Diaphorina citri psyllid: psy12574

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----

CRETAFIYAITSAAVTHTVARSCAEGSIESCTCDYSHQSKGQRPTKTTLNNVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGRSLREKMNLHNNEAGRCRETAFIYAITSAAVTHTVARSCAEGSIESCTCDYSHQSKGQRPTKTTLNNVAGVRDWEWGGCSDNIGFGFKFSREFVDTGERGRSLREKMNLHNNEAGRAHFNMVLNVSLLQHVMAEMRQECKCHGMSGSCTVKTCWMRLPNF

cHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccCECcccccccccEEccccccc

CRETAFIYAITSAAVTHTVARSCAEGSIESCTC***********************DWEWGGCSDNIGFGFKFSREFVDTGERGR***E**NLHNNEAGRCRETAFIYAITSAAVTHTVARSCAEGSIESCTC**********************RDWEWGGCSDNIGFGFKFSREFVDTGERGRSLREKMN*****AGRAHFNMVLNVSLLQHVMAEMRQECKCHGMSGSCTVKTCWMRLPNF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein Wnt-1 (Fragment)	Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule important in CNS development. Is likely to signal over only few cell diameters. Proeminent role in the induction of the mesencephalon and cerebellum.	confident	Q91029
Proto-oncogene Wnt-1	Ligand for members of the frizzled family of seven transmembrane receptors. In some developmental processes, is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. Probable developmental protein. May be a signaling molecule important in CNS development. Is likely to signal over only few cell diameters.	confident	P04628
Protein Wnt-1	Ligand for members of the frizzled family of seven transmembrane receptors. Involved in neurogenesis. Performs a partially redundant function with wnt10b in the formation of the midbrain-hindbrain boundary (MHB) organizer. In the hindbrain, mediates lateral inhibition of boundary cell specification, probably via up-regulation of proneural and Delta gene expression in non-boundary cells; localized expression of wnt1 in boundary cells is maintained via rfng-mediated modulation of Notch activity.	confident	P24257

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0050840 [MF]	extracellular matrix binding	probable	GO:0003674, GO:0005488
GO:0045121 [CC]	membrane raft	probable	GO:0005575, GO:0044425, GO:0016020
GO:0030139 [CC]	endocytic vesicle	probable	GO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005539 [MF]	glycosaminoglycan binding	probable	GO:0097367, GO:0003674, GO:0005488
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0043499 [MF]	eukaryotic cell surface binding	probable
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0005769 [CC]	early endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005771 [CC]	multivesicular body	probable	GO:0005737, GO:0043231, GO:0043227, GO:0005770, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0035170 [BP]	lymph gland crystal cell differentiation	probable	GO:0035168, GO:0048569, GO:0035167, GO:0035166, GO:0009791, GO:0002164, GO:0007275, GO:0044699, GO:0048869, GO:0042688, GO:0048513, GO:0048534, GO:0002520, GO:0032502, GO:0042386, GO:0030154, GO:0032501, GO:0009987, GO:0048731, GO:0044767, GO:0044763, GO:0030097, GO:0048542, GO:0044707, GO:0048856, GO:0002376, GO:0008150, GO:0048732
GO:0048146 [BP]	positive regulation of fibroblast proliferation	probable	GO:0008284, GO:0042127, GO:0048145, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0051129 [BP]	negative regulation of cellular component organization	probable	GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0048523, GO:0048519, GO:0051128, GO:0050789, GO:0044699
GO:0010002 [BP]	cardioblast differentiation	probable	GO:0032502, GO:0007507, GO:0048863, GO:0044707, GO:0048869, GO:0032501, GO:0030154, GO:0035051, GO:0044767, GO:0048513, GO:0072359, GO:0072358, GO:0044763, GO:0008150, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0048856
GO:0030707 [BP]	ovarian follicle cell development	probable	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0007276, GO:0000003, GO:0048869, GO:0044699, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0044763, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0008150
GO:0051017 [BP]	actin filament bundle assembly	probable	GO:0006996, GO:0007015, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0071822, GO:0043933, GO:0009987, GO:0030036, GO:0044085, GO:0044763, GO:0016043, GO:0008150, GO:0071840
GO:0022407 [BP]	regulation of cell-cell adhesion	probable	GO:0008150, GO:0030155, GO:0065007, GO:0050789, GO:0050794
GO:0051270 [BP]	regulation of cellular component movement	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789, GO:0050794
GO:0035017 [BP]	cuticle pattern formation	probable	GO:0032502, GO:0007389, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0090344 [BP]	negative regulation of cell aging	probable	GO:0051093, GO:0090342, GO:0050793, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0060914 [BP]	heart formation	probable	GO:0032502, GO:0007507, GO:0009887, GO:0032501, GO:0044707, GO:0008150, GO:0048513, GO:0048856, GO:0007275, GO:0003007, GO:0072359, GO:0072358, GO:0044767, GO:0044699, GO:0048731, GO:0009653, GO:0048645, GO:0048646
GO:0035153 [BP]	epithelial cell type specification, open tracheal system	probable	GO:0060541, GO:0007424, GO:0045165, GO:0044707, GO:0048869, GO:0001708, GO:0030154, GO:0032502, GO:0032501, GO:0044763, GO:0008150, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0048856
GO:0031012 [CC]	extracellular matrix	probable	GO:0005575
GO:0046672 [BP]	positive regulation of compound eye retinal cell programmed cell death	probable	GO:0051094, GO:0050793, GO:0008150, GO:0022603, GO:0045595, GO:0060284, GO:0050789, GO:0065007, GO:0010942, GO:0043067, GO:0046670, GO:0046668, GO:0046669, GO:0051239, GO:0048522, GO:0048518, GO:2000026, GO:0010941, GO:0043068, GO:0050794, GO:2000027
GO:0061328 [BP]	posterior Malpighian tubule development	probable	GO:0032502, GO:0032501, GO:0061326, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072002, GO:0035295, GO:0072001, GO:0044699
GO:0048728 [BP]	proboscis development	probable	GO:0032502, GO:0032501, GO:0035213, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005112 [MF]	Notch binding	probable	GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:2000002 [BP]	negative regulation of DNA damage checkpoint	probable	GO:0045786, GO:0051726, GO:0048583, GO:0048585, GO:0080135, GO:0010564, GO:0050794, GO:0050789, GO:0080134, GO:0010948, GO:0065007, GO:2000001, GO:0008150, GO:0048519, GO:2001021, GO:2001020, GO:1901977, GO:1901976, GO:0048523
GO:0046847 [BP]	filopodium assembly	probable	GO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0035147 [BP]	branch fusion, open tracheal system	probable	GO:0035146, GO:0048754, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0060541, GO:0032501, GO:0035239, GO:0060446, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0007424, GO:0044707, GO:0048856, GO:0032502, GO:0048731
GO:0043085 [BP]	positive regulation of catalytic activity	probable	GO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0061184 [BP]	positive regulation of dermatome development	probable	GO:0051239, GO:0051094, GO:0040019, GO:0050789, GO:0008150, GO:0050793, GO:2000026, GO:0045995, GO:0048518, GO:0065007, GO:0061183
GO:0048190 [BP]	wing disc dorsal/ventral pattern formation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009953, GO:0044707, GO:0007444, GO:0007450, GO:0048856, GO:0035222, GO:0035220, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007447, GO:0007275, GO:0044699
GO:0007346 [BP]	regulation of mitotic cell cycle	probable	GO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0042770 [BP]	signal transduction in response to DNA damage	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0006974, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0050789, GO:0044699
GO:0007523 [BP]	larval visceral muscle development	probable	GO:0032502, GO:0048513, GO:0007517, GO:0032501, GO:0044707, GO:0048569, GO:0048856, GO:0009791, GO:0002164, GO:0044767, GO:0008150, GO:0061061, GO:0048731, GO:0007522, GO:0007275, GO:0044699
GO:0000578 [BP]	embryonic axis specification	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009798, GO:0007275, GO:0044699
GO:0033077 [BP]	T cell differentiation in thymus	probable	GO:0030154, GO:0042110, GO:0045321, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0048534, GO:0032502, GO:0032501, GO:0030217, GO:0009987, GO:0044767, GO:0001775, GO:0046649, GO:0044763, GO:0048731, GO:0002521, GO:0002520, GO:0044707, GO:0048856, GO:0030097, GO:0002376, GO:0030098, GO:0008150
GO:0043410 [BP]	positive regulation of MAPK cascade	probable	GO:0023051, GO:0010646, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0010627, GO:0050789, GO:0043408
GO:0042060 [BP]	wound healing	probable	GO:0050896, GO:0006950, GO:0008150, GO:0009611
GO:0043568 [BP]	positive regulation of insulin-like growth factor receptor signaling pathway	probable	GO:0043567, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0045747 [BP]	positive regulation of Notch signaling pathway	probable	GO:0023051, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0008593, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0030032 [BP]	lamellipodium assembly	probable	GO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0035289 [BP]	posterior head segmentation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0060322, GO:0008150, GO:0003002, GO:0035282, GO:0007350, GO:0007275, GO:0044699, GO:0035287
GO:0031346 [BP]	positive regulation of cell projection organization	probable	GO:0051130, GO:0051128, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0031344, GO:0048522
GO:0010259 [BP]	multicellular organismal aging	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0048076 [BP]	regulation of compound eye pigmentation	probable	GO:0050793, GO:0048073, GO:0048070, GO:0065007, GO:0008150, GO:0050789
GO:0040012 [BP]	regulation of locomotion	probable	GO:0008150, GO:0065007, GO:0050789
GO:0071425 [BP]	hematopoietic stem cell proliferation	probable	GO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0008283, GO:0048856, GO:0007275, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0030097, GO:0072089, GO:0048534, GO:0044699, GO:0002520
GO:0016015 [MF]	morphogen activity	probable	GO:0003674
GO:0061320 [BP]	pericardial nephrocyte differentiation	probable	GO:0030154, GO:0072359, GO:0072358, GO:0061318, GO:0007275, GO:0044699, GO:0048869, GO:0061319, GO:0048513, GO:0032502, GO:0032501, GO:0009987, GO:0035051, GO:0044767, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0007507, GO:0044707, GO:0048856, GO:0044763
GO:0014706 [BP]	striated muscle tissue development	probable	GO:0032502, GO:0048856, GO:0008150, GO:0009888, GO:0060537
GO:0035290 [BP]	trunk segmentation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0035282, GO:0007350, GO:0007275, GO:0044699
GO:0008544 [BP]	epidermis development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0009888, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0032876 [BP]	negative regulation of DNA endoreduplication	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0010948, GO:0090329, GO:0050789, GO:0051052, GO:0010605, GO:0019222, GO:0010564, GO:2000113, GO:0060255, GO:0065007, GO:0031326, GO:0048519, GO:0051053, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008156, GO:0008150, GO:0051171, GO:0051172, GO:0032875, GO:0051726, GO:2000104, GO:0006275, GO:0010556, GO:0010558, GO:0048523
GO:0061331 [BP]	epithelial cell proliferation involved in Malpighian tubule morphogenesis	probable	GO:0032502, GO:0061326, GO:0048619, GO:0055123, GO:0009790, GO:0048565, GO:0009653, GO:0007275, GO:0044699, GO:2001013, GO:0002009, GO:0048513, GO:0048729, GO:0060562, GO:0072001, GO:0048598, GO:0061333, GO:0032501, GO:0035239, GO:0008283, GO:0060429, GO:0009888, GO:0044767, GO:0061525, GO:0008150, GO:0001655, GO:0072002, GO:0035295, GO:0007443, GO:0007442, GO:0044707, GO:0048856, GO:0050673, GO:0048731, GO:0048546
GO:0061332 [BP]	Malpighian tubule bud morphogenesis	probable	GO:0032502, GO:0016331, GO:0061326, GO:0060571, GO:0060572, GO:0048619, GO:0009887, GO:0035148, GO:0055123, GO:0009790, GO:0072175, GO:0072078, GO:0072079, GO:0048565, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0001822, GO:0072073, GO:0048513, GO:0048729, GO:0060562, GO:0048646, GO:0048598, GO:0001838, GO:0061333, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0044767, GO:0061525, GO:0072009, GO:0008150, GO:0001655, GO:0060993, GO:0072002, GO:0072001, GO:0072006, GO:0007443, GO:0007442, GO:0044707, GO:0072028, GO:0048856, GO:0035295, GO:0072080, GO:0048731, GO:0072088, GO:0048546
GO:0035311 [BP]	wing cell fate specification	probable	GO:0060573, GO:0030154, GO:0035220, GO:0007275, GO:0044699, GO:0007389, GO:0048869, GO:0001708, GO:0008150, GO:0048513, GO:0032502, GO:0032501, GO:0009987, GO:0044767, GO:0060581, GO:0003002, GO:0035309, GO:0045165, GO:0044707, GO:0007444, GO:0048856, GO:0044763, GO:0048731
GO:0051091 [BP]	positive regulation of sequence-specific DNA binding transcription factor activity	probable	GO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0021587 [BP]	cerebellum morphogenesis	probable	GO:0032502, GO:0044707, GO:0021549, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0022037, GO:0021575, GO:0044767, GO:0048513, GO:0008150, GO:0030902, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0007417
GO:0030917 [BP]	midbrain-hindbrain boundary development	probable	GO:0021903, GO:0021532, GO:0009790, GO:0009792, GO:0007275, GO:0044699, GO:0007417, GO:0007389, GO:0048513, GO:0043009, GO:0032502, GO:0032501, GO:0021915, GO:0044767, GO:0008150, GO:0003002, GO:0048731, GO:0009952, GO:0007420, GO:0044707, GO:0048856, GO:0007399
GO:0035277 [BP]	spiracle morphogenesis, open tracheal system	probable	GO:0032502, GO:0007424, GO:0032501, GO:0044707, GO:0060541, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0090263 [BP]	positive regulation of canonical Wnt receptor signaling pathway	probable	GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0030111, GO:0050794, GO:0023056, GO:0030177, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0060828, GO:0048522
GO:0030579 [BP]	ubiquitin-dependent SMAD protein catabolic process	probable	GO:0044238, GO:0044248, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0043632, GO:0050789, GO:0044699, GO:0044267, GO:0051716, GO:0044265, GO:0044260, GO:0071704, GO:0065007, GO:0006508, GO:0044700, GO:0009987, GO:0019941, GO:1901575, GO:0050794, GO:0044763, GO:0030163, GO:0008152, GO:0044257, GO:0007154, GO:0009056, GO:0009057, GO:0007178, GO:0051603, GO:0019538, GO:0050896, GO:0044237, GO:0043170, GO:0006511, GO:0008150
GO:0072091 [BP]	regulation of stem cell proliferation	probable	GO:0042127, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0007476 [BP]	imaginal disc-derived wing morphogenesis	probable	GO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:2000059 [BP]	negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process	probable	GO:0009894, GO:0009892, GO:0080090, GO:0031329, GO:0031324, GO:0031323, GO:0042176, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0051246, GO:2000058, GO:0065007, GO:0031399, GO:0031396, GO:0031397, GO:0060255, GO:0050794, GO:0030162, GO:0048519, GO:0032269, GO:0032268, GO:0031400, GO:0008150, GO:0048523
GO:0002168 [BP]	instar larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002165, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0031099 [BP]	regeneration	probable	GO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0050768 [BP]	negative regulation of neurogenesis	probable	GO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0008150, GO:0065007, GO:0010721, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0051146 [BP]	striated muscle cell differentiation	probable	GO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0061061, GO:0008150, GO:0009987, GO:0042692, GO:0044699
GO:0007267 [BP]	cell-cell signaling	probable	GO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699
GO:0035263 [BP]	genital disc sexually dimorphic development	probable	GO:0032502, GO:0048513, GO:0035215, GO:0032501, GO:0048609, GO:0032504, GO:0007444, GO:0044707, GO:0048856, GO:0007548, GO:0044767, GO:0003006, GO:0022414, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0000003
GO:0032535 [BP]	regulation of cellular component size	probable	GO:0009987, GO:0016043, GO:0090066, GO:0065007, GO:0044763, GO:0071840, GO:0008150, GO:0065008, GO:0044699
GO:0048332 [BP]	mesoderm morphogenesis	probable	GO:0032502, GO:0007498, GO:0048856, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0031334 [BP]	positive regulation of protein complex assembly	probable	GO:0051130, GO:0051128, GO:0044087, GO:0065007, GO:0048518, GO:0008150, GO:0043254, GO:0050794, GO:0050789, GO:0048522
GO:0050770 [BP]	regulation of axonogenesis	probable	GO:0022604, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0030512 [BP]	negative regulation of transforming growth factor beta receptor signaling pathway	probable	GO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0021846 [BP]	cell proliferation in forebrain	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0008283, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0030900, GO:0008150, GO:0061351, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0016318 [BP]	ommatidial rotation	probable	GO:0048749, GO:0060429, GO:0007163, GO:0007164, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001745, GO:0008150, GO:0048513, GO:0048729, GO:0032502, GO:0009887, GO:0032501, GO:0002009, GO:0042067, GO:0048592, GO:0009987, GO:0009888, GO:0044767, GO:0001738, GO:0001654, GO:0048731, GO:0001736, GO:0007423, GO:0044707, GO:0048856, GO:0044763
GO:0035224 [BP]	genital disc anterior/posterior pattern formation	probable	GO:0032502, GO:0007389, GO:0035215, GO:0048856, GO:0007447, GO:0009952, GO:0044707, GO:0007444, GO:0032501, GO:0007448, GO:0035221, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0048731, GO:0007275, GO:0044699
GO:0035225 [BP]	determination of genital disc primordium	probable	GO:0032502, GO:0035215, GO:0045165, GO:0044707, GO:0007445, GO:0007444, GO:0048869, GO:0032501, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0048856
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0044212 [MF]	transcription regulatory region DNA binding	probable	GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0007446 [BP]	imaginal disc growth	probable	GO:0032502, GO:0032501, GO:0048589, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0035265, GO:0048731, GO:0007275, GO:0044699, GO:0040007
GO:0042691 [BP]	positive regulation of crystal cell differentiation	probable	GO:0051094, GO:0050793, GO:0045595, GO:0050794, GO:0045597, GO:0002684, GO:0042689, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:0065007, GO:0045610, GO:0050789, GO:0045612, GO:0048522
GO:0035288 [BP]	anterior head segmentation	probable	GO:0032502, GO:0007389, GO:0032501, GO:0097065, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009880, GO:0060322, GO:0008150, GO:0003002, GO:0035282, GO:0007350, GO:0007275, GO:0044699, GO:0035287
GO:0043066 [BP]	negative regulation of apoptotic process	probable	GO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0008104 [BP]	protein localization	probable	GO:0033036, GO:0008150, GO:0051179
GO:0007419 [BP]	ventral cord development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0007411 [BP]	axon guidance	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0045611 [BP]	negative regulation of hemocyte differentiation	probable	GO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0002682, GO:0002683, GO:0051239, GO:0048519, GO:0045610, GO:0050789, GO:0048523
GO:0010812 [BP]	negative regulation of cell-substrate adhesion	probable	GO:0010810, GO:0030155, GO:0050794, GO:0008150, GO:0007162, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0030509 [BP]	BMP signaling pathway	probable	GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0007178, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150
GO:0014019 [BP]	neuroblast development	probable	GO:0032502, GO:0014016, GO:0048863, GO:0048864, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0048699, GO:0044767, GO:0032501, GO:0044763, GO:0008150, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0003136 [BP]	negative regulation of heart induction by canonical Wnt receptor signaling pathway	probable	GO:0016055, GO:0009997, GO:0009996, GO:0023057, GO:0072359, GO:0072358, GO:0023052, GO:0010648, GO:0007166, GO:0023051, GO:2000736, GO:0051890, GO:0050789, GO:0044699, GO:1901320, GO:0010646, GO:0003306, GO:0090381, GO:0007275, GO:0048513, GO:0065007, GO:0048519, GO:0061311, GO:0042686, GO:0061316, GO:0032502, GO:0032501, GO:0044700, GO:0050793, GO:0009987, GO:0051716, GO:0050794, GO:0044767, GO:0060070, GO:0045595, GO:0042659, GO:0051239, GO:0048731, GO:0007154, GO:0048856, GO:0051093, GO:0007507, GO:2000043, GO:2000044, GO:0044707, GO:0045596, GO:0050896, GO:0010453, GO:0010454, GO:0044763, GO:2000026, GO:0008150, GO:0048523, GO:0007165
GO:0035217 [BP]	labial disc development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0051641 [BP]	cellular localization	probable	GO:0008150, GO:0009987, GO:0044763, GO:0051179, GO:0044699
GO:0061382 [BP]	Malpighian tubule tip cell differentiation	probable	GO:0032502, GO:0048856, GO:0061326, GO:0044707, GO:0008150, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0007275, GO:0044767, GO:0048513, GO:0044763, GO:0001655, GO:0048731, GO:0072002, GO:0035295, GO:0072001, GO:0044699
GO:0005125 [MF]	cytokine activity	probable	GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0007418 [BP]	ventral midline development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0007398 [BP]	ectoderm development	probable	GO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0007394 [BP]	dorsal closure, elongation of leading edge cells	probable	GO:0022604, GO:0032502, GO:0016331, GO:0051239, GO:0048589, GO:0022603, GO:0051128, GO:0009790, GO:0009792, GO:0009653, GO:0007275, GO:0044699, GO:0009826, GO:0001700, GO:0016049, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0065007, GO:0071840, GO:0048729, GO:0016476, GO:0060560, GO:0048598, GO:0060429, GO:0002009, GO:0050793, GO:0032501, GO:0009987, GO:0009888, GO:0050794, GO:0044767, GO:0008360, GO:0044763, GO:0045995, GO:0040007, GO:0065008, GO:0044707, GO:0048856, GO:0007392, GO:0007391, GO:0050789, GO:2000026, GO:0008150
GO:0001934 [BP]	positive regulation of protein phosphorylation	probable	GO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F0A, chain B
Confidence level:very confident
Coverage over the Query: 97-141,154-202,215-244
View the alignment between query and template
View the model in PyMOL

Template: 4F0A, chain B
Confidence level:very confident
Coverage over the Query: 1-40,53-100,113-133
View the alignment between query and template
View the model in PyMOL