~nC~tt~Tp~WRr~~~-----G~~lCNaCGly~k~~~~~R-P~~~~k~~~~~  127 (142)
                      ..+|.||.|+.||+|||+..     |.+||||||||+++||++| |+.++..-+.+
T Consensus       158 ~~vc~Nc~t~stPlwrR~~~~~s~~~n~lcnaCgl~~klhg~~r~P~t~ks~~~ks  213 (498)
T COG5641         158 PHVCSNCKTTSTPLWRRASSESSLPGNNLCNACGLYLKLHGSPRAPISLKSDSIKS  213 (498)
T ss_pred             cchhccccccCCccccccccccccCCccccccccccccccCCcCCCcccccccccc
Confidence            34999999999999999999     8999999999999999999 99887665543


No 10 
>KOG1601|consensus
Probab=97.73  E-value=1.8e-05  Score=61.19  Aligned_cols=36  Identities=47%  Similarity=0.863  Sum_probs=33.0

Q ss_pred             CcccccCCCCCCCCcccCCCC-ccccccccccccccc
Q psy12567         20 GRECVNCGAISTPLWRRDGTG-HYLCNARLFSTSFTG   55 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g-~~lCnacg~~~k~~G   55 (142)
                      ...|.+|++..||+||+++.| +.+|||||++.+..+
T Consensus       199 ~~~c~~~~~~~t~~~r~~~~g~~~~cnacgl~~k~~~  235 (340)
T KOG1601|consen  199 LRQCSNCGTTKTPLWRRGPEGPKSLCNACGLRYKKGG  235 (340)
T ss_pred             CcccCCCCCCCCcceecCCCCCccccccchhhhhhcC
Confidence            589999999999999999999 999999999877664


No 11 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=91.12  E-value=0.21  Score=35.39  Aligned_cols=83  Identities=28%  Similarity=0.637  Sum_probs=47.3

Q ss_pred             ccccCCCCCCCCcccCCCCcccccccccccccc---cccccccccccCC--C--c--ccc-ccCCCCccccccCCCCCCc
Q psy12567         22 ECVNCGAISTPLWRRDGTGHYLCNARLFSTSFT---GYFIMSRFLFASL--P--V--EDI-EYFTEGRECVNCGAISTPL   91 (142)
Q Consensus        22 ~C~nCgt~~TplWr~~~~g~~lCnacg~~~k~~---G~~~~~R~~~~~~--~--~--~~~-~~~~~~~~C~nC~tt~Tp~   91 (142)
                      -|.+||+.-.|.     .+.+.|..|++.....   .+....+ +..+.  .  .  ... ........|.+||...--.
T Consensus         2 fC~~Cg~~l~~~-----~~~~~C~~C~~~~~~~~~~~~v~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~Cp~Cg~~~a~f   75 (104)
T TIGR01384         2 FCPKCGSLMTPK-----NGVYVCPSCGYEKEKKPEDDYKVTEK-VKHKIKETIIIREEDSETLPTTRVECPKCGHKEAYY   75 (104)
T ss_pred             CCcccCcccccC-----CCeEECcCCCCccccccccccEEEEE-eccccccceeeccccccCCCcccCCCCCCCCCeeEE
Confidence            589999987652     3578999999754321   1111111 11100  0  0  000 1123468999999776433


Q ss_pred             c----ccCCCCC---cccchhhhhHH
Q psy12567         92 W----RRDGTGH---YLCNACGLYHK  110 (142)
Q Consensus        92 W----Rr~~~G~---~lCNaCGly~k  110 (142)
                      |    |..++|.   ++|-.||..|+
T Consensus        76 ~~~Q~RsadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        76 WLLQTRRADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             EEeccCCCCCCcEEEEEeCCCCCeeE
Confidence            3    4455563   79999998775


No 12 
>KOG3554|consensus
Probab=88.53  E-value=0.26  Score=45.16  Aligned_cols=37  Identities=30%  Similarity=0.695  Sum_probs=31.2

Q ss_pred             CCccccccCCCCCCccc-cCCCC--CcccchhhhhHHhcC
Q psy12567         77 EGRECVNCGAISTPLWR-RDGTG--HYLCNACGLYHKMNG  113 (142)
Q Consensus        77 ~~~~C~nC~tt~Tp~WR-r~~~G--~~lCNaCGly~k~~~  113 (142)
                      .++.|.+|+|++.-.|= .||.|  ..||-.|-+|||+.|
T Consensus       385 ~g~~CEsC~ttqs~qWYsWGppnmqcrLCasCWiyWKKyg  424 (693)
T KOG3554|consen  385 DGRACESCYTTQSLQWYSWGPPNMQCRLCASCWIYWKKYG  424 (693)
T ss_pred             CCCcccccccccccceeccCCCCccchhhHHHHHHHHHhc
Confidence            37899999999999873 47776  479999999999975


No 13 
>PF12773 DZR:  Double zinc ribbon
Probab=86.44  E-value=0.84  Score=28.12  Aligned_cols=13  Identities=46%  Similarity=0.994  Sum_probs=7.3

Q ss_pred             CccccccCCCCCC
Q psy12567         78 GRECVNCGAISTP   90 (142)
Q Consensus        78 ~~~C~nC~tt~Tp   90 (142)
                      ...|.+|++...+
T Consensus        29 ~~~C~~Cg~~~~~   41 (50)
T PF12773_consen   29 KKICPNCGAENPP   41 (50)
T ss_pred             CCCCcCCcCCCcC
Confidence            4566666665433


No 14 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=85.45  E-value=0.4  Score=29.20  Aligned_cols=26  Identities=23%  Similarity=0.533  Sum_probs=19.1

Q ss_pred             ccccCCCCCCCCcccCCCCccccccccc
Q psy12567         22 ECVNCGAISTPLWRRDGTGHYLCNARLF   49 (142)
Q Consensus        22 ~C~nCgt~~TplWr~~~~g~~lCnacg~   49 (142)
                      .|.+||+..  +--...+|.++|..||+
T Consensus         2 ~Cp~Cg~~~--~~~D~~~g~~vC~~CG~   27 (43)
T PF08271_consen    2 KCPNCGSKE--IVFDPERGELVCPNCGL   27 (43)
T ss_dssp             SBTTTSSSE--EEEETTTTEEEETTT-B
T ss_pred             CCcCCcCCc--eEEcCCCCeEECCCCCC
Confidence            599999966  33345678999999974


No 15 
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=81.74  E-value=0.79  Score=39.60  Aligned_cols=29  Identities=31%  Similarity=0.855  Sum_probs=26.7

Q ss_pred             CCCcccccCCCCCCCCcccCCCCccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNAR   47 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnac   47 (142)
                      .+-..|.+||+.. |.|-.-.=|-+||..|
T Consensus        18 ~~Nk~CaDCga~~-P~W~S~nlGvfiCi~C   46 (319)
T COG5347          18 SSNKKCADCGAPN-PTWASVNLGVFLCIDC   46 (319)
T ss_pred             cccCccccCCCCC-CceEecccCeEEEeec
Confidence            5567999999999 9998888899999999


No 16 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=80.80  E-value=0.99  Score=29.67  Aligned_cols=25  Identities=32%  Similarity=0.616  Sum_probs=20.4

Q ss_pred             CCcccccCCCCCCCCcccCCCCccccccccccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGHYLCNARLFST   51 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~   51 (142)
                      .--+|.+||...-|        |.+|..||+|.
T Consensus        26 ~l~~C~~CG~~~~~--------H~vC~~CG~Y~   50 (57)
T PRK12286         26 GLVECPNCGEPKLP--------HRVCPSCGYYK   50 (57)
T ss_pred             cceECCCCCCccCC--------eEECCCCCcCC
Confidence            34579999987776        77999999885


No 17 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=80.62  E-value=1  Score=32.84  Aligned_cols=39  Identities=31%  Similarity=0.730  Sum_probs=28.0

Q ss_pred             CCCCccccccCCCCCCccccCCCCCcccchhhhhHHhcCC
Q psy12567         75 FTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGM  114 (142)
Q Consensus        75 ~~~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~~  114 (142)
                      ......|++|+... |.|-.-.-|-.||-.|.-..+..|+
T Consensus        10 ~~~N~~CaDCg~~~-p~w~s~~~GiflC~~Cag~HR~lg~   48 (116)
T PF01412_consen   10 KPGNKVCADCGAPN-PTWASLNYGIFLCLECAGIHRSLGV   48 (116)
T ss_dssp             STTCTB-TTT-SBS---EEETTTTEEE-HHHHHHHHHHTT
T ss_pred             CcCcCcCCCCCCCC-CCEEEeecChhhhHHHHHHHHHhcc
Confidence            46789999999665 5999999999999999887776664


No 18 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=79.12  E-value=1.8  Score=31.44  Aligned_cols=38  Identities=32%  Similarity=0.829  Sum_probs=31.9

Q ss_pred             CCccccccCCCCCCccccCCCCCcccchhhhhHHhcCCC
Q psy12567         77 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMN  115 (142)
Q Consensus        77 ~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~~~  115 (142)
                      ....|++|+.. -|.|-.-.-|-.||-.|.-..+..|++
T Consensus         2 ~N~~CaDC~~~-~p~w~s~~~GifvC~~CsgiHR~lg~h   39 (112)
T smart00105        2 GNKKCFDCGAP-NPTWASVNLGVFLCIECSGIHRSLGVH   39 (112)
T ss_pred             CCCcccCCCCC-CCCcEEeccceeEhHHhHHHHHhcCCC
Confidence            46789999984 599999999999999998887777653


No 19 
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=78.13  E-value=1.2  Score=28.87  Aligned_cols=25  Identities=28%  Similarity=0.607  Sum_probs=19.3

Q ss_pred             CCcccccCCCCCCCCcccCCCCccccccccccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGHYLCNARLFST   51 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~   51 (142)
                      ..-.|.+||...-|        |.+|.+||+|.
T Consensus        25 ~l~~c~~cg~~~~~--------H~vc~~cG~y~   49 (56)
T PF01783_consen   25 NLVKCPNCGEPKLP--------HRVCPSCGYYK   49 (56)
T ss_dssp             SEEESSSSSSEEST--------TSBCTTTBBSS
T ss_pred             ceeeeccCCCEecc--------cEeeCCCCeEC
Confidence            44689999975544        67999999875


No 20 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=75.86  E-value=1.6  Score=31.75  Aligned_cols=37  Identities=27%  Similarity=0.642  Sum_probs=23.7

Q ss_pred             CCCCccccccCCCCCCccccCCCCCcccchhhhhHHh
Q psy12567         75 FTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKM  111 (142)
Q Consensus        75 ~~~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~  111 (142)
                      ....-.|.+|+...-++=....-++.+|-.||+|+-.
T Consensus        18 lpt~f~CP~Cge~~v~v~~~k~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         18 LPKIFECPRCGKVSISVKIKKNIAIITCGNCGLYTEF   54 (99)
T ss_pred             CCcEeECCCCCCeEeeeecCCCcceEECCCCCCccCE
Confidence            3456889999953322211123457899999998554


No 21 
>COG3529 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=75.31  E-value=0.73  Score=31.23  Aligned_cols=34  Identities=29%  Similarity=0.628  Sum_probs=28.3

Q ss_pred             CCCccccccCCCCCC-ccccCCCCCcccchhhhhH
Q psy12567         76 TEGRECVNCGAISTP-LWRRDGTGHYLCNACGLYH  109 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp-~WRr~~~G~~lCNaCGly~  109 (142)
                      ..+..|..|.+.+|- +||.+.-...-|-+||.-.
T Consensus         8 IAGA~CP~C~~~Dtl~mW~En~ve~vECV~CG~~~   42 (66)
T COG3529           8 IAGAVCPACQAQDTLAMWRENNVEIVECVKCGHHM   42 (66)
T ss_pred             hccCCCcccchhhHHHHHHhcCCceEehhhcchHh
Confidence            457899999999998 7887777788999999843


No 22 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=74.48  E-value=1.6  Score=31.64  Aligned_cols=28  Identities=32%  Similarity=0.875  Sum_probs=24.2

Q ss_pred             CcccccCCCCCCCCcccCCCCcccccccc
Q psy12567         20 GRECVNCGAISTPLWRRDGTGHYLCNARL   48 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g~~lCnacg   48 (142)
                      -..|.+||+ .-|.|-.-.-|-+||..|-
T Consensus         3 N~~CaDC~~-~~p~w~s~~~GifvC~~Cs   30 (112)
T smart00105        3 NKKCFDCGA-PNPTWASVNLGVFLCIECS   30 (112)
T ss_pred             CCcccCCCC-CCCCcEEeccceeEhHHhH
Confidence            468999998 4599988888999999994


No 23 
>KOG0703|consensus
Probab=73.20  E-value=1.8  Score=37.08  Aligned_cols=29  Identities=28%  Similarity=0.759  Sum_probs=26.4

Q ss_pred             CCCcccccCCCCCCCCcccCCCCccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNAR   47 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnac   47 (142)
                      .+.+.|.+||+. .|-|-...-|-++|.-|
T Consensus        23 ~~N~~CADC~a~-~P~WaSwnlGvFiC~~C   51 (287)
T KOG0703|consen   23 PDNKVCADCGAK-GPRWASWNLGVFICLRC   51 (287)
T ss_pred             cccCcccccCCC-CCCeEEeecCeEEEeec
Confidence            447899999998 99999989999999998


No 24 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=72.94  E-value=1.8  Score=31.51  Aligned_cols=30  Identities=30%  Similarity=0.732  Sum_probs=20.6

Q ss_pred             CCCcccccCCCCCCCCcccCCCCcccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNARL   48 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnacg   48 (142)
                      .+-+.|.+||+.. |.|..-.-|-+||..|.
T Consensus        11 ~~N~~CaDCg~~~-p~w~s~~~GiflC~~Ca   40 (116)
T PF01412_consen   11 PGNKVCADCGAPN-PTWASLNYGIFLCLECA   40 (116)
T ss_dssp             TTCTB-TTT-SBS---EEETTTTEEE-HHHH
T ss_pred             cCcCcCCCCCCCC-CCEEEeecChhhhHHHH
Confidence            4557999999655 48988888999999994


No 25 
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=72.19  E-value=2.3  Score=36.74  Aligned_cols=40  Identities=30%  Similarity=0.740  Sum_probs=32.7

Q ss_pred             ccCCCCccccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         73 EYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        73 ~~~~~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      ........|+.|++.. |.|-.=.-|-.||-.|.=..|.-|
T Consensus        15 ~~~~~Nk~CaDCga~~-P~W~S~nlGvfiCi~CagvHRsLG   54 (319)
T COG5347          15 KSDSSNKKCADCGAPN-PTWASVNLGVFLCIDCAGVHRSLG   54 (319)
T ss_pred             hhccccCccccCCCCC-CceEecccCeEEEeecchhhhccc
Confidence            3456789999999999 999999999999999965444433


No 26 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=70.49  E-value=2.8  Score=25.86  Aligned_cols=25  Identities=36%  Similarity=0.752  Sum_probs=19.7

Q ss_pred             CcccccCCCCCCCCcccCCCCcccccccc
Q psy12567         20 GRECVNCGAISTPLWRRDGTGHYLCNARL   48 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g~~lCnacg   48 (142)
                      +..|.+|   .+|+.+ +-+|...|.+|+
T Consensus        17 ~~~Cp~C---~~PL~~-~k~g~~~Cv~C~   41 (41)
T PF06677_consen   17 DEHCPDC---GTPLMR-DKDGKIYCVSCG   41 (41)
T ss_pred             cCccCCC---CCeeEE-ecCCCEECCCCC
Confidence            4578888   489997 667888999884


No 27 
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=69.55  E-value=3.5  Score=30.37  Aligned_cols=88  Identities=18%  Similarity=0.443  Sum_probs=49.0

Q ss_pred             cccccCCCCCCCCcccCC-CCcccccccccccccccccccccccccCCCc------------cccccCCC-CccccccCC
Q psy12567         21 RECVNCGAISTPLWRRDG-TGHYLCNARLFSTSFTGYFIMSRFLFASLPV------------EDIEYFTE-GRECVNCGA   86 (142)
Q Consensus        21 ~~C~nCgt~~TplWr~~~-~g~~lCnacg~~~k~~G~~~~~R~~~~~~~~------------~~~~~~~~-~~~C~nC~t   86 (142)
                      .-|.+||+.--|  +.+. .+.+.|-.||+........+.........+.            ........ ...|..||.
T Consensus         3 ~FCp~Cgsll~p--~~~~~~~~l~C~kCgye~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CpkCg~   80 (113)
T COG1594           3 RFCPKCGSLLYP--KKDDEGGKLVCRKCGYEEEASNKKVYRYSVKEAVEKKKEVVLVVEDETQGAKTLPTAKEKCPKCGN   80 (113)
T ss_pred             cccCCccCeeEE--eEcCCCcEEECCCCCcchhccccceeEEEEeeccCCcceeeeeecccccCccccccccccCCCCCC
Confidence            468999998877  4443 3478899999865443211001100110010            00001111 356999998


Q ss_pred             CCCC----ccccCCCCC---cccchhhhhHH
Q psy12567         87 ISTP----LWRRDGTGH---YLCNACGLYHK  110 (142)
Q Consensus        87 t~Tp----~WRr~~~G~---~lCNaCGly~k  110 (142)
                      .+=-    +=|.++++.   +.|-.||-.|+
T Consensus        81 ~ea~y~~~QtRsaDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          81 KEAYYWQLQTRSADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             ceeEEEeeehhccCCCceEEEEecccCCEee
Confidence            7633    336666663   68999998776


No 28 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=69.37  E-value=2.7  Score=27.36  Aligned_cols=24  Identities=29%  Similarity=0.627  Sum_probs=18.8

Q ss_pred             CcccccCCCCCCCCcccCCCCccccccccccc
Q psy12567         20 GRECVNCGAISTPLWRRDGTGHYLCNARLFST   51 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~   51 (142)
                      --+|.+||...-|        |.+|..||+|.
T Consensus        26 l~~C~~cG~~~~~--------H~vc~~cG~Y~   49 (55)
T TIGR01031        26 LVVCPNCGEFKLP--------HRVCPSCGYYK   49 (55)
T ss_pred             ceECCCCCCcccC--------eeECCccCeEC
Confidence            3479999986555        67999999885


No 29 
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=68.69  E-value=6.1  Score=34.09  Aligned_cols=72  Identities=22%  Similarity=0.434  Sum_probs=46.4

Q ss_pred             CCCcccccCCCCCCCCccc--CCCC--cccccccccccccccccccccccccCCCccccccCCCCccccccCCCCCC-cc
Q psy12567         18 TEGRECVNCGAISTPLWRR--DGTG--HYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTP-LW   92 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~--~~~g--~~lCnacg~~~k~~G~~~~~R~~~~~~~~~~~~~~~~~~~C~nC~tt~Tp-~W   92 (142)
                      .....|.-||+...-.+.+  +..|  ...|.-|+..=.                       .....|.+||.+..- .|
T Consensus       185 ~~~~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~teW~-----------------------~~R~~C~~Cg~~~~l~y~  241 (309)
T PRK03564        185 EQRQFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCESEWH-----------------------VVRVKCSNCEQSGKLHYW  241 (309)
T ss_pred             cCCCCCCCCCCcchhheeeccCCCCceEEEcCCCCCccc-----------------------ccCccCCCCCCCCceeee
Confidence            3467999999987665433  2345  567999953211                       113679999986544 35


Q ss_pred             ccCCC--C--CcccchhhhhHHhc
Q psy12567         93 RRDGT--G--HYLCNACGLYHKMN  112 (142)
Q Consensus        93 Rr~~~--G--~~lCNaCGly~k~~  112 (142)
                      --+++  +  -.+|..|+-|.|.-
T Consensus       242 ~~~~~~~~~r~e~C~~C~~YlK~~  265 (309)
T PRK03564        242 SLDSEQAAVKAESCGDCGTYLKIL  265 (309)
T ss_pred             eecCCCcceEeeecccccccceec
Confidence            43332  3  26999999998863


No 30 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=68.35  E-value=3.5  Score=34.84  Aligned_cols=32  Identities=22%  Similarity=0.331  Sum_probs=24.1

Q ss_pred             cCCCCcccccCCCCCCCCcccCCCCccccccccc
Q psy12567         16 YFTEGRECVNCGAISTPLWRRDGTGHYLCNARLF   49 (142)
Q Consensus        16 ~~~~~~~C~nCgt~~TplWr~~~~g~~lCnacg~   49 (142)
                      +......|.+||.  ++.-.....|.++|..||+
T Consensus         7 ~~~~~~~Cp~Cg~--~~iv~d~~~Ge~vC~~CG~   38 (310)
T PRK00423          7 EEEEKLVCPECGS--DKLIYDYERGEIVCADCGL   38 (310)
T ss_pred             hcccCCcCcCCCC--CCeeEECCCCeEeecccCC
Confidence            3455678999996  4554456789999999985


No 31 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=68.29  E-value=2.2  Score=25.48  Aligned_cols=25  Identities=36%  Similarity=1.034  Sum_probs=20.8

Q ss_pred             ccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         79 RECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        79 ~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      ..|..|+..    |-...+|.+.|..||-
T Consensus         9 ~~C~~C~~~----~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    9 EPCPVCGSR----WFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CcCCCCCCe----EeEccCCEEEhhhCce
Confidence            459999987    6668899999999985


No 32 
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=67.28  E-value=3.8  Score=36.43  Aligned_cols=42  Identities=26%  Similarity=0.684  Sum_probs=34.1

Q ss_pred             ccCCCCccccccCCCCCCccccCCCCCcccchhhhhHHhcCCC
Q psy12567         73 EYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMN  115 (142)
Q Consensus        73 ~~~~~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~~~  115 (142)
                      ........|+.|+... |.|-.-.-|-.||..|.=..|..|++
T Consensus        17 ~~kPgNk~CaDCga~n-PtWASvn~GIFLCl~CSGVHRsLGvH   58 (395)
T PLN03114         17 KAKSDNKICFDCNAKN-PTWASVTYGIFLCIDCSAVHRSLGVH   58 (395)
T ss_pred             HhCcCCCcCccCCCCC-CCceeeccceeehhhhhHhhccCCCC
Confidence            3446789999999875 99999999999999997766665543


No 33 
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=66.32  E-value=4.9  Score=24.28  Aligned_cols=29  Identities=28%  Similarity=0.612  Sum_probs=21.4

Q ss_pred             cccccCCCCCCCCccc-CCCCccccccccc
Q psy12567         21 RECVNCGAISTPLWRR-DGTGHYLCNARLF   49 (142)
Q Consensus        21 ~~C~nCgt~~TplWr~-~~~g~~lCnacg~   49 (142)
                      ..|.+||....=.|.. +..|.++|+.|+.
T Consensus         4 ~pCP~CGG~DrFr~~d~~g~G~~~C~~Cg~   33 (37)
T smart00778        4 GPCPNCGGSDRFRFDDKDGRGTWFCSVCGA   33 (37)
T ss_pred             cCCCCCCCccccccccCCCCcCEEeCCCCC
Confidence            4689999877766533 3568999999963


No 34 
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=66.05  E-value=3  Score=28.59  Aligned_cols=35  Identities=26%  Similarity=0.581  Sum_probs=26.6

Q ss_pred             CcccccCCCCCCC-CcccCCCCcccccccccccccc
Q psy12567         20 GRECVNCGAISTP-LWRRDGTGHYLCNARLFSTSFT   54 (142)
Q Consensus        20 ~~~C~nCgt~~Tp-lWr~~~~g~~lCnacg~~~k~~   54 (142)
                      +-.|..|++..|= +|+.++....-|.+|||....+
T Consensus         8 Ga~CP~C~~~D~i~~~~e~~ve~vECV~CGy~e~~~   43 (71)
T PF09526_consen    8 GAVCPKCQAMDTIMMWRENGVEYVECVECGYTERQP   43 (71)
T ss_pred             CccCCCCcCccEEEEEEeCCceEEEecCCCCeeccC
Confidence            4589999998887 5555555577899999876544


No 35 
>KOG3740|consensus
Probab=65.62  E-value=2.5  Score=39.91  Aligned_cols=32  Identities=28%  Similarity=0.721  Sum_probs=28.7

Q ss_pred             CCCccccccCCCCCCccccCCCC----Ccccchhhh
Q psy12567         76 TEGRECVNCGAISTPLWRRDGTG----HYLCNACGL  107 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp~WRr~~~G----~~lCNaCGl  107 (142)
                      .+.-.|..|.|..||.|+.-+.|    +++|.+|--
T Consensus       460 ~~P~~caqcktdftp~wk~ekstq~d~~i~cE~cvt  495 (706)
T KOG3740|consen  460 TEPYACAQCKTDFTPAWKKEKSTQADAAIVCENCVT  495 (706)
T ss_pred             CCchhhhhcccccccccccccccCcchHHHHHhhhh
Confidence            44789999999999999999998    789999965


No 36 
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=65.56  E-value=3.6  Score=36.56  Aligned_cols=30  Identities=27%  Similarity=0.699  Sum_probs=26.0

Q ss_pred             CCCcccccCCCCCCCCcccCCCCcccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNARL   48 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnacg   48 (142)
                      ..-+.|.+||+.. |.|-.-.-|-+||..|-
T Consensus        20 PgNk~CaDCga~n-PtWASvn~GIFLCl~CS   49 (395)
T PLN03114         20 SDNKICFDCNAKN-PTWASVTYGIFLCIDCS   49 (395)
T ss_pred             cCCCcCccCCCCC-CCceeeccceeehhhhh
Confidence            4567999999875 99988888999999993


No 37 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=65.26  E-value=4.6  Score=24.81  Aligned_cols=29  Identities=28%  Similarity=0.615  Sum_probs=19.5

Q ss_pred             CCCcccccCCCCCCCCcccCCCCcccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNARL   48 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnacg   48 (142)
                      .++.+|..||.+ ..-+.. ..+.+-|.+|+
T Consensus        16 ~~g~~CP~Cg~~-~~~~~~-~~~~~~C~~C~   44 (46)
T PF12760_consen   16 PDGFVCPHCGST-KHYRLK-TRGRYRCKACR   44 (46)
T ss_pred             CCCCCCCCCCCe-eeEEeC-CCCeEECCCCC
Confidence            345679999887 443333 36778888885


No 38 
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=65.02  E-value=3.3  Score=27.70  Aligned_cols=34  Identities=21%  Similarity=0.468  Sum_probs=25.9

Q ss_pred             CcccccCCCCCCC-CcccCCCCccccccccccccc
Q psy12567         20 GRECVNCGAISTP-LWRRDGTGHYLCNARLFSTSF   53 (142)
Q Consensus        20 ~~~C~nCgt~~Tp-lWr~~~~g~~lCnacg~~~k~   53 (142)
                      +-.|..|++..|= +|+.++....-|.+|||....
T Consensus         9 GA~CP~C~~~Dtl~~~~e~~~e~vECv~Cg~~~~~   43 (59)
T TIGR02443         9 GAVCPACSAQDTLAMWKENNIELVECVECGYQEQQ   43 (59)
T ss_pred             cccCCCCcCccEEEEEEeCCceEEEeccCCCcccc
Confidence            4589999998887 565555567789999887543


No 39 
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=64.87  E-value=2.5  Score=28.23  Aligned_cols=34  Identities=26%  Similarity=0.663  Sum_probs=26.3

Q ss_pred             CCCccccccCCCCCC-ccccCCCCCcccchhhhhH
Q psy12567         76 TEGRECVNCGAISTP-LWRRDGTGHYLCNACGLYH  109 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp-~WRr~~~G~~lCNaCGly~  109 (142)
                      ..+..|-.|++.+|- +|+.++....-|-+||...
T Consensus         7 IAGA~CP~C~~~Dtl~~~~e~~~e~vECv~Cg~~~   41 (59)
T TIGR02443         7 IAGAVCPACSAQDTLAMWKENNIELVECVECGYQE   41 (59)
T ss_pred             eccccCCCCcCccEEEEEEeCCceEEEeccCCCcc
Confidence            447899999999998 5655555568999999854


No 40 
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=64.22  E-value=2.6  Score=28.86  Aligned_cols=35  Identities=31%  Similarity=0.785  Sum_probs=26.7

Q ss_pred             CCCccccccCCCCCCc-cccCCCCCcccchhhhhHH
Q psy12567         76 TEGRECVNCGAISTPL-WRRDGTGHYLCNACGLYHK  110 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp~-WRr~~~G~~lCNaCGly~k  110 (142)
                      ..+-.|-.|++.+|.+ |+-+..-..-|-+||....
T Consensus         6 IAGa~CP~C~~~D~i~~~~e~~ve~vECV~CGy~e~   41 (71)
T PF09526_consen    6 IAGAVCPKCQAMDTIMMWRENGVEYVECVECGYTER   41 (71)
T ss_pred             ecCccCCCCcCccEEEEEEeCCceEEEecCCCCeec
Confidence            3478999999999995 5544444679999998544


No 41 
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=63.81  E-value=2.6  Score=32.29  Aligned_cols=30  Identities=30%  Similarity=0.537  Sum_probs=23.1

Q ss_pred             CccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         78 GRECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        78 ~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      =..|..|+..+|-+=+.+..=...|+|||-
T Consensus       102 yVlC~~C~spdT~l~k~~r~~~l~C~ACGa  131 (138)
T PRK03988        102 YVICPECGSPDTKLIKEGRIWVLKCEACGA  131 (138)
T ss_pred             cEECCCCCCCCcEEEEcCCeEEEEcccCCC
Confidence            478999999999996642222468999996


No 42 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=63.57  E-value=4.5  Score=26.35  Aligned_cols=37  Identities=19%  Similarity=0.411  Sum_probs=24.9

Q ss_pred             CCccccCCCCcccccCCCCCCCCcccCCCCcccccccccc
Q psy12567         11 VEDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNARLFS   50 (142)
Q Consensus        11 ~~~~~~~~~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~   50 (142)
                      .-.++....+..|+.||...-.   ......+.|..||+.
T Consensus        19 v~~v~~~~TSq~C~~CG~~~~~---~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   19 VVEVDEAYTSQTCPRCGHRNKK---RRSGRVFTCPNCGFE   55 (69)
T ss_pred             EEEECCCCCccCccCccccccc---ccccceEEcCCCCCE
Confidence            3344444578899999997665   222236899999875


No 43 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=63.56  E-value=8.3  Score=36.31  Aligned_cols=18  Identities=33%  Similarity=0.905  Sum_probs=10.9

Q ss_pred             CCCccccccCCCCCCccc
Q psy12567         76 TEGRECVNCGAISTPLWR   93 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp~WR   93 (142)
                      .....|.+||+...+.|.
T Consensus        39 ~~~~fC~~CG~~~~~~~~   56 (645)
T PRK14559         39 VDEAHCPNCGAETGTIWW   56 (645)
T ss_pred             cccccccccCCcccchhh
Confidence            345667777766655554


No 44 
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=63.34  E-value=8.8  Score=32.99  Aligned_cols=72  Identities=18%  Similarity=0.289  Sum_probs=47.3

Q ss_pred             CCCcccccCCCCCCCCcccC---CCC--cccccccccccccccccccccccccCCCccccccCCCCccccccCCCCCC-c
Q psy12567         18 TEGRECVNCGAISTPLWRRD---GTG--HYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTP-L   91 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~---~~g--~~lCnacg~~~k~~G~~~~~R~~~~~~~~~~~~~~~~~~~C~nC~tt~Tp-~   91 (142)
                      .....|.-||+...-...+.   ..|  ...|.-|+..-.                       .....|.+||.++.- .
T Consensus       182 ~~~~~CPvCGs~P~~s~~~~~~~~~G~RyL~CslC~teW~-----------------------~~R~~C~~Cg~~~~l~y  238 (305)
T TIGR01562       182 ESRTLCPACGSPPVASMVRQGGKETGLRYLSCSLCATEWH-----------------------YVRVKCSHCEESKHLAY  238 (305)
T ss_pred             CCCCcCCCCCChhhhhhhcccCCCCCceEEEcCCCCCccc-----------------------ccCccCCCCCCCCceee
Confidence            34568999999887655544   345  567999943211                       113689999987644 3


Q ss_pred             cccCC----CC--CcccchhhhhHHhc
Q psy12567         92 WRRDG----TG--HYLCNACGLYHKMN  112 (142)
Q Consensus        92 WRr~~----~G--~~lCNaCGly~k~~  112 (142)
                      |--..    .+  -.+|..|+-|.|.-
T Consensus       239 ~~~e~~~~~~~~r~e~C~~C~~YlK~~  265 (305)
T TIGR01562       239 LSLEHDAEKAVLKAETCDSCQGYLKIL  265 (305)
T ss_pred             EeecCCCCCcceEEeeccccccchhhh
Confidence            65332    23  25999999998874


No 45 
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=62.10  E-value=2.9  Score=30.78  Aligned_cols=30  Identities=30%  Similarity=0.561  Sum_probs=22.6

Q ss_pred             CccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         78 GRECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        78 ~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      =..|..|+..+|-+=+.+..=...|+|||-
T Consensus        80 yVlC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       80 YVLCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             cEECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            378999999999997652221357999994


No 46 
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=62.06  E-value=2.9  Score=31.77  Aligned_cols=30  Identities=23%  Similarity=0.488  Sum_probs=22.7

Q ss_pred             CccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         78 GRECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        78 ~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      =..|..|+..+|-+=+.+..=...|+|||-
T Consensus        97 yVlC~~C~sPdT~l~k~~r~~~l~C~ACGa  126 (133)
T TIGR00311        97 YVICRECNRPDTRIIKEGRVSLLKCEACGA  126 (133)
T ss_pred             eEECCCCCCCCcEEEEeCCeEEEecccCCC
Confidence            478999999999987642221358999996


No 47 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=61.28  E-value=6.9  Score=28.45  Aligned_cols=39  Identities=18%  Similarity=0.261  Sum_probs=25.2

Q ss_pred             cccCCCCcccccCCCCCCCCcccCCCCcccccccccccc
Q psy12567         14 IEYFTEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTS   52 (142)
Q Consensus        14 ~~~~~~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~k   52 (142)
                      .......-.|.+||...-+.=.....+|..|..||+|..
T Consensus        15 k~klpt~f~CP~Cge~~v~v~~~k~~~h~~C~~CG~y~~   53 (99)
T PRK14892         15 KPKLPKIFECPRCGKVSISVKIKKNIAIITCGNCGLYTE   53 (99)
T ss_pred             ccCCCcEeECCCCCCeEeeeecCCCcceEECCCCCCccC
Confidence            333345668999995333322223567999999998854


No 48 
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=59.82  E-value=4.1  Score=31.16  Aligned_cols=33  Identities=27%  Similarity=0.292  Sum_probs=24.3

Q ss_pred             CCcccccCCCCCCCCcccCCCCccccccccccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGHYLCNARLFST   51 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~   51 (142)
                      +--.|..|+...|-+-..+..-...|+|||...
T Consensus       101 ~yVlC~~C~spdT~l~k~~r~~~l~C~ACGa~~  133 (138)
T PRK03988        101 EYVICPECGSPDTKLIKEGRIWVLKCEACGAET  133 (138)
T ss_pred             hcEECCCCCCCCcEEEEcCCeEEEEcccCCCCC
Confidence            345799999999999764333356799997543


No 49 
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=57.65  E-value=4.8  Score=30.60  Aligned_cols=33  Identities=15%  Similarity=0.203  Sum_probs=23.8

Q ss_pred             CCcccccCCCCCCCCcccCCCCccccccccccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGHYLCNARLFST   51 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~   51 (142)
                      +--.|..|+...|-+-..+-.-...|+|||...
T Consensus        96 ~yVlC~~C~sPdT~l~k~~r~~~l~C~ACGa~~  128 (133)
T TIGR00311        96 KYVICRECNRPDTRIIKEGRVSLLKCEACGAKA  128 (133)
T ss_pred             heEECCCCCCCCcEEEEeCCeEEEecccCCCCC
Confidence            345799999999998864332245799997543


No 50 
>KOG0706|consensus
Probab=56.88  E-value=5.6  Score=36.07  Aligned_cols=44  Identities=30%  Similarity=0.711  Sum_probs=36.3

Q ss_pred             cccCCCCccccccCCCCCCccccCCCCCcccchhhhhHHhcCCCC
Q psy12567         72 IEYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNR  116 (142)
Q Consensus        72 ~~~~~~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~~~R  116 (142)
                      +....+..+|+.|+... |-|-.-..|-.||-.|.-..|--||+-
T Consensus        17 LRs~~~NKvCFDCgAkn-PtWaSVTYGIFLCiDCSAvHRnLGVHi   60 (454)
T KOG0706|consen   17 LRSQSENKVCFDCGAKN-PTWASVTYGIFLCIDCSAVHRNLGVHI   60 (454)
T ss_pred             HhcCCCCceecccCCCC-CCceeecceEEEEEecchhhhccccce
Confidence            44557789999999865 899999999999999988777666654


No 51 
>COG3529 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=56.84  E-value=2.7  Score=28.52  Aligned_cols=31  Identities=26%  Similarity=0.485  Sum_probs=25.7

Q ss_pred             CcccccCCCCCCC-CcccCCCCcccccccccc
Q psy12567         20 GRECVNCGAISTP-LWRRDGTGHYLCNARLFS   50 (142)
Q Consensus        20 ~~~C~nCgt~~Tp-lWr~~~~g~~lCnacg~~   50 (142)
                      +-.|.-|.+.+|= +|+.+.-.+.-|.+||+-
T Consensus        10 GA~CP~C~~~Dtl~mW~En~ve~vECV~CG~~   41 (66)
T COG3529          10 GAVCPACQAQDTLAMWRENNVEIVECVKCGHH   41 (66)
T ss_pred             cCCCcccchhhHHHHHHhcCCceEehhhcchH
Confidence            4589999998886 777788889999999864


No 52 
>KOG1598|consensus
Probab=55.67  E-value=7.5  Score=35.90  Aligned_cols=27  Identities=33%  Similarity=0.599  Sum_probs=21.7

Q ss_pred             cccccCCCCCCCCcccCCCCccccccccc
Q psy12567         21 RECVNCGAISTPLWRRDGTGHYLCNARLF   49 (142)
Q Consensus        21 ~~C~nCgt~~TplWr~~~~g~~lCnacg~   49 (142)
                      ..|.|||.+.--  ++.++|...|.+||.
T Consensus         1 ~~C~~C~~s~fe--~d~a~g~~~C~~CG~   27 (521)
T KOG1598|consen    1 MVCKNCGGSNFE--RDEATGNLYCTACGT   27 (521)
T ss_pred             CcCCCCCCCCcc--cccccCCceeccccc
Confidence            369999987654  566789999999985


No 53 
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=55.41  E-value=8.1  Score=25.87  Aligned_cols=15  Identities=27%  Similarity=0.806  Sum_probs=9.3

Q ss_pred             CcccccCCCCC-CCCc
Q psy12567         20 GRECVNCGAIS-TPLW   34 (142)
Q Consensus        20 ~~~C~nCgt~~-TplW   34 (142)
                      ...|.+||+++ |..|
T Consensus        15 ~~~CP~Cgs~~~T~~W   30 (61)
T PRK08351         15 EDRCPVCGSRDLSDEW   30 (61)
T ss_pred             CCcCCCCcCCcccccc
Confidence            33567776665 6666


No 54 
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=55.08  E-value=4.9  Score=29.56  Aligned_cols=30  Identities=23%  Similarity=0.275  Sum_probs=22.7

Q ss_pred             CcccccCCCCCCCCcccCCCCccccccccc
Q psy12567         20 GRECVNCGAISTPLWRRDGTGHYLCNARLF   49 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g~~lCnacg~   49 (142)
                      --.|..|+..+|-+-..+..-..-|+|||.
T Consensus        80 yVlC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       80 YVLCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             cEECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            357999999999988763333456999974


No 55 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=54.54  E-value=7.1  Score=33.00  Aligned_cols=20  Identities=30%  Similarity=0.757  Sum_probs=10.9

Q ss_pred             CCCccccccCCC-------CCCccccC
Q psy12567         76 TEGRECVNCGAI-------STPLWRRD   95 (142)
Q Consensus        76 ~~~~~C~nC~tt-------~Tp~WRr~   95 (142)
                      ....+|.+||+-       ..|.||.-
T Consensus        28 ~Ge~vC~~CG~Vl~e~~iD~g~EWR~f   54 (310)
T PRK00423         28 RGEIVCADCGLVIEENIIDQGPEWRAF   54 (310)
T ss_pred             CCeEeecccCCcccccccccCCCccCC
Confidence            345666666662       35566644


No 56 
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=53.51  E-value=9.2  Score=25.90  Aligned_cols=15  Identities=27%  Similarity=0.572  Sum_probs=8.0

Q ss_pred             CcccccCCCCC-CCCc
Q psy12567         20 GRECVNCGAIS-TPLW   34 (142)
Q Consensus        20 ~~~C~nCgt~~-TplW   34 (142)
                      ...|.+||+++ |+.|
T Consensus        17 ~~~Cp~Cgs~~~S~~w   32 (64)
T PRK06393         17 EKTCPVHGDEKTTTEW   32 (64)
T ss_pred             CCcCCCCCCCcCCcCc
Confidence            34566666554 4455


No 57 
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=52.24  E-value=7.4  Score=25.73  Aligned_cols=23  Identities=13%  Similarity=0.103  Sum_probs=18.2

Q ss_pred             CcccccCCCCCCCCcccCCCCccccccccccc
Q psy12567         20 GRECVNCGAISTPLWRRDGTGHYLCNARLFST   51 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~   51 (142)
                      ..+|.+||...-|        |.+|. ||+|.
T Consensus        27 ~~~c~~cg~~~~p--------H~vc~-cG~Y~   49 (60)
T PRK01110         27 LSVDKTTGEYHLP--------HHVSP-KGYYK   49 (60)
T ss_pred             eeEcCCCCceecc--------ceecC-CcccC
Confidence            4589999987766        56899 99885


No 58 
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=52.19  E-value=5.1  Score=32.14  Aligned_cols=30  Identities=33%  Similarity=0.583  Sum_probs=22.9

Q ss_pred             CccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         78 GRECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        78 ~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      =..|..|+..+|-+=+.+..=..-|+|||-
T Consensus        98 yV~C~~C~~pdT~l~k~~~~~~l~C~aCGa  127 (201)
T PRK12336         98 YVICSECGLPDTRLVKEDRVLMLRCDACGA  127 (201)
T ss_pred             eEECCCCCCCCcEEEEcCCeEEEEcccCCC
Confidence            478999999999996543221458999996


No 59 
>KOG0706|consensus
Probab=52.15  E-value=7.7  Score=35.20  Aligned_cols=29  Identities=34%  Similarity=0.833  Sum_probs=25.4

Q ss_pred             CCCcccccCCCCCCCCcccCCCCccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNAR   47 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnac   47 (142)
                      .+-++|.+||+. -|.|-.=.=|-+||..|
T Consensus        21 ~~NKvCFDCgAk-nPtWaSVTYGIFLCiDC   49 (454)
T KOG0706|consen   21 SENKVCFDCGAK-NPTWASVTYGIFLCIDC   49 (454)
T ss_pred             CCCceecccCCC-CCCceeecceEEEEEec
Confidence            567899999985 58898888899999999


No 60 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=51.27  E-value=14  Score=37.56  Aligned_cols=22  Identities=27%  Similarity=0.347  Sum_probs=14.7

Q ss_pred             CcccccCCCCCCCCcccCCCCcccccccccc
Q psy12567         20 GRECVNCGAISTPLWRRDGTGHYLCNARLFS   50 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g~~lCnacg~~   50 (142)
                      .+.|.+||+. |+..        .|..||-.
T Consensus       667 ~rkCPkCG~~-t~~~--------fCP~CGs~  688 (1337)
T PRK14714        667 RRRCPSCGTE-TYEN--------RCPDCGTH  688 (1337)
T ss_pred             EEECCCCCCc-cccc--------cCcccCCc
Confidence            4789999985 4432        77777543


No 61 
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=50.61  E-value=9.9  Score=35.77  Aligned_cols=29  Identities=24%  Similarity=0.626  Sum_probs=25.7

Q ss_pred             CCCcccccCCCCCCCCcccCCCCccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNAR   47 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnac   47 (142)
                      .+-+.|.+||+.. |.|-.-.-|-++|.+|
T Consensus        21 PgNk~CADCgs~~-P~WASiNlGIFICi~C   49 (648)
T PLN03119         21 PPNRRCINCNSLG-PQYVCTTFWTFVCMAC   49 (648)
T ss_pred             cCCCccccCCCCC-CCceeeccceEEeccc
Confidence            4567999999976 9998888899999999


No 62 
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=50.61  E-value=6.2  Score=29.62  Aligned_cols=29  Identities=31%  Similarity=0.609  Sum_probs=23.4

Q ss_pred             ccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         79 RECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        79 ~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      ..|..|+..+|-+=..+..=...|+|||-
T Consensus        94 VlC~~C~spdT~l~k~~r~~~l~C~aCGa  122 (125)
T PF01873_consen   94 VLCPECGSPDTELIKEGRLIFLKCKACGA  122 (125)
T ss_dssp             SSCTSTSSSSEEEEEETTCCEEEETTTSC
T ss_pred             EEcCCCCCCccEEEEcCCEEEEEecccCC
Confidence            68999999999997764443578999994


No 63 
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=50.19  E-value=7  Score=31.37  Aligned_cols=34  Identities=26%  Similarity=0.298  Sum_probs=25.4

Q ss_pred             CCcccccCCCCCCCCcccCCCCcccccccccccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGHYLCNARLFSTS   52 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~k   52 (142)
                      +--.|..|+...|-+-..+..-..-|+|||....
T Consensus        97 ~yV~C~~C~~pdT~l~k~~~~~~l~C~aCGa~~~  130 (201)
T PRK12336         97 EYVICSECGLPDTRLVKEDRVLMLRCDACGAHRP  130 (201)
T ss_pred             heEECCCCCCCCcEEEEcCCeEEEEcccCCCCcc
Confidence            3457999999999997654333668999986543


No 64 
>PLN03131 hypothetical protein; Provisional
Probab=47.87  E-value=11  Score=35.71  Aligned_cols=29  Identities=21%  Similarity=0.628  Sum_probs=25.2

Q ss_pred             CCCcccccCCCCCCCCcccCCCCccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNAR   47 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnac   47 (142)
                      .+-+.|.+||+.. |.|-.-.-|-+||.+|
T Consensus        21 PgNk~CADCga~~-P~WASiNlGIFICi~C   49 (705)
T PLN03131         21 PPNRRCINCNSLG-PQFVCTNFWTFICMTC   49 (705)
T ss_pred             cCCCccccCCCCC-CCeeEeccceEEchhc
Confidence            4567999999865 9998888899999999


No 65 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=47.58  E-value=12  Score=20.38  Aligned_cols=22  Identities=36%  Similarity=0.765  Sum_probs=12.8

Q ss_pred             ccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         79 RECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        79 ~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      ..|.+||+..       +.+...|-.||-
T Consensus         3 ~~Cp~Cg~~~-------~~~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEI-------DPDAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcC-------CcccccChhhCC
Confidence            4677777743       233446777763


No 66 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=47.52  E-value=13  Score=22.61  Aligned_cols=28  Identities=18%  Similarity=0.542  Sum_probs=18.5

Q ss_pred             ccccCCCCCCCCcccCCC-Cccccccccccc
Q psy12567         22 ECVNCGAISTPLWRRDGT-GHYLCNARLFST   51 (142)
Q Consensus        22 ~C~nCgt~~TplWr~~~~-g~~lCnacg~~~   51 (142)
                      -|.+||..-.+.  .+.. ..+.|..|++..
T Consensus         2 FCp~Cg~~l~~~--~~~~~~~~vC~~Cg~~~   30 (52)
T smart00661        2 FCPKCGNMLIPK--EGKEKRRFVCRKCGYEE   30 (52)
T ss_pred             CCCCCCCccccc--cCCCCCEEECCcCCCeE
Confidence            588999865553  1222 278999998654


No 67 
>PRK00420 hypothetical protein; Validated
Probab=47.02  E-value=14  Score=27.50  Aligned_cols=27  Identities=26%  Similarity=0.623  Sum_probs=21.0

Q ss_pred             CcccccCCCCCCCCcccCCCCcccccccccc
Q psy12567         20 GRECVNCGAISTPLWRRDGTGHYLCNARLFS   50 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g~~lCnacg~~   50 (142)
                      +..|..||   +|+.+- ..|...|.+||-.
T Consensus        23 ~~~CP~Cg---~pLf~l-k~g~~~Cp~Cg~~   49 (112)
T PRK00420         23 SKHCPVCG---LPLFEL-KDGEVVCPVHGKV   49 (112)
T ss_pred             cCCCCCCC---Ccceec-CCCceECCCCCCe
Confidence            46899998   788753 6788999999753


No 68 
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=46.91  E-value=11  Score=35.54  Aligned_cols=35  Identities=23%  Similarity=0.584  Sum_probs=29.4

Q ss_pred             ccCCCCccccccCCCCCCccccCCCCCcccchhhhh
Q psy12567         73 EYFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLY  108 (142)
Q Consensus        73 ~~~~~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly  108 (142)
                      ........|++|+... |.|---..|-.||-+|.=.
T Consensus        18 lklPgNk~CADCgs~~-P~WASiNlGIFICi~CSGI   52 (648)
T PLN03119         18 MKLPPNRRCINCNSLG-PQYVCTTFWTFVCMACSGI   52 (648)
T ss_pred             hhCcCCCccccCCCCC-CCceeeccceEEeccchhh
Confidence            3457789999999876 9999999999999999553


No 69 
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=46.83  E-value=3.1  Score=34.65  Aligned_cols=71  Identities=23%  Similarity=0.337  Sum_probs=34.1

Q ss_pred             CCcccccCCCCCCCCcccCCC--C--cccccccccccccccccccccccccCCCccccccCCCCccccccCCCCCC-ccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGT--G--HYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTP-LWR   93 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~--g--~~lCnacg~~~k~~G~~~~~R~~~~~~~~~~~~~~~~~~~C~nC~tt~Tp-~WR   93 (142)
                      ....|.-||+...-.+.++..  |  +..|.-|+..=.                       .....|.+||.++-- +|-
T Consensus       171 ~~g~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~W~-----------------------~~R~~Cp~Cg~~~~~~l~~  227 (290)
T PF04216_consen  171 QRGYCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTEWR-----------------------FVRIKCPYCGNTDHEKLEY  227 (290)
T ss_dssp             T-SS-TTT---EEEEEEE------EEEEEETTT--EEE-------------------------TTS-TTT---SS-EEE-
T ss_pred             cCCcCCCCCCcCceEEEecCCCCccEEEEcCCCCCeee-----------------------ecCCCCcCCCCCCCcceee
Confidence            356899999987777777766  6  557888853211                       113579999998754 443


Q ss_pred             c---CCCC--CcccchhhhhHHhc
Q psy12567         94 R---DGTG--HYLCNACGLYHKMN  112 (142)
Q Consensus        94 r---~~~G--~~lCNaCGly~k~~  112 (142)
                      =   +..+  -.+|..|+-|.|.-
T Consensus       228 ~~~e~~~~~rve~C~~C~~YlK~v  251 (290)
T PF04216_consen  228 FTVEGEPAYRVEVCESCGSYLKTV  251 (290)
T ss_dssp             -------SEEEEEETTTTEEEEEE
T ss_pred             EecCCCCcEEEEECCcccchHHHH
Confidence            2   2333  26999999998753


No 70 
>KOG1598|consensus
Probab=46.41  E-value=11  Score=34.84  Aligned_cols=27  Identities=37%  Similarity=0.829  Sum_probs=20.7

Q ss_pred             ccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         79 RECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        79 ~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      +.|.||+.++--.  +-..|...|++||.
T Consensus         1 ~~C~~C~~s~fe~--d~a~g~~~C~~CG~   27 (521)
T KOG1598|consen    1 MVCKNCGGSNFER--DEATGNLYCTACGT   27 (521)
T ss_pred             CcCCCCCCCCccc--ccccCCceeccccc
Confidence            4699999887433  34568899999997


No 71 
>KOG2907|consensus
Probab=46.40  E-value=13  Score=27.98  Aligned_cols=87  Identities=22%  Similarity=0.399  Sum_probs=48.3

Q ss_pred             CCcccccCCCCCCCCcccCCCCcccccccccccc---cccccc---cccccccCC---Cc---cccccCCCCccccccCC
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGHYLCNARLFSTS---FTGYFI---MSRFLFASL---PV---EDIEYFTEGRECVNCGA   86 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~k---~~G~~~---~~R~~~~~~---~~---~~~~~~~~~~~C~nC~t   86 (142)
                      +..-|..||++--   -....+..+|..|.....   +.+...   .....+...   .+   ...........|..||.
T Consensus         6 ~~~FC~~CG~ll~---~~~~~~~~~C~~Ck~~~~v~~~~~~~v~~~~~~~~~~~A~~~~ve~~~~~~ga~I~~kCpkCgh   82 (116)
T KOG2907|consen    6 DLDFCSDCGSLLE---EPSAQSTVLCIRCKIEYPVSQFSGLVVETKSLFDEFTSALAEKVENESSADGAVIKHKCPKCGH   82 (116)
T ss_pred             Ccchhhhhhhhcc---cccccCceEeccccccCCHHHhCCeeEEEEEeecccchhhhhhhcccccccccchhccCcccCC
Confidence            4567999998532   233344567999964321   111100   000000000   00   01123456789999998


Q ss_pred             CC----CCccccCCCCC---cccchhhhh
Q psy12567         87 IS----TPLWRRDGTGH---YLCNACGLY  108 (142)
Q Consensus        87 t~----Tp~WRr~~~G~---~lCNaCGly  108 (142)
                      ..    |-+-|..++|+   +-|-.|+..
T Consensus        83 e~m~Y~T~QlRSADEGQTVFYTC~kC~~k  111 (116)
T KOG2907|consen   83 EEMSYHTLQLRSADEGQTVFYTCPKCKYK  111 (116)
T ss_pred             chhhhhhhhcccccCCceEEEEcCcccee
Confidence            75    77889999997   468888763


No 72 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=45.93  E-value=6.2  Score=23.35  Aligned_cols=25  Identities=40%  Similarity=0.884  Sum_probs=12.4

Q ss_pred             cccccCCCCCCccccCCCC----Ccccchhhh
Q psy12567         80 ECVNCGAISTPLWRRDGTG----HYLCNACGL  107 (142)
Q Consensus        80 ~C~nC~tt~Tp~WRr~~~G----~~lCNaCGl  107 (142)
                      -|.+||+.-+   .+-++|    ..+|.+||.
T Consensus         2 fC~~CG~~l~---~~ip~gd~r~R~vC~~Cg~   30 (34)
T PF14803_consen    2 FCPQCGGPLE---RRIPEGDDRERLVCPACGF   30 (34)
T ss_dssp             B-TTT--B-E---EE--TT-SS-EEEETTTTE
T ss_pred             ccccccChhh---hhcCCCCCccceECCCCCC
Confidence            4788887642   233333    378999986


No 73 
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis]
Probab=42.74  E-value=13  Score=32.60  Aligned_cols=67  Identities=24%  Similarity=0.392  Sum_probs=41.2

Q ss_pred             CCCcccccCCCCCCCCcccCCCCcccccccccccccccccccccccccCCCccccccCCCCccccccCCCCCC-ccccCC
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTP-LWRRDG   96 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~k~~G~~~~~R~~~~~~~~~~~~~~~~~~~C~nC~tt~Tp-~WRr~~   96 (142)
                      .....|+.||...-|      ..+-||..|.+-.. .              ...+.....-..|.+||...++ .|=+.+
T Consensus         4 ~~~~~C~~CGr~~~~------~~~~lC~dC~~~~~-~--------------~~~ip~~~~v~~C~~Cga~~~~~~W~~~~   62 (355)
T COG1499           4 ASTILCVRCGRSVDP------LIDGLCGDCYVETT-P--------------LIEIPDEVNVEVCRHCGAYRIRGRWVDEE   62 (355)
T ss_pred             CcccEeccCCCcCch------hhccccHHHHhccC-c--------------cccCCCceEEEECCcCCCccCCCcceecc
Confidence            345689999987653      34569999965421 1              0111111346899999988888 688755


Q ss_pred             CCCcccchh
Q psy12567         97 TGHYLCNAC  105 (142)
Q Consensus        97 ~G~~lCNaC  105 (142)
                      .+.-+=.++
T Consensus        63 ~~~~~l~~~   71 (355)
T COG1499          63 GANRLLEAL   71 (355)
T ss_pred             ccchHHHHH
Confidence            443333443


No 74 
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=42.07  E-value=11  Score=28.34  Aligned_cols=29  Identities=24%  Similarity=0.313  Sum_probs=23.1

Q ss_pred             cccccCCCCCCCCcccCCCCccccccccc
Q psy12567         21 RECVNCGAISTPLWRRDGTGHYLCNARLF   49 (142)
Q Consensus        21 ~~C~nCgt~~TplWr~~~~g~~lCnacg~   49 (142)
                      -.|..|+..+|-+-..+..-...|+|||.
T Consensus        94 VlC~~C~spdT~l~k~~r~~~l~C~aCGa  122 (125)
T PF01873_consen   94 VLCPECGSPDTELIKEGRLIFLKCKACGA  122 (125)
T ss_dssp             SSCTSTSSSSEEEEEETTCCEEEETTTSC
T ss_pred             EEcCCCCCCccEEEEcCCEEEEEecccCC
Confidence            47999999999988775555677999975


No 75 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=41.69  E-value=12  Score=23.18  Aligned_cols=25  Identities=24%  Similarity=0.543  Sum_probs=17.9

Q ss_pred             ccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         79 RECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        79 ~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      -.|.+||...+..    ..+..-|..||-
T Consensus         3 Y~C~~Cg~~~~~~----~~~~irC~~CG~   27 (44)
T smart00659        3 YICGECGRENEIK----SKDVVRCRECGY   27 (44)
T ss_pred             EECCCCCCEeecC----CCCceECCCCCc
Confidence            3689999977654    234568999985


No 76 
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=41.42  E-value=29  Score=26.84  Aligned_cols=65  Identities=12%  Similarity=0.201  Sum_probs=35.8

Q ss_pred             CCCcccCCCCccccccccc--cc------ccccccccccccccCCCccccc-----cCCCCccccccCCCCCCccccCC
Q psy12567         31 TPLWRRDGTGHYLCNARLF--ST------SFTGYFIMSRFLFASLPVEDIE-----YFTEGRECVNCGAISTPLWRRDG   96 (142)
Q Consensus        31 TplWr~~~~g~~lCnacg~--~~------k~~G~~~~~R~~~~~~~~~~~~-----~~~~~~~C~nC~tt~Tp~WRr~~   96 (142)
                      .++|.....|.|+|-+|+.  +.      +.+|..-..++... ..+....     -.+....|.+|+..--=+...||
T Consensus        33 g~~~~~~~~G~Y~C~~Cg~pLF~S~~Kf~Sg~GWPSF~~~i~~-~~V~~~~D~s~gm~RtEv~C~~Cg~HLGHVF~DGP  110 (142)
T PRK00222         33 GEYLDNKEKGIYVCIVCGEPLFSSDTKFDSGCGWPSFTKPIDE-EAIRELRDTSHGMVRTEVRCANCDSHLGHVFPDGP  110 (142)
T ss_pred             CCCCCCCCCeEEEecCCCchhcCCcccccCCCCCcCcCcccCC-CceEEeeccCCCceEEEEEeCCCCCccCcccCCCC
Confidence            3688888899999999973  22      22343211222111 1121111     12345789999887766665553


No 77 
>PLN03131 hypothetical protein; Provisional
Probab=40.99  E-value=16  Score=34.68  Aligned_cols=34  Identities=21%  Similarity=0.623  Sum_probs=28.6

Q ss_pred             cCCCCccccccCCCCCCccccCCCCCcccchhhhh
Q psy12567         74 YFTEGRECVNCGAISTPLWRRDGTGHYLCNACGLY  108 (142)
Q Consensus        74 ~~~~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly  108 (142)
                      .......|++|+... |.|---..|-.||-.|.=.
T Consensus        19 k~PgNk~CADCga~~-P~WASiNlGIFICi~CSGI   52 (705)
T PLN03131         19 KLPPNRRCINCNSLG-PQFVCTNFWTFICMTCSGI   52 (705)
T ss_pred             hCcCCCccccCCCCC-CCeeEeccceEEchhchhh
Confidence            457789999999865 8999989999999999653


No 78 
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=40.54  E-value=12  Score=22.91  Aligned_cols=26  Identities=27%  Similarity=0.691  Sum_probs=14.2

Q ss_pred             ccccCCCCCCCC-ccc-CCCCccccccc
Q psy12567         22 ECVNCGAISTPL-WRR-DGTGHYLCNAR   47 (142)
Q Consensus        22 ~C~nCgt~~Tpl-Wr~-~~~g~~lCnac   47 (142)
                      .|..||.+.-=. |.. +..|+++|+.|
T Consensus         5 pCP~CGG~DrFri~~d~~~~G~~~C~~C   32 (40)
T PF08273_consen    5 PCPICGGKDRFRIFDDKDGRGTWICRQC   32 (40)
T ss_dssp             --TTTT-TTTEEEETT----S-EEETTT
T ss_pred             CCCCCcCccccccCcCcccCCCEECCCC
Confidence            588898865554 543 34589999999


No 79 
>PHA02942 putative transposase; Provisional
Probab=40.52  E-value=18  Score=31.68  Aligned_cols=34  Identities=12%  Similarity=0.322  Sum_probs=23.4

Q ss_pred             cccCCCCcccccCCCCCCCCcccCCCCccccccccccc
Q psy12567         14 IEYFTEGRECVNCGAISTPLWRRDGTGHYLCNARLFST   51 (142)
Q Consensus        14 ~~~~~~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~   51 (142)
                      ++....+..|+.||....++    ....+.|..||+..
T Consensus       319 V~p~yTSq~Cs~CG~~~~~l----~~r~f~C~~CG~~~  352 (383)
T PHA02942        319 VNPSYSSVSCPKCGHKMVEI----AHRYFHCPSCGYEN  352 (383)
T ss_pred             ECCCCCCccCCCCCCccCcC----CCCEEECCCCCCEe
Confidence            33334678999999876543    12368999998753


No 80 
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=40.31  E-value=18  Score=23.96  Aligned_cols=24  Identities=29%  Similarity=0.578  Sum_probs=18.7

Q ss_pred             CcccccCCCCCCCCcccCCCCccccccccccc
Q psy12567         20 GRECVNCGAISTPLWRRDGTGHYLCNARLFST   51 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~   51 (142)
                      ..+|.+||...=|        |.+|..||+|.
T Consensus        27 ~~~c~~cG~~~l~--------Hrvc~~cg~Y~   50 (57)
T COG0333          27 LSVCPNCGEYKLP--------HRVCLKCGYYK   50 (57)
T ss_pred             ceeccCCCCcccC--------ceEcCCCCCcc
Confidence            5689999876655        56999999875


No 81 
>PHA00626 hypothetical protein
Probab=40.24  E-value=18  Score=24.16  Aligned_cols=31  Identities=23%  Similarity=0.454  Sum_probs=19.9

Q ss_pred             ccccCCCCCCC--CcccCCCCcccccccccccc
Q psy12567         22 ECVNCGAISTP--LWRRDGTGHYLCNARLFSTS   52 (142)
Q Consensus        22 ~C~nCgt~~Tp--lWr~~~~g~~lCnacg~~~k   52 (142)
                      .|.+||+.+--  ---+.+...|.|..|||..+
T Consensus         2 ~CP~CGS~~Ivrcg~cr~~snrYkCkdCGY~ft   34 (59)
T PHA00626          2 SCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDS   34 (59)
T ss_pred             CCCCCCCceeeeeceecccCcceEcCCCCCeec
Confidence            58889884332  11234456799999998643


No 82 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=40.09  E-value=15  Score=21.84  Aligned_cols=29  Identities=14%  Similarity=0.295  Sum_probs=15.9

Q ss_pred             CCcccccCCCCCCCCcccCCCCccccccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGHYLCNAR   47 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~~lCnac   47 (142)
                      +..+|..||..-...|-...=+..+|+.|
T Consensus         2 ~~~~C~eC~~~f~dSyL~~~F~~~VCD~C   30 (34)
T PF01286_consen    2 DYPKCDECGKPFMDSYLLNNFDLPVCDKC   30 (34)
T ss_dssp             S-EE-TTT--EES-SSCCCCTS-S--TTT
T ss_pred             CCchHhHhCCHHHHHHHHHhCCccccccc
Confidence            35678899887777776677777888888


No 83 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=39.81  E-value=11  Score=22.83  Aligned_cols=9  Identities=33%  Similarity=0.951  Sum_probs=5.5

Q ss_pred             CccccccCC
Q psy12567         78 GRECVNCGA   86 (142)
Q Consensus        78 ~~~C~nC~t   86 (142)
                      ...|..||.
T Consensus        26 ~~~CP~Cg~   34 (42)
T PF09723_consen   26 PVPCPECGS   34 (42)
T ss_pred             CCcCCCCCC
Confidence            456666665


No 84 
>KOG0703|consensus
Probab=39.51  E-value=13  Score=31.82  Aligned_cols=38  Identities=29%  Similarity=0.720  Sum_probs=30.7

Q ss_pred             CCCCccccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         75 FTEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        75 ~~~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      ..+...|+.|++. .|.|-.-..|--+|--|.=..|.-|
T Consensus        22 ~~~N~~CADC~a~-~P~WaSwnlGvFiC~~C~giHR~lg   59 (287)
T KOG0703|consen   22 EPDNKVCADCGAK-GPRWASWNLGVFICLRCAGIHRSLG   59 (287)
T ss_pred             CcccCcccccCCC-CCCeEEeecCeEEEeeccccccccc
Confidence            3558999999999 9999999999999999965444433


No 85 
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=39.39  E-value=17  Score=27.82  Aligned_cols=66  Identities=15%  Similarity=0.144  Sum_probs=36.8

Q ss_pred             CCCCcccCCCCccccccccc--cc------ccccccccccccccCCCccccc-----cCCCCccccccCCCCCCccccCC
Q psy12567         30 STPLWRRDGTGHYLCNARLF--ST------SFTGYFIMSRFLFASLPVEDIE-----YFTEGRECVNCGAISTPLWRRDG   96 (142)
Q Consensus        30 ~TplWr~~~~g~~lCnacg~--~~------k~~G~~~~~R~~~~~~~~~~~~-----~~~~~~~C~nC~tt~Tp~WRr~~   96 (142)
                      +.+.|.....|.|+|-+|+.  +.      +.+|..-..++..+ ..+....     -.+....|.+|+.---=+...||
T Consensus        29 tg~y~~~~~~G~Y~C~~Cg~pLF~S~~KfdSg~GWPSF~~~i~~-~~V~~~~D~s~gm~RtEv~C~~Cg~HLGHVF~DGP  107 (134)
T TIGR00357        29 TNEYWDNKEEGIYVDITCGEPLFSSEDKFDSGCGWPSFYKPISE-EVVAYERDESHGMIRTEVRCRNCDAHLGHVFDDGP  107 (134)
T ss_pred             CCCCCCCCCCeEEEccCCCCccccccchhcCCCCCcCcCcccCC-CceEEeecCCCCcEEEEEEecCCCCccCcccCCCC
Confidence            34678888899999999973  32      22343212222211 1122111     12345789999987666665554


No 86 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=38.40  E-value=21  Score=22.64  Aligned_cols=27  Identities=15%  Similarity=0.413  Sum_probs=18.9

Q ss_pred             CCcccccCCCCCCCCcccCCCCccccccccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGHYLCNARLF   49 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~~lCnacg~   49 (142)
                      ..+.|.+||+.  -+.  ...+.+.|..||+
T Consensus        19 ~~~fCP~Cg~~--~m~--~~~~r~~C~~Cgy   45 (50)
T PRK00432         19 KNKFCPRCGSG--FMA--EHLDRWHCGKCGY   45 (50)
T ss_pred             ccCcCcCCCcc--hhe--ccCCcEECCCcCC
Confidence            45699999974  322  2236789999986


No 87 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=38.17  E-value=11  Score=22.78  Aligned_cols=28  Identities=29%  Similarity=0.751  Sum_probs=17.6

Q ss_pred             ccccccCCCCCC---ccccCCCCCcccchhhh
Q psy12567         79 RECVNCGAISTP---LWRRDGTGHYLCNACGL  107 (142)
Q Consensus        79 ~~C~nC~tt~Tp---~WRr~~~G~~lCNaCGl  107 (142)
                      ..|+-||.+.+.   |- .|+.|..+|+.|..
T Consensus         2 ~~CSFCgr~~~~v~~li-~g~~~~~IC~~Cv~   32 (41)
T PF06689_consen    2 KRCSFCGRPESEVGRLI-SGPNGAYICDECVE   32 (41)
T ss_dssp             -B-TTT--BTTTSSSEE-EES-SEEEEHHHHH
T ss_pred             CCccCCCCCHHHHhcee-cCCCCcEECHHHHH
Confidence            468999988864   33 56767889999976


No 88 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=37.90  E-value=16  Score=31.04  Aligned_cols=26  Identities=31%  Similarity=0.873  Sum_probs=13.1

Q ss_pred             cccccCCCCCCccccCCCCCcccchhhh
Q psy12567         80 ECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        80 ~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      .|.+|+.+.  +=..-..|..+|-.||+
T Consensus         3 ~CpeCg~~~--~~~d~~~ge~VC~~CG~   28 (285)
T COG1405           3 SCPECGSTN--IITDYERGEIVCADCGL   28 (285)
T ss_pred             CCCCCCCcc--ceeeccCCeEEeccCCE
Confidence            466666651  11112345666666665


No 89 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=34.68  E-value=32  Score=31.09  Aligned_cols=23  Identities=26%  Similarity=0.514  Sum_probs=17.5

Q ss_pred             CCccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         77 EGRECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        77 ~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      ....|..||.+...-|        .|-.||-
T Consensus       239 ~~l~Ch~Cg~~~~~~~--------~Cp~C~s  261 (505)
T TIGR00595       239 GKLRCHYCGYQEPIPK--------TCPQCGS  261 (505)
T ss_pred             CeEEcCCCcCcCCCCC--------CCCCCCC
Confidence            3578999998887665        5888864


No 90 
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=34.48  E-value=20  Score=28.62  Aligned_cols=28  Identities=32%  Similarity=0.822  Sum_probs=23.5

Q ss_pred             cccccCCCCCCccccCCCCC---cccchhhh
Q psy12567         80 ECVNCGAISTPLWRRDGTGH---YLCNACGL  107 (142)
Q Consensus        80 ~C~nC~tt~Tp~WRr~~~G~---~lCNaCGl  107 (142)
                      .|.+||.....++++-.+|.   +.|..||-
T Consensus         2 iCIeCg~~v~~Ly~~Ys~~~irLt~C~~C~~   32 (208)
T PF04161_consen    2 ICIECGHPVKSLYRQYSPGNIRLTKCPNCGK   32 (208)
T ss_pred             EeccCCCcchhhhhccCCCcEEEeeccccCC
Confidence            69999999988999887773   78999974


No 91 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=33.57  E-value=26  Score=20.93  Aligned_cols=32  Identities=25%  Similarity=0.478  Sum_probs=19.9

Q ss_pred             CcccccCCCCCCCCcccCCCC-ccccccccccc
Q psy12567         20 GRECVNCGAISTPLWRRDGTG-HYLCNARLFST   51 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g-~~lCnacg~~~   51 (142)
                      ...|..|++.--|.-.-+..| ...|+-|+...
T Consensus         2 p~rC~~C~aylNp~~~~~~~~~~w~C~~C~~~N   34 (40)
T PF04810_consen    2 PVRCRRCRAYLNPFCQFDDGGKTWICNFCGTKN   34 (40)
T ss_dssp             S-B-TTT--BS-TTSEEETTTTEEEETTT--EE
T ss_pred             ccccCCCCCEECCcceEcCCCCEEECcCCCCcC
Confidence            457999999999987777765 78999997543


No 92 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=33.14  E-value=24  Score=28.28  Aligned_cols=28  Identities=18%  Similarity=0.388  Sum_probs=20.7

Q ss_pred             ccCCCCcccccCCCCCCCCcccCCCCcccccccccc
Q psy12567         15 EYFTEGRECVNCGAISTPLWRRDGTGHYLCNARLFS   50 (142)
Q Consensus        15 ~~~~~~~~C~nCgt~~TplWr~~~~g~~lCnacg~~   50 (142)
                      +...++..|+.||.        -..+.+.|..||+.
T Consensus       304 ~~~~tS~~C~~cg~--------~~~r~~~C~~cg~~  331 (364)
T COG0675         304 PPYYTSKTCPCCGH--------LSGRLFKCPRCGFV  331 (364)
T ss_pred             CCCCCcccccccCC--------ccceeEECCCCCCe
Confidence            34567789999999        11346799999874


No 93 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=32.87  E-value=34  Score=24.02  Aligned_cols=33  Identities=33%  Similarity=0.604  Sum_probs=23.7

Q ss_pred             CCccccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         77 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        77 ~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      +...|.-|+...+-.+    -|...|+||..|++..-
T Consensus         5 ~~~~C~VCg~~a~g~h----yGv~sC~aCk~FFRR~v   37 (90)
T cd07169           5 EQRTCLICGDRATGLH----YGIISCEGCKGFFKRSI   37 (90)
T ss_pred             cCCCCeecCCcCcceE----ECcceehhhHHHHHHHh
Confidence            4567899987655432    45678999999988753


No 94 
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=32.84  E-value=35  Score=27.63  Aligned_cols=52  Identities=25%  Similarity=0.465  Sum_probs=34.6

Q ss_pred             cccCCCCCCCCcccCCCCcccccccccccccccccccccccccCCCccccccCCCCccccccCCCCCC-ccccC
Q psy12567         23 CVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTP-LWRRD   95 (142)
Q Consensus        23 C~nCgt~~TplWr~~~~g~~lCnacg~~~k~~G~~~~~R~~~~~~~~~~~~~~~~~~~C~nC~tt~Tp-~WRr~   95 (142)
                      |..||....|+-      .-||..|.+...  .       ...      +.....-..|..||....+ .|...
T Consensus         1 C~~CG~~~~~~~------~~lC~~C~~~~~--~-------i~e------i~~~i~v~~C~~Cg~~~~~~~W~~~   53 (236)
T PF04981_consen    1 CPRCGREIEPLI------DGLCPDCYLKRF--D-------IIE------IPDRIEVTICPKCGRYRIGGRWVDP   53 (236)
T ss_pred             CCCCCCCCCCcc------cccChHHhcccC--C-------eee------cCCccCceECCCCCCEECCCEeeec
Confidence            889998665543      239999965431  1       011      1122456899999999887 89887


No 95 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=31.85  E-value=40  Score=19.60  Aligned_cols=24  Identities=21%  Similarity=0.224  Sum_probs=11.8

Q ss_pred             ccccCCCCCCCCcccCCCCccccccccc
Q psy12567         22 ECVNCGAISTPLWRRDGTGHYLCNARLF   49 (142)
Q Consensus        22 ~C~nCgt~~TplWr~~~~g~~lCnacg~   49 (142)
                      .|.+||+...-.    +.+..-|..||+
T Consensus         2 ~C~~Cg~~~~~~----~~~~irC~~CG~   25 (32)
T PF03604_consen    2 ICGECGAEVELK----PGDPIRCPECGH   25 (32)
T ss_dssp             BESSSSSSE-BS----TSSTSSBSSSS-
T ss_pred             CCCcCCCeeEcC----CCCcEECCcCCC
Confidence            477777765511    122345776753


No 96 
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=31.11  E-value=18  Score=23.35  Aligned_cols=20  Identities=35%  Similarity=0.953  Sum_probs=13.9

Q ss_pred             cccCCCCCCCCcccCCCCcccccccccc
Q psy12567         23 CVNCGAISTPLWRRDGTGHYLCNARLFS   50 (142)
Q Consensus        23 C~nCgt~~TplWr~~~~g~~lCnacg~~   50 (142)
                      |..|++....+|        +|..|+..
T Consensus         1 C~~C~~~~~~lw--------~CL~Cg~~   20 (63)
T PF02148_consen    1 CSVCGSTNSNLW--------LCLTCGYV   20 (63)
T ss_dssp             -SSSHTCSSSEE--------EETTTS-E
T ss_pred             CCCCCCcCCceE--------EeCCCCcc
Confidence            677876666777        89999754


No 97 
>KOG1597|consensus
Probab=30.95  E-value=28  Score=30.21  Aligned_cols=30  Identities=27%  Similarity=0.668  Sum_probs=21.3

Q ss_pred             cccccCCCCCCccccCCCCCcccchhhhhH
Q psy12567         80 ECVNCGAISTPLWRRDGTGHYLCNACGLYH  109 (142)
Q Consensus        80 ~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~  109 (142)
                      .|..|....-.+--....|.++|-.|||..
T Consensus         2 ~c~~C~~~~~~~V~d~~~gdtvC~~CGlVl   31 (308)
T KOG1597|consen    2 TCPDCKRHPENLVEDHSAGDTVCSECGLVL   31 (308)
T ss_pred             CCCCCCCCCCCeeeeccCCceecccCCeee
Confidence            477777665556666777888888888843


No 98 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=30.71  E-value=20  Score=20.70  Aligned_cols=8  Identities=38%  Similarity=0.866  Sum_probs=3.9

Q ss_pred             cccchhhh
Q psy12567        100 YLCNACGL  107 (142)
Q Consensus       100 ~lCNaCGl  107 (142)
                      ..|-.||-
T Consensus        27 ~~CP~Cg~   34 (41)
T smart00834       27 ATCPECGG   34 (41)
T ss_pred             CCCCCCCC
Confidence            34555554


No 99 
>PF02701 zf-Dof:  Dof domain, zinc finger;  InterPro: IPR003851 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry consists of proteins containing a Dof domain, which is a zinc finger DNA-binding domain that shows resemblance to the Cys2 zinc finger, although it has a longer putative loop where an extra Cys residue is conserved []. AOBP, a DNA-binding protein in pumpkin (Cucurbita maxima), contains a 52 amino acid Dof domain, which is highly conserved in several DNA-binding proteins of higher plants. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent
Probab=30.53  E-value=94  Score=21.02  Aligned_cols=44  Identities=20%  Similarity=0.536  Sum_probs=32.4

Q ss_pred             CCCccccccCCCCCCc--cccCCCC--CcccchhhhhHHhcCCCCCCC
Q psy12567         76 TEGRECVNCGAISTPL--WRRDGTG--HYLCNACGLYHKMNGMNRPLV  119 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp~--WRr~~~G--~~lCNaCGly~k~~~~~RP~~  119 (142)
                      .+...|..|..+.|-.  .-.....  .+.|-+|--||-..|..|-+.
T Consensus         3 ~~~~~CPRC~S~nTKFcYyNNy~~~QPR~~Ck~C~rywT~GG~lRnVP   50 (63)
T PF02701_consen    3 EQPLPCPRCDSTNTKFCYYNNYNLSQPRYFCKSCRRYWTHGGTLRNVP   50 (63)
T ss_pred             ccCCCCCCcCCCCCEEEeecCCCCCCcchhhHHHHHHHHhcceecCCc
Confidence            3467899999988863  2223333  479999999999999877663


No 100
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=29.95  E-value=30  Score=20.88  Aligned_cols=20  Identities=40%  Similarity=0.863  Sum_probs=14.8

Q ss_pred             ccccCCCCCCCCcccCCCCcccccccccc
Q psy12567         22 ECVNCGAISTPLWRRDGTGHYLCNARLFS   50 (142)
Q Consensus        22 ~C~nCgt~~TplWr~~~~g~~lCnacg~~   50 (142)
                      .|.+|++.. .+|        +|..|+..
T Consensus         1 ~C~~C~~~~-~l~--------~CL~C~~~   20 (50)
T smart00290        1 RCSVCGTIE-NLW--------LCLTCGQV   20 (50)
T ss_pred             CcccCCCcC-CeE--------EecCCCCc
Confidence            488999766 377        89988653


No 101
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=29.93  E-value=30  Score=25.41  Aligned_cols=32  Identities=31%  Similarity=0.567  Sum_probs=19.0

Q ss_pred             CCCccccccCCCCCCccccCCCCCcccchhhhhHHh
Q psy12567         76 TEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKM  111 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~  111 (142)
                      ...+.|.+||+..==|=| .|   .+|-.||--|-.
T Consensus         7 GtKR~Cp~CG~kFYDLnk-~P---ivCP~CG~~~~~   38 (108)
T PF09538_consen    7 GTKRTCPSCGAKFYDLNK-DP---IVCPKCGTEFPP   38 (108)
T ss_pred             CCcccCCCCcchhccCCC-CC---ccCCCCCCccCc
Confidence            345778888887644421 22   368888874443


No 102
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=29.35  E-value=23  Score=21.72  Aligned_cols=8  Identities=38%  Similarity=0.866  Sum_probs=3.7

Q ss_pred             cccchhhh
Q psy12567        100 YLCNACGL  107 (142)
Q Consensus       100 ~lCNaCGl  107 (142)
                      ..|-.||-
T Consensus        27 ~~CP~Cg~   34 (52)
T TIGR02605        27 ATCPECGG   34 (52)
T ss_pred             CCCCCCCC
Confidence            34555543


No 103
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=29.12  E-value=42  Score=23.83  Aligned_cols=33  Identities=24%  Similarity=0.503  Sum_probs=23.5

Q ss_pred             CCccccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         77 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        77 ~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      +...|.-||...+-.+    -|...|+||..|++..-
T Consensus         4 ~~~~C~VCg~~~~g~h----yGv~sC~aC~~FFRR~v   36 (95)
T cd06968           4 EVIPCKICGDKSSGIH----YGVITCEGCKGFFRRSQ   36 (95)
T ss_pred             cccCCcccCCcCcceE----ECceeehhhHHhhHHhe
Confidence            3457899987655432    45668999999988743


No 104
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=28.93  E-value=33  Score=27.26  Aligned_cols=31  Identities=19%  Similarity=0.334  Sum_probs=25.2

Q ss_pred             CCCcccccCCCCCCCCcccCCCCcccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNARL   48 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnacg   48 (142)
                      .+-..|..||......+-....|..+|..|.
T Consensus       147 p~l~~C~~Cg~~~~~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        147 LDLDHCAVCGAPGDHRYFSPKEGGAVCSECG  177 (247)
T ss_pred             cchhhHhcCCCCCCceEEecccCCccccccc
Confidence            4456899999887767777778899999996


No 105
>PRK05580 primosome assembly protein PriA; Validated
Probab=28.79  E-value=45  Score=31.28  Aligned_cols=23  Identities=26%  Similarity=0.575  Sum_probs=16.7

Q ss_pred             CCccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         77 EGRECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        77 ~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      ....|..||.+...-|        .|..||-
T Consensus       407 ~~l~Ch~Cg~~~~~~~--------~Cp~Cg~  429 (679)
T PRK05580        407 RRLRCHHCGYQEPIPK--------ACPECGS  429 (679)
T ss_pred             CeEECCCCcCCCCCCC--------CCCCCcC
Confidence            4578999998876666        4888853


No 106
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=28.23  E-value=18  Score=21.81  Aligned_cols=30  Identities=27%  Similarity=0.769  Sum_probs=14.2

Q ss_pred             cccccCCCCCCcc----ccCCCC---CcccchhhhhH
Q psy12567         80 ECVNCGAISTPLW----RRDGTG---HYLCNACGLYH  109 (142)
Q Consensus        80 ~C~nC~tt~Tp~W----Rr~~~G---~~lCNaCGly~  109 (142)
                      .|.+|+-.+.-.|    |..+++   -+.|..||-.|
T Consensus         2 ~Cp~C~~~~a~~~q~Q~RsaDE~mT~fy~C~~C~~~w   38 (40)
T smart00440        2 PCPKCGNREATFFQLQTRSADEPMTVFYVCTKCGHRW   38 (40)
T ss_pred             cCCCCCCCeEEEEEEcccCCCCCCeEEEEeCCCCCEe
Confidence            3555554443322    333444   25666666543


No 107
>PRK14873 primosome assembly protein PriA; Provisional
Probab=27.54  E-value=44  Score=31.54  Aligned_cols=22  Identities=36%  Similarity=0.952  Sum_probs=16.3

Q ss_pred             CCccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         77 EGRECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        77 ~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      ....|.+||... +-|        .|-.||-
T Consensus       409 ~~l~Ch~CG~~~-~p~--------~Cp~Cgs  430 (665)
T PRK14873        409 GTPRCRWCGRAA-PDW--------RCPRCGS  430 (665)
T ss_pred             CeeECCCCcCCC-cCc--------cCCCCcC
Confidence            358899999876 344        5899975


No 108
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=27.30  E-value=78  Score=25.68  Aligned_cols=33  Identities=30%  Similarity=0.524  Sum_probs=21.3

Q ss_pred             CccccCCCCcccccCCCCCCCCcccCCCCccccccc
Q psy12567         12 EDIEYFTEGRECVNCGAISTPLWRRDGTGHYLCNAR   47 (142)
Q Consensus        12 ~~~~~~~~~~~C~nCgt~~TplWr~~~~g~~lCnac   47 (142)
                      +......+.+.|.|||...=  -++|-. +.||-.|
T Consensus        52 d~~~~~~~~~~C~nCg~~GH--~~~DCP-~~iC~~C   84 (190)
T COG5082          52 DVSAIREENPVCFNCGQNGH--LRRDCP-HSICYNC   84 (190)
T ss_pred             ccccccccccccchhcccCc--ccccCC-hhHhhhc
Confidence            33355678999999987543  245555 5666666


No 109
>KOG0704|consensus
Probab=26.89  E-value=33  Score=30.56  Aligned_cols=28  Identities=32%  Similarity=0.845  Sum_probs=23.9

Q ss_pred             CCcccccCCCCCCCCcccCCCCccccccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGHYLCNAR   47 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~~lCnac   47 (142)
                      +-..|+.|++. -|+|..---|-++|..|
T Consensus        18 eNk~CfeC~a~-NPQWvSvsyGIfICLEC   45 (386)
T KOG0704|consen   18 ENKKCFECGAP-NPQWVSVSYGIFICLEC   45 (386)
T ss_pred             cCCceeecCCC-CCCeEeecccEEEEEec
Confidence            45689999876 49998877799999999


No 110
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=26.88  E-value=47  Score=22.97  Aligned_cols=31  Identities=23%  Similarity=0.654  Sum_probs=22.0

Q ss_pred             ccccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         79 RECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        79 ~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      ..|.-|+...+-.    --|..-|+||..+++..-
T Consensus         4 ~~C~VCg~~a~g~----hyGv~sC~aCk~FFRR~v   34 (82)
T cd07173           4 KTCLICGDEASGC----HYGALTCGSCKVFFKRAA   34 (82)
T ss_pred             CCCeecCCcCcce----EECcchhhhHHHHHHHHh
Confidence            4588888655432    235668999999998753


No 111
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=26.05  E-value=15  Score=20.81  Aligned_cols=26  Identities=38%  Similarity=0.779  Sum_probs=13.8

Q ss_pred             CccccccCCCCCCccccCCCC-Ccccchhhh
Q psy12567         78 GRECVNCGAISTPLWRRDGTG-HYLCNACGL  107 (142)
Q Consensus        78 ~~~C~nC~tt~Tp~WRr~~~G-~~lCNaCGl  107 (142)
                      .+.|..||+...+.    +.| ..+|.+||.
T Consensus         3 ~rfC~~CG~~t~~~----~~g~~r~C~~Cg~   29 (32)
T PF09297_consen    3 HRFCGRCGAPTKPA----PGGWARRCPSCGH   29 (32)
T ss_dssp             TSB-TTT--BEEE-----SSSS-EEESSSS-
T ss_pred             CcccCcCCccccCC----CCcCEeECCCCcC
Confidence            46788888876543    334 568888887


No 112
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=25.88  E-value=13  Score=22.20  Aligned_cols=30  Identities=27%  Similarity=0.719  Sum_probs=13.7

Q ss_pred             cccccCCCCCCcc----ccCCCCC---cccchhhhhH
Q psy12567         80 ECVNCGAISTPLW----RRDGTGH---YLCNACGLYH  109 (142)
Q Consensus        80 ~C~nC~tt~Tp~W----Rr~~~G~---~lCNaCGly~  109 (142)
                      .|.+|+..+.-.|    |..+++.   +.|..||-.|
T Consensus         2 ~Cp~Cg~~~a~~~~~Q~rsaDE~~T~fy~C~~C~~~w   38 (39)
T PF01096_consen    2 KCPKCGHNEAVFFQIQTRSADEPMTLFYVCCNCGHRW   38 (39)
T ss_dssp             --SSS-SSEEEEEEESSSSSSSSSEEEEEESSSTEEE
T ss_pred             CCcCCCCCeEEEEEeeccCCCCCCeEEEEeCCCCCee
Confidence            3566666554332    3344442   5677776543


No 113
>TIGR00613 reco DNA repair protein RecO. All proteins in this family for which functions are known are DNA binding proteins that are involved in the initiation of recombination or recombinational repair.
Probab=25.86  E-value=49  Score=26.15  Aligned_cols=32  Identities=19%  Similarity=0.292  Sum_probs=23.1

Q ss_pred             CCCcccccCCCCCCCCcccCCCCccccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTGHYLCNARLF   49 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g~~lCnacg~   49 (142)
                      .+-..|+.||......+-.-..|..+|..|..
T Consensus       145 p~l~~C~~cg~~~~~~~fs~~~gg~~C~~c~~  176 (241)
T TIGR00613       145 LDLDKCAVCGSKEDLIYFSMTYGGALCRQCGE  176 (241)
T ss_pred             cccCccCCCCCcCCCceEchhcCeEEChhhCc
Confidence            45568999998544455555578899999954


No 114
>KOG3740|consensus
Probab=25.77  E-value=27  Score=33.26  Aligned_cols=33  Identities=27%  Similarity=0.626  Sum_probs=29.3

Q ss_pred             CCCcccccCCCCCCCCcccCCCC----cccccccccc
Q psy12567         18 TEGRECVNCGAISTPLWRRDGTG----HYLCNARLFS   50 (142)
Q Consensus        18 ~~~~~C~nCgt~~TplWr~~~~g----~~lCnacg~~   50 (142)
                      ++..+|.-|.+.-||.|..-..+    +.+|-+|..+
T Consensus       460 ~~P~~caqcktdftp~wk~ekstq~d~~i~cE~cvtS  496 (706)
T KOG3740|consen  460 TEPYACAQCKTDFTPAWKKEKSTQADAAIVCENCVTS  496 (706)
T ss_pred             CCchhhhhcccccccccccccccCcchHHHHHhhhhh
Confidence            56889999999999999998887    8999999765


No 115
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers. DNA-binding domain of REV-ERB receptor- like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. REV-ERB receptors are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. REV-ERB receptors bind as a monomer to a (A/G)GGTCA half-site with a 5' AT-rich extension or as a homodimer to a direct repeat 2 element (AGGTCA sequence with a 2-bp spacer), indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target genes. The porphyr
Probab=25.73  E-value=30  Score=24.23  Aligned_cols=31  Identities=19%  Similarity=0.458  Sum_probs=21.9

Q ss_pred             CccccccCCCCCCccccCCCCCcccchhhhhHHhc
Q psy12567         78 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMN  112 (142)
Q Consensus        78 ~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~  112 (142)
                      ...|.-|+...+-.+    -|...|+||..|++..
T Consensus         3 ~~~C~VCg~~a~g~h----yGv~sC~aCk~FFRR~   33 (89)
T cd07166           3 VVLCKVCGDKASGFH----YGVHACEGCKGFFRRS   33 (89)
T ss_pred             CCCCcccCccCcceE----EChhhhhhHhhEecce
Confidence            346888887655432    4567899999988864


No 116
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=25.54  E-value=53  Score=23.03  Aligned_cols=32  Identities=25%  Similarity=0.438  Sum_probs=22.6

Q ss_pred             CccccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         78 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        78 ~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      ...|.-|+...+-.    --|...|+||..+++..-
T Consensus         6 ~~~C~VCg~~~~g~----hyGv~sC~aCk~FFRR~v   37 (90)
T cd07168           6 PKLCSICEDKATGL----HYGIITCEGCKGFFKRTV   37 (90)
T ss_pred             CCCCcccCCcCcce----EECceehhhhhHhhhhhh
Confidence            45688898755432    235678999999988743


No 117
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers. DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate  a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, p
Probab=25.03  E-value=51  Score=22.47  Aligned_cols=31  Identities=19%  Similarity=0.513  Sum_probs=21.4

Q ss_pred             ccccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         79 RECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        79 ~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      ..|.-|+...+-.    .-|..-|+||..+++..-
T Consensus         3 ~~C~VCg~~a~g~----hyGv~sC~aC~~FFRR~v   33 (78)
T cd07172           3 KICLVCSDEASGC----HYGVLTCGSCKVFFKRAV   33 (78)
T ss_pred             CCCeecCCcCcce----EECceeehhhHHhHHHHe
Confidence            4588888654432    235668999999988754


No 118
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER  has  a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserv
Probab=24.85  E-value=55  Score=22.58  Aligned_cols=31  Identities=19%  Similarity=0.499  Sum_probs=21.8

Q ss_pred             ccccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         79 RECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        79 ~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      ..|.-|+...+-.    --|...|+||..|++..-
T Consensus         4 ~~C~VCg~~~~g~----hyGv~sC~aC~~FFRR~v   34 (82)
T cd07171           4 HFCAVCSDYASGY----HYGVWSCEGCKAFFKRSI   34 (82)
T ss_pred             CCCeecCCcCcce----EECceeehhhHHhHHHHe
Confidence            4688888655432    235668999999998754


No 119
>KOG0909|consensus
Probab=24.20  E-value=54  Score=30.14  Aligned_cols=38  Identities=29%  Similarity=0.524  Sum_probs=26.6

Q ss_pred             CCcccccCCCCC-CCCcccCCC------C-----cccccccccccccccc
Q psy12567         19 EGRECVNCGAIS-TPLWRRDGT------G-----HYLCNARLFSTSFTGY   56 (142)
Q Consensus        19 ~~~~C~nCgt~~-TplWr~~~~------g-----~~lCnacg~~~k~~G~   56 (142)
                      ..+.|..||... +++=...|+      |     -|.||+||....++-|
T Consensus       160 N~PpC~~CG~et~~~l~~~~p~eeE~~~Ga~rVEiy~C~~C~~~~RFPRY  209 (500)
T KOG0909|consen  160 NNPPCNKCGGETSSGLGNQPPNEEEKKFGAGRVEIYKCNRCGTETRFPRY  209 (500)
T ss_pred             CCCCcccccccccccccCCCCchhHhhcCCceEEEEEecCCCCcccCccc
Confidence            456899999966 555443333      2     4789999988777665


No 120
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=24.00  E-value=49  Score=23.89  Aligned_cols=32  Identities=16%  Similarity=0.432  Sum_probs=23.0

Q ss_pred             CccccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         78 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        78 ~~~C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      ...|.-|+...+-.    --|...|+||..|++..-
T Consensus        18 ~~~C~VCg~~a~g~----hyGv~sC~aCk~FFRR~v   49 (101)
T cd07160          18 NEVCSVCGDKASGF----HYNVLSCEGCKGFFRRSV   49 (101)
T ss_pred             CCCCeecCCcCcce----EECcceehhhhhhhhhcc
Confidence            45799999755432    235678999999988653


No 121
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=23.47  E-value=50  Score=25.43  Aligned_cols=12  Identities=17%  Similarity=0.384  Sum_probs=8.3

Q ss_pred             CCcccccccccc
Q psy12567         39 TGHYLCNARLFS   50 (142)
Q Consensus        39 ~g~~lCnacg~~   50 (142)
                      .|.+.|..||..
T Consensus       110 ~G~l~C~~Cg~~  121 (146)
T PF07295_consen  110 PGTLVCENCGHE  121 (146)
T ss_pred             CceEecccCCCE
Confidence            367788888644


No 122
>PF10005 DUF2248:  Uncharacterized protein conserved in bacteria (DUF2248);  InterPro: IPR011201 This is a family of uncharacterised bacterial proteins.
Probab=23.43  E-value=1.1e+02  Score=26.87  Aligned_cols=31  Identities=29%  Similarity=0.547  Sum_probs=21.9

Q ss_pred             CCCccccccCCCCCCccccCCCC-Ccccchhhh
Q psy12567         76 TEGRECVNCGAISTPLWRRDGTG-HYLCNACGL  107 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp~WRr~~~G-~~lCNaCGl  107 (142)
                      ..-+.|.| .....--|=-..++ ..+|-||-+
T Consensus        51 ~~~~~C~N-~~~~~CNWlvp~~~~~~~C~aCrl   82 (343)
T PF10005_consen   51 RRYRRCAN-AEHAVCNWLVPADDPDALCRACRL   82 (343)
T ss_pred             ceeeeCCC-CCccccceeecCCCCCCcchhhhc
Confidence            45688999 66666678765554 689999943


No 123
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=23.42  E-value=33  Score=20.78  Aligned_cols=26  Identities=23%  Similarity=0.475  Sum_probs=13.8

Q ss_pred             ccccccCCCCCCccccCCCCCcccchhhh
Q psy12567         79 RECVNCGAISTPLWRRDGTGHYLCNACGL  107 (142)
Q Consensus        79 ~~C~nC~tt~Tp~WRr~~~G~~lCNaCGl  107 (142)
                      -.|.+||+..+-.   ...+...|..||-
T Consensus         4 y~C~~CG~~~~~~---~~~~~~~Cp~CG~   29 (46)
T PRK00398          4 YKCARCGREVELD---EYGTGVRCPYCGY   29 (46)
T ss_pred             EECCCCCCEEEEC---CCCCceECCCCCC
Confidence            3577777755321   1111456777775


No 124
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=23.30  E-value=53  Score=24.73  Aligned_cols=19  Identities=16%  Similarity=0.093  Sum_probs=16.1

Q ss_pred             CCCcccCCCCccccccccc
Q psy12567         31 TPLWRRDGTGHYLCNARLF   49 (142)
Q Consensus        31 TplWr~~~~g~~lCnacg~   49 (142)
                      .+.|.....|.|+|-.|+.
T Consensus        23 g~y~~~~~~G~Y~C~~Cg~   41 (119)
T PRK05508         23 GEYNDFFEKGTYVCKQCGA   41 (119)
T ss_pred             CCCcCcCCCeEEEecCCCC
Confidence            4688888899999999983


No 125
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=22.99  E-value=50  Score=17.64  Aligned_cols=6  Identities=83%  Similarity=1.885  Sum_probs=2.5

Q ss_pred             cccCCC
Q psy12567         23 CVNCGA   28 (142)
Q Consensus        23 C~nCgt   28 (142)
                      |.+||+
T Consensus         2 Cp~CG~    7 (23)
T PF13240_consen    2 CPNCGA    7 (23)
T ss_pred             CcccCC
Confidence            344443


No 126
>KOG0818|consensus
Probab=22.98  E-value=38  Score=31.78  Aligned_cols=28  Identities=25%  Similarity=0.789  Sum_probs=0.0

Q ss_pred             CCcccccCCCCCCCCcccCCCCccccccc
Q psy12567         19 EGRECVNCGAISTPLWRRDGTGHYLCNAR   47 (142)
Q Consensus        19 ~~~~C~nCgt~~TplWr~~~~g~~lCnac   47 (142)
                      +..+|.+||+.. |.|-.=.-|-+||..|
T Consensus         7 ~~evC~DC~~~d-p~WASvnrGt~lC~eC   34 (669)
T KOG0818|consen    7 SSEVCADCSGPD-PSWASVNRGTFLCDEC   34 (669)
T ss_pred             hhhhhcccCCCC-CcceeecCceEehHhh


No 127
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=22.68  E-value=39  Score=28.92  Aligned_cols=31  Identities=32%  Similarity=0.643  Sum_probs=23.9

Q ss_pred             CCCccccccCCCCCCccccCCCC-CcccchhhhhHH
Q psy12567         76 TEGRECVNCGAISTPLWRRDGTG-HYLCNACGLYHK  110 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp~WRr~~~G-~~lCNaCGly~k  110 (142)
                      ...+.|..||+...+.    ..| ..+|+.||.+++
T Consensus       109 ~~~RFCg~CG~~~~~~----~~g~~~~C~~cg~~~f  140 (279)
T COG2816         109 RSHRFCGRCGTKTYPR----EGGWARVCPKCGHEHF  140 (279)
T ss_pred             hhCcCCCCCCCcCccc----cCceeeeCCCCCCccC
Confidence            4579999999998764    233 689999998544


No 128
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=22.48  E-value=69  Score=17.61  Aligned_cols=23  Identities=22%  Similarity=0.521  Sum_probs=11.1

Q ss_pred             cccCCCCCCCCcccCCCCcccccccc
Q psy12567         23 CVNCGAISTPLWRRDGTGHYLCNARL   48 (142)
Q Consensus        23 C~nCgt~~TplWr~~~~g~~lCnacg   48 (142)
                      |+.||..-.|.   .-.-.|.|..||
T Consensus         1 C~sC~~~i~~r---~~~v~f~CPnCG   23 (24)
T PF07754_consen    1 CTSCGRPIAPR---EQAVPFPCPNCG   23 (24)
T ss_pred             CccCCCcccCc---ccCceEeCCCCC
Confidence            45555554441   111246676665


No 129
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=22.13  E-value=36  Score=23.51  Aligned_cols=29  Identities=21%  Similarity=0.523  Sum_probs=19.2

Q ss_pred             ccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         81 CVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        81 C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      |.-|+...+-.+    -|...|+||..+++..-
T Consensus         2 C~VCg~~~~g~h----yGv~sC~aCk~FFRR~v   30 (84)
T cd06965           2 CRVCGDKASGFH----YGVHACEGCKGFFRRTI   30 (84)
T ss_pred             CcccCccCcceE----EChhhhhhhhhheeeee
Confidence            666775444332    35568999999888643


No 130
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=22.07  E-value=50  Score=26.22  Aligned_cols=31  Identities=26%  Similarity=0.598  Sum_probs=25.4

Q ss_pred             CCCccccccCCCCCCccccCCCCCcccchhh
Q psy12567         76 TEGRECVNCGAISTPLWRRDGTGHYLCNACG  106 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp~WRr~~~G~~lCNaCG  106 (142)
                      ..-..|..||+.....+-.-.+|..+|..|+
T Consensus       147 p~l~~C~~Cg~~~~~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        147 LDLDHCAVCGAPGDHRYFSPKEGGAVCSECG  177 (247)
T ss_pred             cchhhHhcCCCCCCceEEecccCCccccccc
Confidence            3456899999887767777788899999996


No 131
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=21.62  E-value=40  Score=28.81  Aligned_cols=36  Identities=22%  Similarity=0.433  Sum_probs=25.7

Q ss_pred             CCCCccccccCCCCCCcc----ccCCCC---CcccchhhhhHH
Q psy12567         75 FTEGRECVNCGAISTPLW----RRDGTG---HYLCNACGLYHK  110 (142)
Q Consensus        75 ~~~~~~C~nC~tt~Tp~W----Rr~~~G---~~lCNaCGly~k  110 (142)
                      ......|..|+-.....|    |..+++   -++|..||-.|+
T Consensus       255 ~t~~~~C~~C~~~~~~~~q~QtrsaDEpmT~f~~C~~Cg~~w~  297 (299)
T TIGR01385       255 VTDLFTCGKCKQKKCTYYQLQTRSADEPMTTFVTCEECGNRWK  297 (299)
T ss_pred             CcccccCCCCCCccceEEEecccCCCCCCeEEEEcCCCCCeee
Confidence            345689999998887544    333444   369999998776


No 132
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=21.28  E-value=39  Score=25.43  Aligned_cols=31  Identities=26%  Similarity=0.285  Sum_probs=19.7

Q ss_pred             CCCcccccCCCCCCCC--c-ccCCCCcccccccc
Q psy12567         18 TEGRECVNCGAISTPL--W-RRDGTGHYLCNARL   48 (142)
Q Consensus        18 ~~~~~C~nCgt~~Tpl--W-r~~~~g~~lCnacg   48 (142)
                      .....|.+||..-|.+  - -.+++|.+.|..||
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg  130 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQLLDMDGTFTCPRCG  130 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHhcCCCCcEECCCCC
Confidence            4466788888766541  1 11456678888885


No 133
>PF15396 FAM60A:  Protein Family FAM60A
Probab=20.66  E-value=50  Score=27.27  Aligned_cols=11  Identities=55%  Similarity=0.975  Sum_probs=8.9

Q ss_pred             ccchhhhhHHh
Q psy12567        101 LCNACGLYHKM  111 (142)
Q Consensus       101 lCNaCGly~k~  111 (142)
                      +||||-|..++
T Consensus        51 ICNACVLLVKR   61 (213)
T PF15396_consen   51 ICNACVLLVKR   61 (213)
T ss_pred             hhHHHHHHHHH
Confidence            89999995555


No 134
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=20.60  E-value=60  Score=21.59  Aligned_cols=28  Identities=21%  Similarity=0.580  Sum_probs=17.8

Q ss_pred             ccccCCCCCCccccCCCCCcccchhhhhHHhc
Q psy12567         81 CVNCGAISTPLWRRDGTGHYLCNACGLYHKMN  112 (142)
Q Consensus        81 C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~  112 (142)
                      |.-|+...+-.    .-|...|+||..++++.
T Consensus         1 C~VCg~~~~g~----hyGv~~C~aC~~FFRR~   28 (73)
T cd07158           1 CKVCGDKASGF----HYGVHSCEGCKGFFRRT   28 (73)
T ss_pred             CcccCccCcce----EECcchhhHHHHHHhhh
Confidence            44565544422    23556899999998864


No 135
>COG3952 Predicted membrane protein [Function unknown]
Probab=20.59  E-value=24  Score=26.41  Aligned_cols=20  Identities=35%  Similarity=0.669  Sum_probs=13.6

Q ss_pred             ccccCCCCCcccchhhhhHHh
Q psy12567         91 LWRRDGTGHYLCNACGLYHKM  111 (142)
Q Consensus        91 ~WRr~~~G~~lCNaCGly~k~  111 (142)
                      +||.||- ..+|++||++-.+
T Consensus        76 i~~~DpV-~Vl~~~~glF~~l   95 (113)
T COG3952          76 IRRQDPV-FVLGQACGLFIYL   95 (113)
T ss_pred             HHhcchH-HHHHHhhhHHHHH
Confidence            4555555 4699999996544


No 136
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=20.57  E-value=59  Score=22.21  Aligned_cols=29  Identities=21%  Similarity=0.494  Sum_probs=18.4

Q ss_pred             ccccCCCCCCccccCCCCCcccchhhhhHHhcC
Q psy12567         81 CVNCGAISTPLWRRDGTGHYLCNACGLYHKMNG  113 (142)
Q Consensus        81 C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~~  113 (142)
                      |.-|+...+-.    --|...|+||..+++..-
T Consensus         1 C~VCg~~~~g~----hyG~~sC~aC~~FFRR~~   29 (81)
T cd07165           1 CKVCGDKASGY----HYGVTSCEGCKGFFRRSI   29 (81)
T ss_pred             CCccCccCcce----EECchhhhhHHHHHHhHh
Confidence            44566544322    235668999999888743


No 137
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=20.28  E-value=36  Score=21.45  Aligned_cols=31  Identities=29%  Similarity=0.651  Sum_probs=21.6

Q ss_pred             CCCccccccCCCCCCc----cccCCCCCcccchhhh
Q psy12567         76 TEGRECVNCGAISTPL----WRRDGTGHYLCNACGL  107 (142)
Q Consensus        76 ~~~~~C~nC~tt~Tp~----WRr~~~G~~lCNaCGl  107 (142)
                      -.+..|..|+..-+|.    ++++ ++-..|..||-
T Consensus        20 v~~~~C~gC~~~l~~~~~~~i~~~-~~i~~Cp~CgR   54 (56)
T PF02591_consen   20 VEGGTCSGCHMELPPQELNEIRKG-DEIVFCPNCGR   54 (56)
T ss_pred             eeCCccCCCCEEcCHHHHHHHHcC-CCeEECcCCCc
Confidence            3456899999988885    3333 44578888874


No 138
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domains of estrogen receptor (ER) and estrogen related receptors (ERR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. ER and ERR interact with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulate the rate of transcriptional initiation. ERR and ER are closely related and share sequence similarity, target genes, co-regulators and promoters. While ER is activated by endogenous estrogen, ERR lacks the ability to bind to estrogen. Estrogen receptor mediates the biological effects of hormone estrogen by the binding of the receptor dimer to estrogen response element of target genes.  However, ERRs seem to interfere with the classic ER-mediated estrogen responsive signaling by targeting the same set of genes. E
Probab=20.07  E-value=61  Score=21.77  Aligned_cols=28  Identities=32%  Similarity=0.737  Sum_probs=17.7

Q ss_pred             ccccCCCCCCccccCCCCCcccchhhhhHHhc
Q psy12567         81 CVNCGAISTPLWRRDGTGHYLCNACGLYHKMN  112 (142)
Q Consensus        81 C~nC~tt~Tp~WRr~~~G~~lCNaCGly~k~~  112 (142)
                      |.-|+...+-.    .-|...|+||..+++..
T Consensus         1 C~VC~~~~~g~----hygv~sC~aCk~FFRR~   28 (75)
T cd07155           1 CLVCGDIASGY----HYGVASCEACKAFFKRT   28 (75)
T ss_pred             CcccCccCcce----EEChhhhhhhHHHHHHH
Confidence            44555443322    23556899999998874


No 139
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=20.04  E-value=94  Score=32.05  Aligned_cols=49  Identities=27%  Similarity=0.516  Sum_probs=30.5

Q ss_pred             CcccccCCCCCCCCcccCCCCcccccccccccccccccccccccccCCCccccccCCCCccccccCCCCCC-ccccCC
Q psy12567         20 GRECVNCGAISTPLWRRDGTGHYLCNARLFSTSFTGYFIMSRFLFASLPVEDIEYFTEGRECVNCGAISTP-LWRRDG   96 (142)
Q Consensus        20 ~~~C~nCgt~~TplWr~~~~g~~lCnacg~~~k~~G~~~~~R~~~~~~~~~~~~~~~~~~~C~nC~tt~Tp-~WRr~~   96 (142)
                      ...|.+||+..+|.        +.|..||.....                .  ++ . ...|.+|++..++ .+++-+
T Consensus       679 ~~fCP~CGs~te~v--------y~CPsCGaev~~----------------d--es-~-a~~CP~CGtplv~~~~~~i~  728 (1337)
T PRK14714        679 ENRCPDCGTHTEPV--------YVCPDCGAEVPP----------------D--ES-G-RVECPRCDVELTPYQRRTIN  728 (1337)
T ss_pred             cccCcccCCcCCCc--------eeCccCCCccCC----------------C--cc-c-cccCCCCCCcccccceEEec
Confidence            34899999987664        489999642110                0  01 1 4579999988766 344433


Done!