Diaphorina citri psyllid: psy12630

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MAVTGDSGDTVQFAEFIAKNIQLYKMRNGYELSPRAAAYYTRKQLAEYLRSRSPYNCNMLIAGHDPEEGPQLFFIDYLASLIEIPYITHGYPGIVTLSIMGEYHRSEVQKRLIINVPNFKVTMVSKDGIKHLPPIKAKNIPEENKGIPETEQYAAIPVAV
cccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEcccccCEEEEccccccccccEEEEcccHHHHHHHHHHHcHHHHHHHHHHccccEEEEEEcccccEEccccccccccccccccccccccccccccc
MAVTGDSGDTVQFAEFIAKNIQLYKMRNGYELSPRAAAYYTRKQLAEYLRSRSPYNCNMLIAGHDPEEGPQLFFIDYLASLIEIPYITHGYPGIVTLSIMGEYHRSEVQKRLIINVPNFKVTMVSKDGIKHLPPIKAKNI***************IP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVTGDSGDTVQFAEFIAKNIQLYKMRNGYELSPRAAAYYTRKQLAEYLRSRSPYNCNMLIAGHDPEEGPQLFFIDYLASLIEIPYITHGYPGIVTLSIMGEYHRSEVQKRLIINVPNFKVTMVSKDGIKHLPPIKAKNIPEENKGIPETEQYAAIPVAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proteasome subunit beta type-2 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a chymotrypsin-like activity.confidentQ9R1P3
Proteasome subunit beta type-2 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a chymotrypsin-like activity.confidentP40307
Proteasome subunit beta type-2-A The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentO23714

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005839 [CC]proteasome core complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000084 [BP]S phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010243 [BP]response to organic nitrogenprobableGO:0009719, GO:0050896, GO:1901698, GO:0008150, GO:0042221, GO:0010033
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0000209 [BP]protein polyubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0014070 [BP]response to organic cyclic compoundprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0032504 [BP]multicellular organism reproductionprobableGO:0032501, GO:0008150, GO:0000003
GO:0016071 [BP]mRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0000216 [BP]M/G1 transition of mitotic cell cycleprobable
GO:0031145 [BP]anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0006977 [BP]DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrestprobableGO:0051726, GO:0044699, GO:0010948, GO:0044773, GO:0044774, GO:0007165, GO:0035556, GO:0072331, GO:0050789, GO:0072401, GO:0090068, GO:0051716, GO:2000134, GO:0031570, GO:0031571, GO:0072395, GO:0010564, GO:0071158, GO:0065007, GO:1901988, GO:0048518, GO:0048519, GO:0071156, GO:1901990, GO:0030330, GO:0008150, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0044763, GO:0023052, GO:0007154, GO:0072413, GO:0042770, GO:0044700, GO:0007049, GO:0000077, GO:2000045, GO:0000075, GO:0072431, GO:0022402, GO:0072422, GO:0033554, GO:1901991, GO:0044783, GO:0007093, GO:0050896, GO:0048523, GO:0048522
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0051437 [BP]positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycleprobableGO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051439, GO:0051438, GO:0050789, GO:0007049, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044699, GO:0031398, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0043085, GO:0009987, GO:0000278, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0044763, GO:0032268, GO:0051443, GO:0022402, GO:0031401, GO:0051351, GO:0008150, GO:0044093, GO:0048522
GO:0051436 [BP]negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycleprobableGO:0009892, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0031399, GO:0022402, GO:0051438, GO:0043086, GO:0044699, GO:0051248, GO:0051340, GO:0010605, GO:0051246, GO:0050789, GO:0065007, GO:0007049, GO:0044092, GO:0031396, GO:0031397, GO:0065009, GO:0009987, GO:0000278, GO:0060255, GO:0051439, GO:0050790, GO:0050794, GO:0044763, GO:0048519, GO:0051444, GO:0032269, GO:0032268, GO:0031400, GO:0051352, GO:0008150, GO:0048523
GO:0006521 [BP]regulation of cellular amino acid metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0010565, GO:0050794, GO:0033238, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0002479 [BP]antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependentprobableGO:0002474, GO:0019882, GO:0019884, GO:0002478, GO:0002376, GO:0042590, GO:0008150, GO:0048002
GO:0010467 [BP]gene expressionprobableGO:0071704, GO:0008150, GO:0008152, GO:0043170
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0004298 [MF]threonine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0003824, GO:0070003, GO:0070011, GO:0003674, GO:0008233
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.25.-Threonine endopeptidases.probable
3.4.25.1Transferred entry: 3.4.25.1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RYP, chain K
Confidence level:very confident
Coverage over the Query: 1-136
View the alignment between query and template
View the model in PyMOL