Diaphorina citri psyllid: psy12568


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MLTDESQQGSPQSLSTLVLKCFGKTLNKQDQFSNWENRPLRPSQISYAALDAFCLLQVYQVLHDQCARQGIELGPLLTEVLSSHAVTTKKSTILYFSTVSGLDTKEHRQLCLNH
ccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccHHHHccccHHHcHHHHHHHHcc
**************STLVLKCFGKTLNKQDQFSNWENRPLRPSQISYAALDAFCLLQVYQVLHDQCARQGIELGPLLTEVLSSHAVTTKKSTILYFSTVSGLDTKEHRQLCL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTDESQQGSPQSLSTLVLKCFGKTLNKQDQFSNWENRPLRPSQISYAALDAFCLLQVYQVLHDQCARQGIELGPLLTEVLSSHAVTTKKSTILYFSTVSGLDTKEHRQLCLNH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable exonuclease mut-7 homolog confidentQ9VIF1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SAF, chain A
Confidence level:very confident
Coverage over the Query: 11-72
View the alignment between query and template
View the model in PyMOL
Template: 1YT3, chain A
Confidence level:confident
Coverage over the Query: 9-110
View the alignment between query and template
View the model in PyMOL