Diaphorina citri psyllid: psy12609


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MLNTIEIPFNIFPQEYSALFEGAGNDPGDKTLEDKFFEHEVRLNVYAFLQQFHFGVFYSYLKLKEQECRNIVWISECVAQKHRTKIDNYIPIF
cccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
***TIEIPFNIFPQEYSALFEGAG*****KTLEDKFFEHEVRLNVYAFLQQFHFGVFYSYLKLKEQECRNIVWISECVAQKHRTKIDNYIPIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNTIEIPFNIFPQEYSALFEGAGNDPGDKTLEDKFFEHEVRLNVYAFLQQFHFGVFYSYLKLKEQECRNIVWISECVAQKHRTKIDNYIPIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
V-type proton ATPase subunit d 1 Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.confidentQ9W4P5
V-type proton ATPase subunit d 1 Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis.confidentP51863
V-type proton ATPase subunit d 1 Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis.confidentQ5R6I1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partconfidentGO:0005575, GO:0005623
GO:0016020 [CC]membraneconfidentGO:0005575
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0043679 [CC]axon terminusprobableGO:0044306, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0008553 [MF]hydrogen-exporting ATPase activity, phosphorylative mechanismprobableGO:0003674, GO:0016887, GO:0042625, GO:0042626, GO:0016820, GO:0042623, GO:0015077, GO:0015399, GO:0022804, GO:0016787, GO:0005215, GO:0008324, GO:0017111, GO:0003824, GO:0022891, GO:0022890, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0019829, GO:0015075, GO:0016462, GO:0022857, GO:0015078, GO:0015662, GO:0015405
GO:0005769 [CC]early endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0016471 [CC]vacuolar proton-transporting V-type ATPase complexprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0005774, GO:0044437, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0033176, GO:0044424, GO:0044425, GO:0016469, GO:0044422
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0015991 [BP]ATP hydrolysis coupled proton transportprobableGO:0006818, GO:0015992, GO:0006812, GO:0006811, GO:0006810, GO:0015988, GO:0015672, GO:0034220, GO:0044765, GO:0044763, GO:0051179, GO:0008150, GO:0009987, GO:0051234, GO:0055085, GO:0044699
GO:0030670 [CC]phagocytic vesicle membraneprobableGO:0030139, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0030666, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030659, GO:0045335, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0033572 [BP]transferrin transportprobableGO:0045184, GO:0033036, GO:0000041, GO:0072512, GO:0006812, GO:0006811, GO:0006810, GO:0015682, GO:0044765, GO:0008104, GO:0006826, GO:0008150, GO:0071702, GO:0015031, GO:0030001, GO:0051234, GO:0051179, GO:0044699
GO:0010008 [CC]endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0008286 [BP]insulin receptor signaling pathwayprobableGO:0042221, GO:0007169, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0032869, GO:0032868, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:1901698, GO:0071417, GO:0071310, GO:0065007, GO:0071495, GO:0044700, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0010243, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0050896
GO:0006879 [BP]cellular iron ion homeostasisprobableGO:0019725, GO:0006875, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0055072, GO:0044763, GO:0008150, GO:0030003, GO:0055065, GO:0055080, GO:0065007, GO:0055082, GO:0065008, GO:0044699
GO:0046688 [BP]response to copper ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0051701 [BP]interaction with hostprobableGO:0044419, GO:0044403, GO:0008150, GO:0051704
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0007035 [BP]vacuolar acidificationprobableGO:0019725, GO:0042592, GO:0044699, GO:0045851, GO:0008150, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0055080, GO:0030004, GO:0065007, GO:0044763, GO:0055067, GO:0030003, GO:0051453, GO:0051452, GO:0055082, GO:0065008, GO:0030641
GO:0033181 [CC]plasma membrane proton-transporting V-type ATPase complexprobableGO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0016469, GO:0044459, GO:0033176
GO:0008593 [BP]regulation of Notch signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0032438 [BP]melanosome organizationprobableGO:0006996, GO:0043473, GO:0048753, GO:0071840, GO:0009987, GO:0016050, GO:0033059, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0033179 [CC]proton-transporting V-type ATPase, V0 domainprobableGO:0043234, GO:0032991, GO:0016020, GO:0005575, GO:0044425, GO:0016469, GO:0033176, GO:0033177
GO:0090382 [BP]phagosome maturationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0008057 [BP]eye pigment granule organizationprobableGO:0006996, GO:0043473, GO:0048753, GO:0071840, GO:0009987, GO:0016050, GO:0033059, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0006987 [BP]activation of signaling protein activity involved in unfolded protein responseprobableGO:0032069, GO:0048522, GO:0019220, GO:0080090, GO:0019222, GO:0033674, GO:0051246, GO:0031325, GO:0031323, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0050789, GO:0043085, GO:0009893, GO:0006984, GO:0051716, GO:0006986, GO:0051347, GO:0010604, GO:0051345, GO:0010562, GO:0043549, GO:0034976, GO:0051247, GO:0019219, GO:0071310, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0042325, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0032075, GO:0051174, GO:0006950, GO:0032268, GO:0044763, GO:0051171, GO:0007154, GO:0050794, GO:0010033, GO:0051336, GO:0044700, GO:0042327, GO:0045860, GO:0030968, GO:0050896, GO:0031401, GO:0051338, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0009987, GO:0001932, GO:0001934, GO:0034620
GO:0003406 [BP]retinal pigment epithelium developmentprobableGO:0032502, GO:0048856, GO:0044707, GO:0007423, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0048513, GO:0001654, GO:0060041, GO:0048731, GO:0008150, GO:0043010, GO:0007275, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V9M, chain A
Confidence level:confident
Coverage over the Query: 15-87
View the alignment between query and template
View the model in PyMOL