Query         psy12639
Match_columns 134
No_of_seqs    129 out of 2037
Neff          10.9
Searched_HMMs 46136
Date          Fri Aug 16 15:44:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12639.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12639hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9   1E-26 2.2E-31  148.3   5.5  115    1-118   146-265 (279)
  2 KOG2462|consensus               99.9 9.3E-24   2E-28  134.9   4.6   89    1-92    177-265 (279)
  3 KOG3576|consensus               99.7 2.8E-18   6E-23  105.7   2.1  100   10-110   114-224 (267)
  4 KOG3623|consensus               99.7 1.3E-17 2.9E-22  118.7   2.0   80   11-91    892-971 (1007)
  5 KOG1074|consensus               99.7 1.4E-17 3.1E-22  119.8   1.7   77   42-118   605-690 (958)
  6 KOG1074|consensus               99.6 9.6E-17 2.1E-21  115.7   3.7   60   43-102   880-939 (958)
  7 KOG3576|consensus               99.6 1.8E-16   4E-21   97.7   1.4   95    1-96    133-238 (267)
  8 KOG3623|consensus               99.6   7E-16 1.5E-20  110.1   3.2  103   14-116   211-329 (1007)
  9 KOG3608|consensus               99.6 2.8E-15   6E-20   99.4   3.8  121    1-123   195-348 (467)
 10 KOG3608|consensus               99.5 2.4E-13 5.2E-18   90.4   6.5  118    1-121   253-377 (467)
 11 PHA00733 hypothetical protein   99.4 2.8E-13 6.1E-18   79.9   4.6   84   10-95     37-124 (128)
 12 PHA02768 hypothetical protein;  99.1   3E-11 6.6E-16   59.9   1.5   40   43-84      6-45  (55)
 13 PLN03086 PRLI-interacting fact  99.1 3.4E-10 7.3E-15   80.8   6.0  101    9-116   449-560 (567)
 14 PLN03086 PRLI-interacting fact  99.0 8.3E-10 1.8E-14   78.9   7.1   54   44-102   455-508 (567)
 15 PHA00733 hypothetical protein   99.0 8.1E-10 1.8E-14   65.2   4.7   57    8-67     68-124 (128)
 16 PHA02768 hypothetical protein;  99.0 2.7E-10 5.8E-15   56.5   1.7   43   13-58      5-47  (55)
 17 PF13465 zf-H2C2_2:  Zinc-finge  98.9 3.5E-10 7.5E-15   48.3   0.7   24    1-24      2-25  (26)
 18 PF13465 zf-H2C2_2:  Zinc-finge  98.9 9.6E-10 2.1E-14   46.9   1.7   24   58-81      2-25  (26)
 19 PHA00616 hypothetical protein   98.8 3.6E-09 7.9E-14   50.1   2.4   33   70-102     1-33  (44)
 20 KOG3993|consensus               98.7 6.1E-09 1.3E-13   71.2   1.5   82   14-96    268-382 (500)
 21 PHA00616 hypothetical protein   98.6 2.5E-08 5.5E-13   47.2   1.4   33   13-46      1-33  (44)
 22 PHA00732 hypothetical protein   98.5 1.3E-07 2.9E-12   51.1   3.0   47   13-65      1-47  (79)
 23 PHA00732 hypothetical protein   98.5 1.1E-07 2.3E-12   51.4   2.6   46   42-93      1-47  (79)
 24 PF05605 zf-Di19:  Drought indu  98.5 4.2E-07 9.1E-12   45.7   4.5   49   43-94      3-53  (54)
 25 PF05605 zf-Di19:  Drought indu  98.4 6.7E-07 1.4E-11   44.9   3.6   51   13-66      2-53  (54)
 26 PF00096 zf-C2H2:  Zinc finger,  98.3 5.1E-07 1.1E-11   37.1   1.7   22   71-92      1-22  (23)
 27 KOG3993|consensus               98.2 4.8E-07   1E-11   62.2   1.8   54   12-66    294-380 (500)
 28 PF12756 zf-C2H2_2:  C2H2 type   98.2 1.4E-06   3E-11   49.2   2.4   73   15-93      1-73  (100)
 29 COG5189 SFP1 Putative transcri  98.2 4.7E-07   1E-11   60.2   0.3   72   10-91    346-419 (423)
 30 PF13894 zf-C2H2_4:  C2H2-type   98.1 2.5E-06 5.5E-11   35.2   2.1   24   71-94      1-24  (24)
 31 PF13912 zf-C2H2_6:  C2H2-type   98.0 3.3E-06 7.2E-11   36.1   1.3   25   70-94      1-25  (27)
 32 PF00096 zf-C2H2:  Zinc finger,  98.0 5.7E-06 1.2E-10   33.9   1.8   22   14-35      1-22  (23)
 33 PF13894 zf-C2H2_4:  C2H2-type   97.8 1.6E-05 3.5E-10   32.6   1.7   22   14-35      1-22  (24)
 34 PF09237 GAGA:  GAGA factor;  I  97.8 2.8E-05 6.1E-10   37.8   2.6   33   66-98     20-52  (54)
 35 PF13912 zf-C2H2_6:  C2H2-type   97.7 2.5E-05 5.5E-10   33.2   1.7   23   13-35      1-23  (27)
 36 smart00355 ZnF_C2H2 zinc finge  97.6   9E-05   2E-09   30.8   2.3   24   71-94      1-24  (26)
 37 PF09237 GAGA:  GAGA factor;  I  97.3 0.00025 5.4E-09   34.5   2.1   34   37-70     19-52  (54)
 38 smart00355 ZnF_C2H2 zinc finge  97.1 0.00062 1.3E-08   28.1   2.3   20   15-34      2-21  (26)
 39 PF12874 zf-met:  Zinc-finger o  97.0 0.00037 8.1E-09   28.9   1.2   21   71-91      1-21  (25)
 40 PF12874 zf-met:  Zinc-finger o  97.0 0.00045 9.7E-09   28.7   1.4   22   14-35      1-22  (25)
 41 PRK04860 hypothetical protein;  97.0 0.00066 1.4E-08   41.8   2.4   38   42-83    119-156 (160)
 42 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00072 1.6E-08   27.8   1.8   23   71-94      1-23  (24)
 43 KOG4173|consensus               96.8   0.001 2.2E-08   42.0   2.1   77   14-94     80-170 (253)
 44 PF13913 zf-C2HC_2:  zinc-finge  96.7  0.0014 3.1E-08   27.3   1.8   21   71-92      3-23  (25)
 45 PF12171 zf-C2H2_jaz:  Zinc-fin  96.7  0.0004 8.8E-09   29.5  -0.1   22   71-92      2-23  (27)
 46 PRK04860 hypothetical protein;  96.7  0.0015 3.3E-08   40.2   2.3   38   13-55    119-156 (160)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.6 0.00084 1.8E-08   28.5   0.7   22   14-35      2-23  (27)
 48 PF13909 zf-H2C2_5:  C2H2-type   96.3  0.0048   1E-07   25.2   2.0   21   14-35      1-21  (24)
 49 COG4049 Uncharacterized protei  95.9  0.0048   1E-07   30.6   1.2   31    7-37     11-41  (65)
 50 smart00451 ZnF_U1 U1-like zinc  95.5    0.01 2.2E-07   26.6   1.5   22   70-91      3-24  (35)
 51 COG5189 SFP1 Putative transcri  95.3  0.0084 1.8E-07   40.6   1.2   49   68-116   347-418 (423)
 52 cd00350 rubredoxin_like Rubred  95.0   0.018   4E-07   25.6   1.6    9   69-77     16-24  (33)
 53 smart00451 ZnF_U1 U1-like zinc  95.0   0.021 4.5E-07   25.5   1.7   22   13-34      3-24  (35)
 54 KOG1146|consensus               94.9   0.014   3E-07   46.4   1.4   26   67-92    515-540 (1406)
 55 KOG1146|consensus               94.0    0.04 8.7E-07   44.0   2.2   57    8-64    460-540 (1406)
 56 PF12756 zf-C2H2_2:  C2H2 type   93.4   0.085 1.8E-06   29.3   2.4   25   41-65     49-73  (100)
 57 COG4049 Uncharacterized protei  93.4   0.061 1.3E-06   26.7   1.5   29   66-94     13-41  (65)
 58 COG2888 Predicted Zn-ribbon RN  93.0   0.088 1.9E-06   26.6   1.8   31   42-77     27-57  (61)
 59 COG5048 FOG: Zn-finger [Genera  93.0    0.02 4.3E-07   40.2  -0.8   61   42-102   289-355 (467)
 60 PF13719 zinc_ribbon_5:  zinc-r  92.7    0.15 3.3E-06   23.2   2.2   32   15-52      4-35  (37)
 61 KOG2231|consensus               92.6    0.21 4.6E-06   37.6   4.0   16   22-37    123-138 (669)
 62 COG5048 FOG: Zn-finger [Genera  92.6   0.039 8.4E-07   38.8   0.3   63   12-74    288-355 (467)
 63 TIGR02098 MJ0042_CXXC MJ0042 f  92.1    0.17 3.7E-06   23.0   2.0   33   14-52      3-35  (38)
 64 cd00729 rubredoxin_SM Rubredox  91.7    0.13 2.8E-06   23.0   1.3    9   43-51      3-11  (34)
 65 PF13717 zinc_ribbon_4:  zinc-r  91.3     0.3 6.5E-06   22.1   2.3   32   15-52      4-35  (36)
 66 COG1592 Rubrerythrin [Energy p  91.1    0.17 3.7E-06   31.4   1.8   23   42-77    134-156 (166)
 67 KOG2893|consensus               91.0   0.048   1E-06   35.6  -0.6   49   41-94     10-58  (341)
 68 KOG2186|consensus               90.9    0.16 3.5E-06   33.5   1.7   49   13-65      3-51  (276)
 69 TIGR00373 conserved hypothetic  90.9    0.19   4E-06   31.0   1.9   33   39-80    106-138 (158)
 70 COG5236 Uncharacterized conser  90.3    0.18 3.9E-06   34.8   1.6   23   14-36    152-176 (493)
 71 smart00531 TFIIE Transcription  89.7    0.25 5.5E-06   30.0   1.8   35   42-80     99-133 (147)
 72 PF09986 DUF2225:  Uncharacteri  89.5   0.085 1.8E-06   34.2  -0.4   23   11-33      3-25  (214)
 73 PRK06266 transcription initiat  89.5    0.27 5.8E-06   31.0   1.8   33   40-81    115-147 (178)
 74 TIGR00622 ssl1 transcription f  89.5    0.46   1E-05   27.5   2.6   78   12-93     14-104 (112)
 75 PRK14890 putative Zn-ribbon RN  88.9    0.34 7.4E-06   24.5   1.6   31   42-77     25-55  (59)
 76 TIGR00373 conserved hypothetic  88.3    0.68 1.5E-05   28.6   3.0   30   12-51    108-137 (158)
 77 PF12013 DUF3505:  Protein of u  87.7     1.7 3.8E-05   24.9   4.3   80   12-95     10-109 (109)
 78 PRK06266 transcription initiat  87.4    0.32 6.9E-06   30.7   1.2   16   70-85    117-132 (178)
 79 KOG2482|consensus               87.2    0.76 1.6E-05   31.9   2.9   22   14-35    196-217 (423)
 80 smart00734 ZnF_Rad18 Rad18-lik  86.3    0.93   2E-05   18.9   2.0   19   72-91      3-21  (26)
 81 PF09538 FYDLN_acid:  Protein o  86.2    0.54 1.2E-05   27.1   1.6   15   69-83     25-39  (108)
 82 PHA00626 hypothetical protein   85.8    0.45 9.7E-06   23.8   1.0   12   70-81     23-34  (59)
 83 PRK00464 nrdR transcriptional   85.5    0.19 4.1E-06   30.9  -0.6   16   42-57     28-43  (154)
 84 COG5236 Uncharacterized conser  85.2     3.1 6.8E-05   29.1   5.0   75   15-95    222-306 (493)
 85 smart00659 RPOLCX RNA polymera  85.2    0.75 1.6E-05   21.9   1.5   10   14-23      3-12  (44)
 86 KOG2893|consensus               84.4    0.29 6.2E-06   32.1  -0.1   45   12-62     10-54  (341)
 87 PF02892 zf-BED:  BED zinc fing  84.2       1 2.2E-05   21.2   1.8   26   67-92     13-42  (45)
 88 KOG2186|consensus               84.0    0.76 1.7E-05   30.5   1.7   50   43-95      4-53  (276)
 89 KOG2785|consensus               83.8     1.4 2.9E-05   31.1   2.9   49   44-92    168-242 (390)
 90 PF09723 Zn-ribbon_8:  Zinc rib  83.5    0.23   5E-06   23.3  -0.6   13   14-26      6-18  (42)
 91 TIGR02605 CxxC_CxxC_SSSS putat  83.5     0.4 8.6E-06   23.5   0.2   12   14-25      6-17  (52)
 92 smart00614 ZnF_BED BED zinc fi  83.0    0.93   2E-05   22.0   1.4   21   71-91     19-44  (50)
 93 KOG2231|consensus               82.8     2.4 5.2E-05   32.3   4.0   65   26-94    162-236 (669)
 94 smart00834 CxxC_CXXC_SSSS Puta  82.5    0.42 9.1E-06   22.0   0.1   11   14-24      6-16  (41)
 95 PRK00398 rpoP DNA-directed RNA  81.1    0.51 1.1E-05   22.5   0.1   11   13-23      3-13  (46)
 96 COG0068 HypF Hydrogenase matur  80.1    0.31 6.6E-06   37.0  -1.3   56   15-78    125-181 (750)
 97 PF04959 ARS2:  Arsenite-resist  79.7     1.1 2.5E-05   29.1   1.3   28   11-38     75-102 (214)
 98 KOG2807|consensus               79.4     3.2 6.9E-05   28.8   3.3   67   12-93    289-368 (378)
 99 PF12013 DUF3505:  Protein of u  78.5       2 4.3E-05   24.6   2.0   26   42-67     80-109 (109)
100 PF06524 NOA36:  NOA36 protein;  78.3       2 4.3E-05   28.8   2.1   76   10-86    139-225 (314)
101 COG1198 PriA Primosomal protei  76.4     1.5 3.2E-05   33.9   1.3   13   67-79    472-484 (730)
102 PF04959 ARS2:  Arsenite-resist  76.2     1.2 2.7E-05   28.9   0.7   26   70-95     77-102 (214)
103 KOG3408|consensus               76.2     2.1 4.5E-05   25.1   1.6   26   67-92     54-79  (129)
104 PF05443 ROS_MUCR:  ROS/MUCR tr  74.9     2.1 4.5E-05   25.7   1.4   25   68-95     70-94  (132)
105 KOG4173|consensus               74.8     1.3 2.7E-05   28.6   0.5   84   42-128    79-178 (253)
106 COG1997 RPL43A Ribosomal prote  73.9     1.7 3.6E-05   23.9   0.8   30   42-81     35-64  (89)
107 PRK09678 DNA-binding transcrip  73.8    0.95 2.1E-05   24.1  -0.2   12   43-54     28-41  (72)
108 KOG3408|consensus               73.6       3 6.4E-05   24.5   1.8   24   12-35     56-79  (129)
109 COG1996 RPC10 DNA-directed RNA  73.4     2.3 4.9E-05   20.8   1.1   10   14-23      7-16  (49)
110 KOG2482|consensus               72.7     7.6 0.00016   27.2   3.8   22   71-92    196-217 (423)
111 TIGR02300 FYDLN_acid conserved  72.1     3.1 6.8E-05   24.6   1.7   15   69-83     25-39  (129)
112 PF04780 DUF629:  Protein of un  71.2     2.6 5.7E-05   30.7   1.5   29   12-40     56-84  (466)
113 PF10013 DUF2256:  Uncharacteri  69.4       3 6.6E-05   19.6   1.0   16   72-87     10-25  (42)
114 KOG2593|consensus               69.0       4 8.6E-05   29.4   1.9   38   11-52    126-163 (436)
115 PF10571 UPF0547:  Uncharacteri  68.8     2.2 4.8E-05   17.8   0.4    9   72-80     16-24  (26)
116 KOG2785|consensus               68.7     6.4 0.00014   27.9   2.8   53   12-64    165-242 (390)
117 PF12907 zf-met2:  Zinc-binding  68.6     4.1   9E-05   18.9   1.4   27   14-40      2-31  (40)
118 PF08274 PhnA_Zn_Ribbon:  PhnA   67.2     2.6 5.6E-05   18.3   0.5    7   43-49     20-26  (30)
119 PF00301 Rubredoxin:  Rubredoxi  64.7       3 6.5E-05   20.1   0.5   12   14-25      2-13  (47)
120 KOG4167|consensus               64.5     1.9 4.2E-05   33.1  -0.3   27   12-39    791-817 (907)
121 PF15269 zf-C2H2_7:  Zinc-finge  64.2     4.9 0.00011   19.1   1.2   22   14-35     21-42  (54)
122 KOG4167|consensus               64.1     2.5 5.4E-05   32.5   0.2   25   70-94    792-816 (907)
123 PF07754 DUF1610:  Domain of un  64.1       4 8.8E-05   16.7   0.8    8   42-49     16-23  (24)
124 PF03604 DNA_RNApol_7kD:  DNA d  63.5     7.9 0.00017   17.0   1.7    7   71-77     18-24  (32)
125 PF13451 zf-trcl:  Probable zin  62.7     5.5 0.00012   19.4   1.2   14   42-55      4-17  (49)
126 KOG1280|consensus               62.7     8.6 0.00019   27.0   2.5   26   13-38     79-104 (381)
127 TIGR00100 hypA hydrogenase nic  62.2     4.6  0.0001   23.5   1.1   12   43-54     71-82  (115)
128 PRK03824 hypA hydrogenase nick  61.3     3.8 8.3E-05   24.6   0.6   13   42-54     70-82  (135)
129 KOG2907|consensus               60.8     3.6 7.9E-05   23.8   0.5   38   43-82     75-114 (116)
130 smart00440 ZnF_C2C2 C2C2 Zinc   60.5    0.83 1.8E-05   21.2  -1.8    8   43-50     29-36  (40)
131 PF07975 C1_4:  TFIIH C1-like d  59.7     2.9 6.2E-05   20.6  -0.1   20   42-61     21-40  (51)
132 KOG1842|consensus               59.1     7.3 0.00016   28.3   1.8   27   70-96     15-41  (505)
133 PF12760 Zn_Tnp_IS1595:  Transp  58.2     9.8 0.00021   18.0   1.7    9   43-51     19-27  (46)
134 TIGR01206 lysW lysine biosynth  58.0     5.4 0.00012   19.9   0.7    9   44-52      4-12  (54)
135 PRK12380 hydrogenase nickel in  57.7     6.4 0.00014   22.9   1.1   10   43-52     71-80  (113)
136 COG1655 Uncharacterized protei  57.3     2.9 6.2E-05   27.5  -0.4    8   71-78     63-70  (267)
137 PLN03238 probable histone acet  56.8      13 0.00028   25.4   2.6   30   67-96     45-74  (290)
138 PF13824 zf-Mss51:  Zinc-finger  56.6     9.7 0.00021   19.1   1.5   10   69-78     13-22  (55)
139 COG5112 UFD2 U1-like Zn-finger  56.6     7.4 0.00016   22.3   1.2   24   68-91     53-76  (126)
140 PF07282 OrfB_Zn_ribbon:  Putat  56.3       9  0.0002   19.7   1.5   15   67-81     43-57  (69)
141 PF02176 zf-TRAF:  TRAF-type zi  55.3      14 0.00029   18.3   2.0   34   12-47      8-43  (60)
142 KOG0978|consensus               55.2     4.9 0.00011   30.9   0.4   19   67-85    675-693 (698)
143 smart00154 ZnF_AN1 AN1-like Zi  54.4       7 0.00015   17.9   0.8   14   13-26     12-25  (39)
144 PTZ00255 60S ribosomal protein  54.2     6.9 0.00015   21.8   0.8   13   70-82     54-66  (90)
145 COG1675 TFA1 Transcription ini  54.2      11 0.00024   23.8   1.9   32   39-79    110-141 (176)
146 KOG0717|consensus               52.5       8 0.00017   28.3   1.1   28   71-98    461-489 (508)
147 COG5151 SSL1 RNA polymerase II  52.4      15 0.00032   25.5   2.3   77   13-93    322-411 (421)
148 PRK00564 hypA hydrogenase nick  52.2     8.5 0.00018   22.5   1.1   10   43-52     72-81  (117)
149 PF06220 zf-U1:  U1 zinc finger  52.1      15 0.00032   16.8   1.6   21   70-90      3-25  (38)
150 COG4338 Uncharacterized protei  52.1     6.1 0.00013   19.1   0.4   15   72-86     14-28  (54)
151 PF04423 Rad50_zn_hook:  Rad50   51.6     5.1 0.00011   19.7   0.1   12   72-83     22-33  (54)
152 TIGR00595 priA primosomal prot  50.7       8 0.00017   28.7   1.0    9   70-78    253-261 (505)
153 KOG4727|consensus               50.0     8.8 0.00019   24.1   0.9   21   14-34     76-96  (193)
154 PLN02294 cytochrome c oxidase   49.9     8.7 0.00019   24.1   0.9   14   12-25    140-153 (174)
155 TIGR00280 L37a ribosomal prote  49.8     8.4 0.00018   21.5   0.7   12   70-81     53-64  (91)
156 PRK14873 primosome assembly pr  49.6     8.3 0.00018   29.7   0.9    9   70-78    422-430 (665)
157 PF05191 ADK_lid:  Adenylate ki  48.6     5.3 0.00012   18.0  -0.1   10   15-24      3-12  (36)
158 PF01428 zf-AN1:  AN1-like Zinc  47.6     6.8 0.00015   18.3   0.1   16   12-27     12-27  (43)
159 PF10537 WAC_Acf1_DNA_bd:  ATP-  47.3      32  0.0007   19.6   2.9   41   12-54      2-42  (102)
160 cd00924 Cyt_c_Oxidase_Vb Cytoc  46.9     9.5 0.00021   21.6   0.7   21   60-81     70-90  (97)
161 KOG1842|consensus               46.7      13 0.00027   27.2   1.4   27   13-39     15-41  (505)
162 PF01155 HypA:  Hydrogenase exp  46.6     9.4  0.0002   22.1   0.7   12   14-25     71-82  (113)
163 PF07800 DUF1644:  Protein of u  46.4      72  0.0016   19.9   5.4   52   42-95     80-133 (162)
164 PLN00104 MYST -like histone ac  45.7      18  0.0004   26.5   2.1   29   68-96    196-224 (450)
165 smart00661 RPOL9 RNA polymeras  45.3      15 0.00032   17.6   1.2    7   71-77     21-27  (52)
166 PF04780 DUF629:  Protein of un  45.2      18 0.00038   26.7   1.9   32   65-96     52-83  (466)
167 PRK03681 hypA hydrogenase nick  44.7     9.3  0.0002   22.2   0.4   10   43-52     71-80  (114)
168 COG1571 Predicted DNA-binding   44.7      15 0.00033   26.6   1.6   14   70-83    367-380 (421)
169 PF01780 Ribosomal_L37ae:  Ribo  44.1     8.4 0.00018   21.5   0.2   30   42-81     35-64  (90)
170 PRK00432 30S ribosomal protein  44.1      13 0.00028   18.2   0.8    9   70-78     37-45  (50)
171 COG3091 SprT Zn-dependent meta  43.8      14  0.0003   22.8   1.0   34   41-79    116-149 (156)
172 KOG4602|consensus               43.7     9.1  0.0002   25.7   0.3   38   42-79    233-277 (318)
173 COG2331 Uncharacterized protei  43.6      16 0.00035   19.6   1.2    9   14-22     13-21  (82)
174 KOG0782|consensus               43.4     3.2   7E-05   31.1  -1.9   50   28-84    240-290 (1004)
175 PRK03976 rpl37ae 50S ribosomal  43.2      12 0.00025   20.9   0.7   12   70-81     54-65  (90)
176 PF10276 zf-CHCC:  Zinc-finger   42.9     9.5 0.00021   17.7   0.2   11   13-23     29-39  (40)
177 PTZ00064 histone acetyltransfe  42.8      24 0.00052   26.3   2.3   29   68-96    278-306 (552)
178 COG3357 Predicted transcriptio  42.6     9.8 0.00021   21.2   0.3   29   12-51     57-85  (97)
179 PF05495 zf-CHY:  CHY zinc fing  42.5     3.3 7.1E-05   21.9  -1.5   58   14-80     11-71  (71)
180 PF02591 DUF164:  Putative zinc  42.3      21 0.00047   17.6   1.5   32   44-79     24-55  (56)
181 COG4888 Uncharacterized Zn rib  42.2     3.4 7.4E-05   23.4  -1.5    8   14-21     23-30  (104)
182 PHA02998 RNA polymerase subuni  41.6     4.4 9.5E-05   25.6  -1.3   38   43-83    144-184 (195)
183 PTZ00448 hypothetical protein;  41.0      18  0.0004   25.7   1.5   24   13-36    314-337 (373)
184 PF13878 zf-C2H2_3:  zinc-finge  40.7      23 0.00049   16.4   1.4   21   14-34     14-36  (41)
185 PF04810 zf-Sec23_Sec24:  Sec23  40.6     5.2 0.00011   18.4  -0.9   10   41-50     23-32  (40)
186 KOG2636|consensus               40.5      26 0.00055   25.7   2.1   58   63-120   394-456 (497)
187 COG4957 Predicted transcriptio  40.0      17 0.00038   21.9   1.1   22   43-67     77-98  (148)
188 PRK00762 hypA hydrogenase nick  39.9      15 0.00032   21.8   0.8   10   43-53     71-80  (124)
189 KOG1280|consensus               39.7      29 0.00062   24.6   2.2   29   70-98     79-107 (381)
190 PF15135 UPF0515:  Uncharacteri  39.5      32 0.00069   23.2   2.3   11   12-22    111-121 (278)
191 PF14353 CpXC:  CpXC protein     38.7       5 0.00011   23.7  -1.3   23   12-34     37-59  (128)
192 COG5188 PRP9 Splicing factor 3  38.0      19 0.00042   25.4   1.2   23   69-91    237-259 (470)
193 cd00065 FYVE FYVE domain; Zinc  37.4      27 0.00058   17.0   1.4    9   44-52     20-28  (57)
194 COG5216 Uncharacterized conser  37.4      18 0.00038   18.4   0.7   30   43-78     23-52  (67)
195 KOG0717|consensus               37.3      17 0.00036   26.7   0.8   21   71-91    293-313 (508)
196 PF08790 zf-LYAR:  LYAR-type C2  37.0     9.8 0.00021   16.2  -0.2    6   18-23      5-10  (28)
197 COG1594 RPB9 DNA-directed RNA   36.8       7 0.00015   22.7  -0.9   37   43-81     73-111 (113)
198 PF01363 FYVE:  FYVE zinc finge  36.3      22 0.00049   18.2   1.1   10   15-24     11-20  (69)
199 PRK04023 DNA polymerase II lar  35.5      30 0.00065   28.2   2.0   10   13-22    626-635 (1121)
200 PRK05978 hypothetical protein;  34.9      16 0.00035   22.4   0.4   30   43-81     34-63  (148)
201 TIGR00627 tfb4 transcription f  34.3      33 0.00071   23.5   1.8   10   71-80    256-265 (279)
202 smart00064 FYVE Protein presen  34.3      29 0.00062   17.7   1.3    8   16-23     13-20  (68)
203 KOG2071|consensus               34.2      27 0.00058   26.5   1.5   28   67-94    415-442 (579)
204 PF11672 DUF3268:  Protein of u  33.6      25 0.00053   20.2   1.0   13   12-24      1-13  (102)
205 PF13821 DUF4187:  Domain of un  33.6      21 0.00045   17.8   0.6   20   12-31     26-45  (55)
206 PF13453 zf-TFIIB:  Transcripti  33.5      23  0.0005   16.2   0.8   18   42-59     19-36  (41)
207 COG4896 Uncharacterized protei  33.4      53  0.0011   16.9   2.0   38   44-81      4-42  (68)
208 PF09845 DUF2072:  Zn-ribbon co  33.4      19 0.00041   21.6   0.5   15   13-27      1-15  (131)
209 COG3677 Transposase and inacti  32.4      22 0.00047   21.3   0.7   36   43-83     31-66  (129)
210 KOG2747|consensus               32.2      35 0.00077   24.6   1.8   29   68-96    156-184 (396)
211 PF09963 DUF2197:  Uncharacteri  32.2      17 0.00037   18.3   0.2    8   71-78     32-39  (56)
212 PF08209 Sgf11:  Sgf11 (transcr  32.1      42 0.00092   14.8   1.4   21   71-92      5-25  (33)
213 smart00731 SprT SprT homologue  32.0      26 0.00056   21.2   1.0   32   42-80    112-143 (146)
214 PF03811 Zn_Tnp_IS1:  InsA N-te  31.7      12 0.00027   16.9  -0.3    7   42-48     29-35  (36)
215 PLN02748 tRNA dimethylallyltra  31.0      37 0.00079   25.2   1.7   24   68-91    416-440 (468)
216 KOG4124|consensus               30.3     9.2  0.0002   26.9  -1.2   69   11-89    347-417 (442)
217 PF03966 Trm112p:  Trm112p-like  29.7      20 0.00044   18.5   0.2   17    8-24     48-64  (68)
218 PF04606 Ogr_Delta:  Ogr/Delta-  29.5      12 0.00027   17.8  -0.6    9   16-24      2-10  (47)
219 PTZ00448 hypothetical protein;  29.4      43 0.00093   23.9   1.8   24   70-93    314-337 (373)
220 PF10263 SprT-like:  SprT-like   29.1      17 0.00036   22.1  -0.2   10   71-80    144-153 (157)
221 COG3364 Zn-ribbon containing p  28.6      26 0.00056   20.0   0.5   14   70-83      2-15  (112)
222 PF06397 Desulfoferrod_N:  Desu  28.2      29 0.00062   15.7   0.5   12   12-23      5-16  (36)
223 PF14311 DUF4379:  Domain of un  27.9      56  0.0012   16.0   1.6    9   43-51     29-37  (55)
224 PF14803 Nudix_N_2:  Nudix N-te  27.8     8.7 0.00019   17.1  -1.2    8   43-50     23-30  (34)
225 PF10083 DUF2321:  Uncharacteri  27.7      18 0.00039   22.4  -0.2   20   67-86     65-84  (158)
226 COG0675 Transposase and inacti  27.5      35 0.00075   23.4   1.1   16   68-83    320-335 (364)
227 PTZ00043 cytochrome c oxidase   27.3      30 0.00065   22.9   0.7   16   11-26    179-194 (268)
228 PRK04351 hypothetical protein;  27.1      37  0.0008   20.8   1.1   32   42-81    112-143 (149)
229 PF01215 COX5B:  Cytochrome c o  27.1      20 0.00043   21.7  -0.1   19   62-81    105-123 (136)
230 PLN03239 histone acetyltransfe  26.7      66  0.0014   22.9   2.3   25   68-92    104-128 (351)
231 smart00249 PHD PHD zinc finger  26.4      54  0.0012   14.6   1.4   10   43-52     15-24  (47)
232 TIGR00244 transcriptional regu  26.3      26 0.00056   21.5   0.3   18   69-86     27-44  (147)
233 PF07503 zf-HYPF:  HypF finger;  26.1      14 0.00031   16.6  -0.6   10   43-52     22-31  (35)
234 COG1773 Rubredoxin [Energy pro  26.1      29 0.00063   17.4   0.4   13   13-25      3-15  (55)
235 PF07295 DUF1451:  Protein of u  26.0      20 0.00044   21.9  -0.2   11   41-51    111-121 (146)
236 cd00730 rubredoxin Rubredoxin;  25.7      26 0.00056   17.1   0.2   13   71-83      2-14  (50)
237 TIGR00686 phnA alkylphosphonat  25.4      39 0.00084   19.6   0.9   10   43-52     20-29  (109)
238 PF14787 zf-CCHC_5:  GAG-polypr  25.3      18  0.0004   16.4  -0.4   14   72-85      4-17  (36)
239 PRK05452 anaerobic nitric oxid  25.3      27 0.00058   25.9   0.3   15   41-55    424-438 (479)
240 PF07911 DUF1677:  Protein of u  25.2 1.4E+02   0.003   16.8   3.5   65   14-97      5-69  (91)
241 KOG2923|consensus               24.6      55  0.0012   17.0   1.2   13   66-78     40-52  (67)
242 KOG3352|consensus               24.5      35 0.00076   21.0   0.6   14   68-81    131-144 (153)
243 PF14447 Prok-RING_4:  Prokaryo  24.4      35 0.00076   17.1   0.5   12   71-82     40-51  (55)
244 PF14255 Cys_rich_CPXG:  Cystei  24.3      30 0.00065   17.1   0.3   10   72-81      2-11  (52)
245 PF04438 zf-HIT:  HIT zinc fing  24.2      64  0.0014   13.8   1.3   16   12-27     12-27  (30)
246 PF11931 DUF3449:  Domain of un  23.5      27 0.00058   22.6   0.0   26   65-90     96-122 (196)
247 CHL00174 accD acetyl-CoA carbo  23.3      40 0.00086   23.4   0.8   33   43-84     39-71  (296)
248 PRK12722 transcriptional activ  23.1      62  0.0013   20.8   1.6   10   44-53    136-145 (187)
249 PF01286 XPA_N:  XPA protein N-  22.8      25 0.00054   15.7  -0.2   12   72-83      5-16  (34)
250 KOG1994|consensus               22.7      47   0.001   22.1   0.9   24   40-63    237-260 (268)
251 PRK01343 zinc-binding protein;  22.6      41 0.00089   17.0   0.6   12   70-81      9-20  (57)
252 KOG2071|consensus               22.5      62  0.0013   24.7   1.6   27    9-35    414-440 (579)
253 PRK12860 transcriptional activ  22.5      65  0.0014   20.8   1.5   10   44-53    136-145 (189)
254 COG1579 Zn-ribbon protein, pos  22.3      80  0.0017   21.2   2.0   36   43-82    198-233 (239)
255 PRK14892 putative transcriptio  22.3      34 0.00073   19.5   0.2    7   43-49     22-28  (99)
256 COG4391 Uncharacterized protei  22.2      32  0.0007   17.6   0.1   11   71-81     49-59  (62)
257 TIGR00515 accD acetyl-CoA carb  22.2      43 0.00094   23.0   0.8   14   70-83     45-58  (285)
258 PF08792 A2L_zn_ribbon:  A2L zi  21.8      34 0.00074   15.1   0.2   10   71-80     22-31  (33)
259 PF02891 zf-MIZ:  MIZ/SP-RING z  21.7      46 0.00099   16.1   0.6    8   71-78     42-49  (50)
260 COG1327 Predicted transcriptio  21.7      36 0.00078   21.0   0.3   16   70-85     28-43  (156)
261 PF14369 zf-RING_3:  zinc-finge  21.5      32 0.00069   15.3   0.0   10   44-53     23-32  (35)
262 COG1779 C4-type Zn-finger prot  21.4      26 0.00057   22.6  -0.3   35   14-54     15-55  (201)
263 TIGR03831 YgiT_finger YgiT-typ  21.0      44 0.00096   15.3   0.5   14   41-54     31-44  (46)
264 PF14690 zf-ISL3:  zinc-finger   21.0      45 0.00097   15.5   0.5    8   13-20      2-9   (47)
265 PF11494 Ta0938:  Ta0938;  Inte  20.5      31 0.00068   19.5  -0.1   13   12-24     13-25  (105)
266 PRK08222 hydrogenase 4 subunit  20.4      71  0.0015   20.2   1.5   22   68-89    112-133 (181)
267 PF01927 Mut7-C:  Mut7-C RNAse   20.4      89  0.0019   19.0   1.8   46   14-59     92-141 (147)
268 PF11789 zf-Nse:  Zinc-finger o  20.2      88  0.0019   15.6   1.5   13   42-54     24-36  (57)
269 COG4306 Uncharacterized protei  20.1      42  0.0009   20.0   0.3   15   69-83     67-81  (160)

No 1  
>KOG2462|consensus
Probab=99.93  E-value=1e-26  Score=148.32  Aligned_cols=115  Identities=23%  Similarity=0.460  Sum_probs=105.3

Q ss_pred             ChhHhhhccC---CCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccc
Q psy12639          1 MESHLMLHTG---AKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCT   77 (134)
Q Consensus         1 l~~h~~~h~~---~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~   77 (134)
                      |.+|.++|..   .+-+.|+.|++.|.+...|..|+++ |+  .++.|.+||+.|...=.|+.|+|+|+|+|||.|+.|+
T Consensus       146 LsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirT-H~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~  222 (279)
T KOG2462|consen  146 LSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRT-HT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCG  222 (279)
T ss_pred             cchhhcccccccccccccCCCCCceeeehHHHhhHhhc-cC--CCcccccccccccchHHhhcccccccCCCCccCCccc
Confidence            5677777763   4668999999999999999999997 76  4789999999999999999999999999999999999


Q ss_pred             hhhcCHHHHHHHHHhhcCCCCCCCC--CCCcccchhhhhhhhh
Q psy12639         78 VRYLRSYELVLHLKKCHREDARNPY--APAFVDVNTVAQVKQE  118 (134)
Q Consensus        78 ~~f~~~~~l~~H~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~  118 (134)
                      |+|..+++|+.|+++|.+.+.|.|.  ++.|....-|.+|...
T Consensus       223 kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  223 KAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             chhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999999999999999999999  8899999999998754


No 2  
>KOG2462|consensus
Probab=99.89  E-value=9.3e-24  Score=134.91  Aligned_cols=89  Identities=27%  Similarity=0.512  Sum_probs=84.4

Q ss_pred             ChhHhhhccCCCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhh
Q psy12639          1 MESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRY   80 (134)
Q Consensus         1 l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f   80 (134)
                      |+-|+++|.  -+++|.+||+.|...=-|+-|+++ |+|++||.|+.|++.|..+++|..|+++|.+.++|+|..|+|.|
T Consensus       177 LkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRT-HTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsF  253 (279)
T KOG2462|consen  177 LKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRT-HTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSF  253 (279)
T ss_pred             HhhHhhccC--CCcccccccccccchHHhhccccc-ccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHH
Confidence            567888886  589999999999999999999998 99999999999999999999999999999999999999999999


Q ss_pred             cCHHHHHHHHHh
Q psy12639         81 LRSYELVLHLKK   92 (134)
Q Consensus        81 ~~~~~l~~H~~~   92 (134)
                      ...+-|.+|...
T Consensus       254 sl~SyLnKH~ES  265 (279)
T KOG2462|consen  254 ALKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHHhhhh
Confidence            999999999875


No 3  
>KOG3576|consensus
Probab=99.71  E-value=2.8e-18  Score=105.70  Aligned_cols=100  Identities=27%  Similarity=0.496  Sum_probs=88.3

Q ss_pred             CCCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHH
Q psy12639         10 GAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLH   89 (134)
Q Consensus        10 ~~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H   89 (134)
                      +...|.|.+|++.|....-|.+|++- |...+.+.|..||++|...-.|.+|+++|+|.+||.|..|+++|+++-.|..|
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kc-h~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKC-HSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhh-ccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHH
Confidence            34559999999999999999999997 88888999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcC-----------CCCCCCCCCCcccch
Q psy12639         90 LKKCHR-----------EDARNPYAPAFVDVN  110 (134)
Q Consensus        90 ~~~~~~-----------~~~~~~~~~~~~~~~  110 (134)
                      ++.-|+           ++.|.|..+++.+..
T Consensus       193 l~kvhgv~~~yaykerr~kl~vcedcg~t~~~  224 (267)
T KOG3576|consen  193 LKKVHGVQHQYAYKERRAKLYVCEDCGYTSER  224 (267)
T ss_pred             HHHHcCchHHHHHHHhhhheeeecccCCCCCC
Confidence            986553           466778866665543


No 4  
>KOG3623|consensus
Probab=99.67  E-value=1.3e-17  Score=118.70  Aligned_cols=80  Identities=35%  Similarity=0.718  Sum_probs=76.6

Q ss_pred             CCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHHH
Q psy12639         11 AKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHL   90 (134)
Q Consensus        11 ~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~   90 (134)
                      ..+|.|..|++.|.-.++|.+|..- |+|++||.|.+|.+.|..+-.|..|.|.|.|+|||+|+.|+|.|+.+....+||
T Consensus       892 ~gmyaCDqCDK~FqKqSSLaRHKYE-HsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  892 DGMYACDQCDKAFQKQSSLARHKYE-HSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             cccchHHHHHHHHHhhHHHHHhhhh-hcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchHhhh
Confidence            4679999999999999999999875 999999999999999999999999999999999999999999999999999998


Q ss_pred             H
Q psy12639         91 K   91 (134)
Q Consensus        91 ~   91 (134)
                      -
T Consensus       971 N  971 (1007)
T KOG3623|consen  971 N  971 (1007)
T ss_pred             c
Confidence            5


No 5  
>KOG1074|consensus
Probab=99.67  E-value=1.4e-17  Score=119.84  Aligned_cols=77  Identities=26%  Similarity=0.458  Sum_probs=63.2

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHHHHhhcCC----CCCCCC-----CCCcccchhh
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHRE----DARNPY-----APAFVDVNTV  112 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~----~~~~~~-----~~~~~~~~~~  112 (134)
                      |..|.+|.+...-.+.|+.|.++|+|++||+|.+||++|+++.+|+.|+-.|...    ..++|+     .+.|.....+
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            4689999999999999999999999999999999999999999999999988654    334555     4456666666


Q ss_pred             hhhhhh
Q psy12639        113 AQVKQE  118 (134)
Q Consensus       113 ~~~~~~  118 (134)
                      ..|+..
T Consensus       685 pQhIri  690 (958)
T KOG1074|consen  685 PQHIRI  690 (958)
T ss_pred             cceEEe
Confidence            665543


No 6  
>KOG1074|consensus
Probab=99.65  E-value=9.6e-17  Score=115.67  Aligned_cols=60  Identities=25%  Similarity=0.521  Sum_probs=43.8

Q ss_pred             eecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHHHHhhcCCCCCCCC
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPY  102 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~  102 (134)
                      ..|.+|++.|...+.|+.|+++|.+++||.|.+|++.|....+|+.||.+|.+..+..-.
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~srr  939 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPSRR  939 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCccC
Confidence            357777777777777777777777777777777777777777777777777766554433


No 7  
>KOG3576|consensus
Probab=99.60  E-value=1.8e-16  Score=97.74  Aligned_cols=95  Identities=33%  Similarity=0.519  Sum_probs=86.0

Q ss_pred             ChhHhhhccCCCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcC-----------CC
Q psy12639          1 MESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTG-----------EK   69 (134)
Q Consensus         1 l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~-----------~~   69 (134)
                      |.+|+.-|...+-+.|..||+.|...-+|.+|+++ |+|.+||.|..|++.|.....|..|.+.-+|           ++
T Consensus       133 lnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rt-htgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~k  211 (267)
T KOG3576|consen  133 LNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRT-HTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAK  211 (267)
T ss_pred             HHHHhhhccHHHHHHHhhccCcccchhhhhhhhcc-ccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhh
Confidence            56888899888899999999999999999999997 9999999999999999999999999886443           46


Q ss_pred             CcccCccchhhcCHHHHHHHHHhhcCC
Q psy12639         70 PYACNLCTVRYLRSYELVLHLKKCHRE   96 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~l~~H~~~~~~~   96 (134)
                      .|.|..||..-.....+-.|++.++..
T Consensus       212 l~vcedcg~t~~~~e~~~~h~~~~hp~  238 (267)
T KOG3576|consen  212 LYVCEDCGYTSERPEVYYLHLKLHHPF  238 (267)
T ss_pred             eeeecccCCCCCChhHHHHHHHhcCCC
Confidence            699999999999999999999988753


No 8  
>KOG3623|consensus
Probab=99.59  E-value=7e-16  Score=110.13  Aligned_cols=103  Identities=20%  Similarity=0.400  Sum_probs=87.8

Q ss_pred             eeCccchhhccChHHHHHHHhcccc-CCCceecCCCCCccCChhhHHhHHhhhcC-------------CCCcccCccchh
Q psy12639         14 YACTECDQKFNRNSKLKIHYNLAHC-TGEMYECCHCARSFPCKSYLIPHLRVHTG-------------EKPYACNLCTVR   79 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~~h~-~~~~~~C~~C~~~~~~~~~l~~h~~~h~~-------------~~~~~C~~C~~~   79 (134)
                      ..|+.|.+.+.....|+.|++..|. .+.-|.|..|..+|.....|.+|+..|..             .+.|+|++|||+
T Consensus       211 ltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKA  290 (1007)
T KOG3623|consen  211 LTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKA  290 (1007)
T ss_pred             hcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchh
Confidence            6899999999999999999986554 34458899999999999999999988852             355999999999


Q ss_pred             hcCHHHHHHHHHhhcCCCCCCCC--CCCcccchhhhhhh
Q psy12639         80 YLRSYELVLHLKKCHREDARNPY--APAFVDVNTVAQVK  116 (134)
Q Consensus        80 f~~~~~l~~H~~~~~~~~~~~~~--~~~~~~~~~~~~~~  116 (134)
                      |.....|+.|+|+|.||+||.|+  ++.|.-.-+...|.
T Consensus       291 FKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHm  329 (1007)
T KOG3623|consen  291 FKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHM  329 (1007)
T ss_pred             hhhHHHHHhhheeecCCCCcCCcccccccccCCcccccc
Confidence            99999999999999999999999  67887777766665


No 9  
>KOG3608|consensus
Probab=99.56  E-value=2.8e-15  Score=99.40  Aligned_cols=121  Identities=23%  Similarity=0.417  Sum_probs=85.0

Q ss_pred             ChhHhhhccCCCceeCccchhhccChHHHHHHHhcccc--CCCc--------------------------eecCCCCCcc
Q psy12639          1 MESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHC--TGEM--------------------------YECCHCARSF   52 (134)
Q Consensus         1 l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~h~--~~~~--------------------------~~C~~C~~~~   52 (134)
                      |..|++.|.++|...|+.||.-|.....|.+|++- .+  ...+                          |.|+.|.-+.
T Consensus       195 LreH~r~Hs~eKvvACp~Cg~~F~~~tkl~DH~rR-qt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHvn~ykCplCdmtc  273 (467)
T KOG3608|consen  195 LREHIRTHSNEKVVACPHCGELFRTKTKLFDHLRR-QTELNTNSFQCAQCFKRFATEKLLKSHVVRHVNCYKCPLCDMTC  273 (467)
T ss_pred             HHHHHHhcCCCeEEecchHHHHhccccHHHHHHHh-hhhhcCCchHHHHHHHHHhHHHHHHHHHHHhhhcccccccccCC
Confidence            56899999999999999999999999999999863 22  1223                          5566666666


Q ss_pred             CChhhHHhHHhh-hcCCCCcccCccchhhcCHHHHHHHHHhhcCCCCCCCC----CCCcccchhhhhhhhhhhcCC
Q psy12639         53 PCKSYLIPHLRV-HTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPY----APAFVDVNTVAQVKQEYEELP  123 (134)
Q Consensus        53 ~~~~~l~~h~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~  123 (134)
                      ...+.|..|++. |..++||+|+.|.+.|.+.+.|.+|...|. +-.|.|.    ...+....++..|..+.++..
T Consensus       274 ~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~  348 (467)
T KOG3608|consen  274 SSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGN  348 (467)
T ss_pred             CChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCC
Confidence            666666666664 666777777777777777777777777665 5566666    234555556666666655433


No 10 
>KOG3608|consensus
Probab=99.45  E-value=2.4e-13  Score=90.36  Aligned_cols=118  Identities=20%  Similarity=0.366  Sum_probs=94.4

Q ss_pred             ChhHhhhccCCCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCc--cch
Q psy12639          1 MESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNL--CTV   78 (134)
Q Consensus         1 l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~--C~~   78 (134)
                      |+.|++.|  ...|+|+.|+.+....++|..|++..|...+||.|..|...+...+.|..|...|. +..|.|..  |..
T Consensus       253 L~~Hv~rH--vn~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~  329 (467)
T KOG3608|consen  253 LKSHVVRH--VNCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHY  329 (467)
T ss_pred             HHHHHHHh--hhcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcH
Confidence            45666665  34689999999999999999999988999999999999999999999999998887 66788877  888


Q ss_pred             hhcCHHHHHHHHHhhc-CC--CCCCCC--CCCcccchhhhhhhhhhhc
Q psy12639         79 RYLRSYELVLHLKKCH-RE--DARNPY--APAFVDVNTVAQVKQEYEE  121 (134)
Q Consensus        79 ~f~~~~~l~~H~~~~~-~~--~~~~~~--~~~~~~~~~~~~~~~~~~~  121 (134)
                      .|.+...+++|.+.++ +.  -+|.|-  ...|.+-.+|..|....+.
T Consensus       330 s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  330 SVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHG  377 (467)
T ss_pred             HHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhc
Confidence            8888888999988766 33  335555  6677777777777755543


No 11 
>PHA00733 hypothetical protein
Probab=99.42  E-value=2.8e-13  Score=79.86  Aligned_cols=84  Identities=19%  Similarity=0.247  Sum_probs=69.3

Q ss_pred             CCCceeCccchhhccChHHHHHHH--h--ccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHH
Q psy12639         10 GAKPYACTECDQKFNRNSKLKIHY--N--LAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYE   85 (134)
Q Consensus        10 ~~~~~~C~~C~~~f~~~~~l~~h~--~--~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~   85 (134)
                      ..+++.|.+|...|.....|..+.  .  ..+.+.+||.|..|++.|.....|..|++.+  ..+|.|..|++.|.....
T Consensus        37 ~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         37 EQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHH
Confidence            356789999999998877776651  1  1234578999999999999999999999876  357999999999999999


Q ss_pred             HHHHHHhhcC
Q psy12639         86 LVLHLKKCHR   95 (134)
Q Consensus        86 l~~H~~~~~~   95 (134)
                      |..|+...|+
T Consensus       115 L~~H~~~~h~  124 (128)
T PHA00733        115 TLDHVCKKHN  124 (128)
T ss_pred             HHHHHHHhcC
Confidence            9999987764


No 12 
>PHA02768 hypothetical protein; Provisional
Probab=99.10  E-value=3e-11  Score=59.88  Aligned_cols=40  Identities=30%  Similarity=0.516  Sum_probs=21.5

Q ss_pred             eecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHH
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSY   84 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~   84 (134)
                      |.|+.||+.|...+.|..|++.|.  +++.|..|++.|...+
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s   45 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTG   45 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccc
Confidence            455555555555555555555554  4555555555555443


No 13 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.07  E-value=3.4e-10  Score=80.83  Aligned_cols=101  Identities=16%  Similarity=0.282  Sum_probs=78.6

Q ss_pred             cCCCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhc-------
Q psy12639          9 TGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYL-------   81 (134)
Q Consensus         9 ~~~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~-------   81 (134)
                      ..++++.|+.|++.|. ...|..|+.. +.  .++.|+ |+..+ ....|..|+..|...+++.|+.|++.|.       
T Consensus       449 el~~H~~C~~Cgk~f~-~s~LekH~~~-~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d  522 (567)
T PLN03086        449 EAKNHVHCEKCGQAFQ-QGEMEKHMKV-FH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMD  522 (567)
T ss_pred             ccccCccCCCCCCccc-hHHHHHHHHh-cC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccc
Confidence            3456789999999996 6789999987 53  689999 99755 6689999999999999999999999985       


Q ss_pred             ---CHHHHHHHHHhhcCCCCCCCCCC-Ccccchhhhhhh
Q psy12639         82 ---RSYELVLHLKKCHREDARNPYAP-AFVDVNTVAQVK  116 (134)
Q Consensus        82 ---~~~~l~~H~~~~~~~~~~~~~~~-~~~~~~~~~~~~  116 (134)
                         ..+.|..|...+ +.+++.|..+ .......+..|.
T Consensus       523 ~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrlrdm~~H~  560 (567)
T PLN03086        523 VRDRLRGMSEHESIC-GSRTAPCDSCGRSVMLKEMDIHQ  560 (567)
T ss_pred             hhhhhhhHHHHHHhc-CCcceEccccCCeeeehhHHHHH
Confidence               246899999986 7888888833 233333344443


No 14 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.04  E-value=8.3e-10  Score=78.89  Aligned_cols=54  Identities=20%  Similarity=0.430  Sum_probs=26.3

Q ss_pred             ecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHHHHhhcCCCCCCCC
Q psy12639         44 ECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPY  102 (134)
Q Consensus        44 ~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~  102 (134)
                      .|+.|+..|. ...|..|+..++  +++.|+ |++.+ .+..|..|+..+..++++.|.
T Consensus       455 ~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~  508 (567)
T PLN03086        455 HCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCR  508 (567)
T ss_pred             cCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCC
Confidence            4555555553 344555555442  445555 55432 344555555555555555554


No 15 
>PHA00733 hypothetical protein
Probab=98.99  E-value=8.1e-10  Score=65.24  Aligned_cols=57  Identities=21%  Similarity=0.428  Sum_probs=49.6

Q ss_pred             ccCCCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcC
Q psy12639          8 HTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTG   67 (134)
Q Consensus         8 h~~~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~   67 (134)
                      +.+.+||.|+.|++.|.+...|..|++. +  ..++.|..|++.|.....|..|+...++
T Consensus        68 ~~~~kPy~C~~Cgk~Fss~s~L~~H~r~-h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         68 SKAVSPYVCPLCLMPFSSSVSLKQHIRY-T--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             cCCCCCccCCCCCCcCCCHHHHHHHHhc-C--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            3457899999999999999999999985 4  3479999999999999999999887543


No 16 
>PHA02768 hypothetical protein; Provisional
Probab=98.97  E-value=2.7e-10  Score=56.54  Aligned_cols=43  Identities=16%  Similarity=0.339  Sum_probs=38.2

Q ss_pred             ceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhH
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYL   58 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l   58 (134)
                      -|.|+.||+.|...++|..|++. |+  +++.|..|++.|...+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~-H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRK-HN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHh-cC--CcccCCcccceeccccee
Confidence            37999999999999999999998 87  588999999999876655


No 17 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.91  E-value=3.5e-10  Score=48.25  Aligned_cols=24  Identities=42%  Similarity=1.000  Sum_probs=17.7

Q ss_pred             ChhHhhhccCCCceeCccchhhcc
Q psy12639          1 MESHLMLHTGAKPYACTECDQKFN   24 (134)
Q Consensus         1 l~~h~~~h~~~~~~~C~~C~~~f~   24 (134)
                      |++|+++|.+++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            456777777777777777777775


No 18 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.89  E-value=9.6e-10  Score=46.86  Aligned_cols=24  Identities=50%  Similarity=1.016  Sum_probs=15.8

Q ss_pred             HHhHHhhhcCCCCcccCccchhhc
Q psy12639         58 LIPHLRVHTGEKPYACNLCTVRYL   81 (134)
Q Consensus        58 l~~h~~~h~~~~~~~C~~C~~~f~   81 (134)
                      |..|++.|.+++||.|+.|++.|.
T Consensus         2 l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    2 LRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHSSSSSEEESSSSEEES
T ss_pred             HHHHhhhcCCCCCCCCCCCcCeeC
Confidence            556666666666666666666664


No 19 
>PHA00616 hypothetical protein
Probab=98.81  E-value=3.6e-09  Score=50.06  Aligned_cols=33  Identities=21%  Similarity=0.395  Sum_probs=26.9

Q ss_pred             CcccCccchhhcCHHHHHHHHHhhcCCCCCCCC
Q psy12639         70 PYACNLCTVRYLRSYELVLHLKKCHREDARNPY  102 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~  102 (134)
                      ||+|+.||+.|...+++..|++.+|+++++.++
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            578888888888888888888888888777665


No 20 
>KOG3993|consensus
Probab=98.69  E-value=6.1e-09  Score=71.18  Aligned_cols=82  Identities=27%  Similarity=0.554  Sum_probs=61.7

Q ss_pred             eeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhc--------C------------------
Q psy12639         14 YACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHT--------G------------------   67 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~--------~------------------   67 (134)
                      |.|..|...|...-.|..|.-. -...-.|.|+.|++.|+-..+|..|.+=|.        +                  
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~-RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCP-RIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCC-eeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            6788888777777777777643 334445778888888888888888766552        1                  


Q ss_pred             -------CCCcccCccchhhcCHHHHHHHHHhhcCC
Q psy12639         68 -------EKPYACNLCTVRYLRSYELVLHLKKCHRE   96 (134)
Q Consensus        68 -------~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   96 (134)
                             +-.|.|..|++.|.+.+-|++|+..|+..
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~  382 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRA  382 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhcc
Confidence                   12489999999999999999999998854


No 21 
>PHA00616 hypothetical protein
Probab=98.58  E-value=2.5e-08  Score=47.22  Aligned_cols=33  Identities=15%  Similarity=0.254  Sum_probs=20.5

Q ss_pred             ceeCccchhhccChHHHHHHHhccccCCCceecC
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNLAHCTGEMYECC   46 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~   46 (134)
                      ||.|+.||+.|....+|..|++. |++++++.|.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~-~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLS-VHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHH-hcCCCcccee
Confidence            45666666666666666666665 5566665554


No 22 
>PHA00732 hypothetical protein
Probab=98.49  E-value=1.3e-07  Score=51.07  Aligned_cols=47  Identities=23%  Similarity=0.371  Sum_probs=29.2

Q ss_pred             ceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhh
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVH   65 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h   65 (134)
                      ||.|..|++.|.+..+|..|++..|.+   +.|+.|++.|.   .+..|..+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC---Chhhhhccc
Confidence            466777777777777777777532432   35777777765   355565443


No 23 
>PHA00732 hypothetical protein
Probab=98.49  E-value=1.1e-07  Score=51.45  Aligned_cols=46  Identities=28%  Similarity=0.442  Sum_probs=38.7

Q ss_pred             ceecCCCCCccCChhhHHhHHhh-hcCCCCcccCccchhhcCHHHHHHHHHhh
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRV-HTGEKPYACNLCTVRYLRSYELVLHLKKC   93 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~   93 (134)
                      ||.|..|++.|.....|..|++. |.   ++.|+.|++.|.   .+..|.+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~   47 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQ   47 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhhccc
Confidence            57899999999999999999985 54   368999999998   477887654


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.48  E-value=4.2e-07  Score=45.68  Aligned_cols=49  Identities=31%  Similarity=0.568  Sum_probs=26.3

Q ss_pred             eecCCCCCccCChhhHHhHHhh-hcCC-CCcccCccchhhcCHHHHHHHHHhhc
Q psy12639         43 YECCHCARSFPCKSYLIPHLRV-HTGE-KPYACNLCTVRYLRSYELVLHLKKCH   94 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~-h~~~-~~~~C~~C~~~f~~~~~l~~H~~~~~   94 (134)
                      |.|++|++ ..+...|..|... |..+ +.+.||+|...+.  .+|..|+...|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            55666666 3444556666544 3332 3466666665433  36666666544


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.37  E-value=6.7e-07  Score=44.94  Aligned_cols=51  Identities=24%  Similarity=0.395  Sum_probs=40.9

Q ss_pred             ceeCccchhhccChHHHHHHHhccccCC-CceecCCCCCccCChhhHHhHHhhhc
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNLAHCTG-EMYECCHCARSFPCKSYLIPHLRVHT   66 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~~h~~~-~~~~C~~C~~~~~~~~~l~~h~~~h~   66 (134)
                      .|.|+.|++ ..+...|..|....|..+ +.+.|++|...+.  .+|..|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            488999999 566788999998878765 4689999998654  48889987654


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.29  E-value=5.1e-07  Score=37.14  Aligned_cols=22  Identities=23%  Similarity=0.689  Sum_probs=16.3

Q ss_pred             cccCccchhhcCHHHHHHHHHh
Q psy12639         71 YACNLCTVRYLRSYELVLHLKK   92 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~~   92 (134)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5677777777777777777765


No 27 
>KOG3993|consensus
Probab=98.24  E-value=4.8e-07  Score=62.19  Aligned_cols=54  Identities=30%  Similarity=0.663  Sum_probs=45.5

Q ss_pred             CceeCccchhhccChHHHHHHHhccccC---------------------------------CCceecCCCCCccCChhhH
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCT---------------------------------GEMYECCHCARSFPCKSYL   58 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~---------------------------------~~~~~C~~C~~~~~~~~~l   58 (134)
                      --|+|+.|++.|+-..+|..|.+. |.-                                 ..-|.|..|++.|.....|
T Consensus       294 vEYrCPEC~KVFsCPANLASHRRW-HKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYL  372 (500)
T KOG3993|consen  294 VEYRCPECDKVFSCPANLASHRRW-HKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYL  372 (500)
T ss_pred             eeecCCcccccccCchhhhhhhcc-cCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHH
Confidence            359999999999999999999987 631                                 1138899999999999999


Q ss_pred             HhHHhhhc
Q psy12639         59 IPHLRVHT   66 (134)
Q Consensus        59 ~~h~~~h~   66 (134)
                      ..|+.+|.
T Consensus       373 rKHqlthq  380 (500)
T KOG3993|consen  373 RKHQLTHQ  380 (500)
T ss_pred             HHhHHhhh
Confidence            99977664


No 28 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.17  E-value=1.4e-06  Score=49.18  Aligned_cols=73  Identities=19%  Similarity=0.330  Sum_probs=21.7

Q ss_pred             eCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHHHHhh
Q psy12639         15 ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKC   93 (134)
Q Consensus        15 ~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~   93 (134)
                      .|..|+..|.+...+..|+...|.-..+     ....+.....+....+.-. ...+.|..|++.|.+...|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~-----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP-----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccc-----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            4889999999999999999876644322     1111122333333333222 23699999999999999999999964


No 29 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.16  E-value=4.7e-07  Score=60.20  Aligned_cols=72  Identities=29%  Similarity=0.521  Sum_probs=47.0

Q ss_pred             CCCceeCcc--chhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHH
Q psy12639         10 GAKPYACTE--CDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELV   87 (134)
Q Consensus        10 ~~~~~~C~~--C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~   87 (134)
                      ++|||.|++  |.+.++....|+.|+.--|...+..+-+.          -..+.-.-...|||.|++|+|.|.....|+
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~----------p~~~~~F~~~~KPYrCevC~KRYKNlNGLK  415 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPS----------PEKMNIFSAKDKPYRCEVCDKRYKNLNGLK  415 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCC----------ccccccccccCCceeccccchhhccCccce
Confidence            358888887  88888888888888864443333221110          001111134568999999999999988888


Q ss_pred             HHHH
Q psy12639         88 LHLK   91 (134)
Q Consensus        88 ~H~~   91 (134)
                      -|..
T Consensus       416 YHr~  419 (423)
T COG5189         416 YHRK  419 (423)
T ss_pred             eccc
Confidence            7754


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.12  E-value=2.5e-06  Score=35.18  Aligned_cols=24  Identities=25%  Similarity=0.667  Sum_probs=16.2

Q ss_pred             cccCccchhhcCHHHHHHHHHhhc
Q psy12639         71 YACNLCTVRYLRSYELVLHLKKCH   94 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~~~~   94 (134)
                      |.|+.|++.|.+...|..|+..+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            567777777777777777777654


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.99  E-value=3.3e-06  Score=36.08  Aligned_cols=25  Identities=20%  Similarity=0.457  Sum_probs=17.0

Q ss_pred             CcccCccchhhcCHHHHHHHHHhhc
Q psy12639         70 PYACNLCTVRYLRSYELVLHLKKCH   94 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~l~~H~~~~~   94 (134)
                      +|.|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4667777777777777777776554


No 32 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.97  E-value=5.7e-06  Score=33.90  Aligned_cols=22  Identities=36%  Similarity=0.753  Sum_probs=13.6

Q ss_pred             eeCccchhhccChHHHHHHHhc
Q psy12639         14 YACTECDQKFNRNSKLKIHYNL   35 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~   35 (134)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666653


No 33 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.79  E-value=1.6e-05  Score=32.63  Aligned_cols=22  Identities=27%  Similarity=0.726  Sum_probs=11.9

Q ss_pred             eeCccchhhccChHHHHHHHhc
Q psy12639         14 YACTECDQKFNRNSKLKIHYNL   35 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~   35 (134)
                      |.|+.|++.|.+...|..|+..
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~   22 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRT   22 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHh
Confidence            4566666666666666666554


No 34 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.79  E-value=2.8e-05  Score=37.75  Aligned_cols=33  Identities=27%  Similarity=0.453  Sum_probs=20.3

Q ss_pred             cCCCCcccCccchhhcCHHHHHHHHHhhcCCCC
Q psy12639         66 TGEKPYACNLCTVRYLRSYELVLHLKKCHREDA   98 (134)
Q Consensus        66 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~   98 (134)
                      ..+.|-.|++|+..+++..+|++|+.+.|+.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            345677888888888888888888877776554


No 35 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.71  E-value=2.5e-05  Score=33.24  Aligned_cols=23  Identities=35%  Similarity=0.777  Sum_probs=14.3

Q ss_pred             ceeCccchhhccChHHHHHHHhc
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNL   35 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~   35 (134)
                      ||.|..|++.|.+...|..|++.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~   23 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRS   23 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCT
T ss_pred             CCCCCccCCccCChhHHHHHhHH
Confidence            45666666666666666666654


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.55  E-value=9e-05  Score=30.79  Aligned_cols=24  Identities=21%  Similarity=0.441  Sum_probs=19.4

Q ss_pred             cccCccchhhcCHHHHHHHHHhhc
Q psy12639         71 YACNLCTVRYLRSYELVLHLKKCH   94 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~~~~   94 (134)
                      |.|+.|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            568888888888888888888553


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.28  E-value=0.00025  Score=34.50  Aligned_cols=34  Identities=21%  Similarity=0.288  Sum_probs=18.2

Q ss_pred             ccCCCceecCCCCCccCChhhHHhHHhhhcCCCC
Q psy12639         37 HCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKP   70 (134)
Q Consensus        37 h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~   70 (134)
                      .....|-.|++|+..+....+|..|+...++.+|
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            3345566777777777777777777766555554


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.10  E-value=0.00062  Score=28.09  Aligned_cols=20  Identities=40%  Similarity=0.780  Sum_probs=11.6

Q ss_pred             eCccchhhccChHHHHHHHh
Q psy12639         15 ACTECDQKFNRNSKLKIHYN   34 (134)
Q Consensus        15 ~C~~C~~~f~~~~~l~~h~~   34 (134)
                      .|..|++.|.....+..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHH
Confidence            45555566655555555554


No 39 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.03  E-value=0.00037  Score=28.90  Aligned_cols=21  Identities=24%  Similarity=0.705  Sum_probs=13.9

Q ss_pred             cccCccchhhcCHHHHHHHHH
Q psy12639         71 YACNLCTVRYLRSYELVLHLK   91 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~   91 (134)
                      |.|..|++.|.+...+..|++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCCcCCHHHHHHHHC
Confidence            456667777777777666665


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.02  E-value=0.00045  Score=28.67  Aligned_cols=22  Identities=23%  Similarity=0.691  Sum_probs=13.4

Q ss_pred             eeCccchhhccChHHHHHHHhc
Q psy12639         14 YACTECDQKFNRNSKLKIHYNL   35 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~   35 (134)
                      |.|..|++.|.+...+..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666643


No 41 
>PRK04860 hypothetical protein; Provisional
Probab=96.97  E-value=0.00066  Score=41.76  Aligned_cols=38  Identities=29%  Similarity=0.541  Sum_probs=29.2

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCH
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRS   83 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   83 (134)
                      +|.|. |+.   ....+..|.+.+.++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            57887 876   566678888888888888888888877643


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.96  E-value=0.00072  Score=27.77  Aligned_cols=23  Identities=35%  Similarity=0.632  Sum_probs=12.4

Q ss_pred             cccCccchhhcCHHHHHHHHHhhc
Q psy12639         71 YACNLCTVRYLRSYELVLHLKKCH   94 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~~~~   94 (134)
                      |.|+.|+.... ...|..|++.+|
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666665555 566666666554


No 43 
>KOG4173|consensus
Probab=96.76  E-value=0.001  Score=42.04  Aligned_cols=77  Identities=30%  Similarity=0.623  Sum_probs=62.3

Q ss_pred             eeCcc--chhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhc----------CCCCccc--Cccchh
Q psy12639         14 YACTE--CDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHT----------GEKPYAC--NLCTVR   79 (134)
Q Consensus        14 ~~C~~--C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~----------~~~~~~C--~~C~~~   79 (134)
                      +.|+.  |...|.....+..|..+.|.+    .|.+|.+.|.+...|..|+.-.+          |.-.|+|  ..|+..
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~~~h~~----sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYHTLHGN----SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhhhcccc----hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            67887  888999988888888765544    69999999999999999976532          4456888  459999


Q ss_pred             hcCHHHHHHHHHhhc
Q psy12639         80 YLRSYELVLHLKKCH   94 (134)
Q Consensus        80 f~~~~~l~~H~~~~~   94 (134)
                      |.+..+.+.|+-..|
T Consensus       156 FkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  156 FKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhhhhhhhhHHHHhc
Confidence            999999999986654


No 44 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.73  E-value=0.0014  Score=27.29  Aligned_cols=21  Identities=24%  Similarity=0.499  Sum_probs=13.6

Q ss_pred             cccCccchhhcCHHHHHHHHHh
Q psy12639         71 YACNLCTVRYLRSYELVLHLKK   92 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~~   92 (134)
                      ..|+.||+.| ....|..|+..
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHHh
Confidence            3577777777 55566677654


No 45 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.69  E-value=0.0004  Score=29.48  Aligned_cols=22  Identities=23%  Similarity=0.599  Sum_probs=17.1

Q ss_pred             cccCccchhhcCHHHHHHHHHh
Q psy12639         71 YACNLCTVRYLRSYELVLHLKK   92 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~~   92 (134)
                      |.|..|++.|.+...+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            6688888888888888877653


No 46 
>PRK04860 hypothetical protein; Provisional
Probab=96.66  E-value=0.0015  Score=40.18  Aligned_cols=38  Identities=24%  Similarity=0.690  Sum_probs=32.4

Q ss_pred             ceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCCh
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCK   55 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~   55 (134)
                      +|.|. |+.   ...++..|.++ |.++++|.|..|+..+...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri-~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRV-VRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHH-hcCCccEECCCCCceeEEe
Confidence            59998 987   56778999997 9999999999999887543


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.61  E-value=0.00084  Score=28.47  Aligned_cols=22  Identities=32%  Similarity=0.769  Sum_probs=14.6

Q ss_pred             eeCccchhhccChHHHHHHHhc
Q psy12639         14 YACTECDQKFNRNSKLKIHYNL   35 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~   35 (134)
                      |.|..|++.|.+...+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4566777777777776666653


No 48 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.25  E-value=0.0048  Score=25.22  Aligned_cols=21  Identities=33%  Similarity=0.662  Sum_probs=10.0

Q ss_pred             eeCccchhhccChHHHHHHHhc
Q psy12639         14 YACTECDQKFNRNSKLKIHYNL   35 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~   35 (134)
                      |.|+.|+.... ...|..|++.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~   21 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKR   21 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHh
Confidence            34555555554 5555555544


No 49 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=95.85  E-value=0.0048  Score=30.58  Aligned_cols=31  Identities=29%  Similarity=0.477  Sum_probs=26.5

Q ss_pred             hccCCCceeCccchhhccChHHHHHHHhccc
Q psy12639          7 LHTGAKPYACTECDQKFNRNSKLKIHYNLAH   37 (134)
Q Consensus         7 ~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~h   37 (134)
                      ..-|+..+.|+-|+..|....++..|++..|
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            4457788999999999999999999998755


No 50 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.53  E-value=0.01  Score=26.56  Aligned_cols=22  Identities=32%  Similarity=0.726  Sum_probs=17.8

Q ss_pred             CcccCccchhhcCHHHHHHHHH
Q psy12639         70 PYACNLCTVRYLRSYELVLHLK   91 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~l~~H~~   91 (134)
                      +|.|..|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4778888888888888888875


No 51 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=95.32  E-value=0.0084  Score=40.60  Aligned_cols=49  Identities=20%  Similarity=0.465  Sum_probs=33.7

Q ss_pred             CCCcccCc--cchhhcCHHHHHHHHHhhc-------------------CCCCCCCC--CCCcccchhhhhhh
Q psy12639         68 EKPYACNL--CTVRYLRSYELVLHLKKCH-------------------REDARNPY--APAFVDVNTVAQVK  116 (134)
Q Consensus        68 ~~~~~C~~--C~~~f~~~~~l~~H~~~~~-------------------~~~~~~~~--~~~~~~~~~~~~~~  116 (134)
                      ++||.|++  |+|.|.+...|+-|+.-.|                   ..+||.|+  ++.+...+.|.-|.
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            58888876  8888888888888876433                   23777777  55565555555544


No 52 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.05  E-value=0.018  Score=25.58  Aligned_cols=9  Identities=33%  Similarity=1.265  Sum_probs=4.6

Q ss_pred             CCcccCccc
Q psy12639         69 KPYACNLCT   77 (134)
Q Consensus        69 ~~~~C~~C~   77 (134)
                      .++.|+.|+
T Consensus        16 ~~~~CP~Cg   24 (33)
T cd00350          16 APWVCPVCG   24 (33)
T ss_pred             CCCcCcCCC
Confidence            345555554


No 53 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.01  E-value=0.021  Score=25.50  Aligned_cols=22  Identities=18%  Similarity=0.573  Sum_probs=12.1

Q ss_pred             ceeCccchhhccChHHHHHHHh
Q psy12639         13 PYACTECDQKFNRNSKLKIHYN   34 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~   34 (134)
                      +|.|..|+..|.....+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            3455555555555555555553


No 54 
>KOG1146|consensus
Probab=94.86  E-value=0.014  Score=46.44  Aligned_cols=26  Identities=31%  Similarity=0.636  Sum_probs=22.6

Q ss_pred             CCCCcccCccchhhcCHHHHHHHHHh
Q psy12639         67 GEKPYACNLCTVRYLRSYELVLHLKK   92 (134)
Q Consensus        67 ~~~~~~C~~C~~~f~~~~~l~~H~~~   92 (134)
                      +.++|.|..|...++...+|..|+..
T Consensus       515 ~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  515 PGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             CCCcccceeeeeeeecchHHHHHHHH
Confidence            35779999999999999999999874


No 55 
>KOG1146|consensus
Probab=94.01  E-value=0.04  Score=44.00  Aligned_cols=57  Identities=26%  Similarity=0.490  Sum_probs=47.5

Q ss_pred             ccCCCceeCccchhhccChHHHHHHHhcccc------------------------CCCceecCCCCCccCChhhHHhHHh
Q psy12639          8 HTGAKPYACTECDQKFNRNSKLKIHYNLAHC------------------------TGEMYECCHCARSFPCKSYLIPHLR   63 (134)
Q Consensus         8 h~~~~~~~C~~C~~~f~~~~~l~~h~~~~h~------------------------~~~~~~C~~C~~~~~~~~~l~~h~~   63 (134)
                      +...+-+.|+.|+..|+....|..||+..|.                        +.++|.|..|...+.....|..|+.
T Consensus       460 ~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  460 HSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             ecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            4445779999999999999999999997552                        2357899999999999989999976


Q ss_pred             h
Q psy12639         64 V   64 (134)
Q Consensus        64 ~   64 (134)
                      .
T Consensus       540 S  540 (1406)
T KOG1146|consen  540 S  540 (1406)
T ss_pred             H
Confidence            5


No 56 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=93.44  E-value=0.085  Score=29.34  Aligned_cols=25  Identities=28%  Similarity=0.679  Sum_probs=21.4

Q ss_pred             CceecCCCCCccCChhhHHhHHhhh
Q psy12639         41 EMYECCHCARSFPCKSYLIPHLRVH   65 (134)
Q Consensus        41 ~~~~C~~C~~~~~~~~~l~~h~~~h   65 (134)
                      ..+.|..|+..|.+...|..|++.+
T Consensus        49 ~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   49 ESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCCccCCCCcCHHHHHHHHcCc
Confidence            3689999999999999999999874


No 57 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.37  E-value=0.061  Score=26.74  Aligned_cols=29  Identities=28%  Similarity=0.605  Sum_probs=21.8

Q ss_pred             cCCCCcccCccchhhcCHHHHHHHHHhhc
Q psy12639         66 TGEKPYACNLCTVRYLRSYELVLHLKKCH   94 (134)
Q Consensus        66 ~~~~~~~C~~C~~~f~~~~~l~~H~~~~~   94 (134)
                      -|+..+.||.|+..|..+.+..+|....|
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhhHHh
Confidence            45666788888888888888888876544


No 58 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=93.05  E-value=0.088  Score=26.59  Aligned_cols=31  Identities=19%  Similarity=0.554  Sum_probs=18.0

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCccc
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCT   77 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~   77 (134)
                      .|.|+.||+......     .+.-....+|.|+.||
T Consensus        27 ~F~CPnCGe~~I~Rc-----~~CRk~g~~Y~Cp~CG   57 (61)
T COG2888          27 KFPCPNCGEVEIYRC-----AKCRKLGNPYRCPKCG   57 (61)
T ss_pred             EeeCCCCCceeeehh-----hhHHHcCCceECCCcC
Confidence            477777776543332     2223345677777776


No 59 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.98  E-value=0.02  Score=40.23  Aligned_cols=61  Identities=31%  Similarity=0.477  Sum_probs=43.6

Q ss_pred             ceecCCCCCccCChhhHHhHHh--hhcCC--CCcccC--ccchhhcCHHHHHHHHHhhcCCCCCCCC
Q psy12639         42 MYECCHCARSFPCKSYLIPHLR--VHTGE--KPYACN--LCTVRYLRSYELVLHLKKCHREDARNPY  102 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~--~h~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~~~  102 (134)
                      ++.|..|...|.....+..|.+  .|.++  +++.|+  .|++.|.+...+..|...+....+..+.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            4667777777777777777777  67777  777777  6777777777777777777665544433


No 60 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=92.69  E-value=0.15  Score=23.24  Aligned_cols=32  Identities=25%  Similarity=0.721  Sum_probs=16.7

Q ss_pred             eCccchhhccChHHHHHHHhccccCCCceecCCCCCcc
Q psy12639         15 ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSF   52 (134)
Q Consensus        15 ~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~   52 (134)
                      .|+.|+..|.-..+     +. ..+.....|+.|+..|
T Consensus         4 ~CP~C~~~f~v~~~-----~l-~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDD-----KL-PAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHH-----Hc-ccCCcEEECCCCCcEe
Confidence            56666666655543     11 1223345666666555


No 61 
>KOG2231|consensus
Probab=92.62  E-value=0.21  Score=37.57  Aligned_cols=16  Identities=31%  Similarity=0.416  Sum_probs=9.6

Q ss_pred             hccChHHHHHHHhccc
Q psy12639         22 KFNRNSKLKIHYNLAH   37 (134)
Q Consensus        22 ~f~~~~~l~~h~~~~h   37 (134)
                      .|.+...|+.|+...|
T Consensus       123 ~~~s~~~Lk~H~~~~H  138 (669)
T KOG2231|consen  123 EFKSVENLKNHMRDQH  138 (669)
T ss_pred             chhHHHHHHHHHHHhh
Confidence            3346667777775434


No 62 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=92.61  E-value=0.039  Score=38.77  Aligned_cols=63  Identities=25%  Similarity=0.472  Sum_probs=52.0

Q ss_pred             CceeCccchhhccChHHHHHHHhc-cccCC--CceecC--CCCCccCChhhHHhHHhhhcCCCCcccC
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNL-AHCTG--EMYECC--HCARSFPCKSYLIPHLRVHTGEKPYACN   74 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~-~h~~~--~~~~C~--~C~~~~~~~~~l~~h~~~h~~~~~~~C~   74 (134)
                      .++.|..|...|.....+..|.+. .|.++  +++.|+  .|++.|.....+..|...|.+..++.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            467888899999999999999883 48888  899998  7999999999899998888877665553


No 63 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=92.06  E-value=0.17  Score=23.05  Aligned_cols=33  Identities=18%  Similarity=0.529  Sum_probs=15.7

Q ss_pred             eeCccchhhccChHHHHHHHhccccCCCceecCCCCCcc
Q psy12639         14 YACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSF   52 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~   52 (134)
                      +.|+.|+..|.-.....      ........|+.|+..|
T Consensus         3 ~~CP~C~~~~~v~~~~~------~~~~~~v~C~~C~~~~   35 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL------GANGGKVRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEEEeCHHHc------CCCCCEEECCCCCCEE
Confidence            35666666655544311      1111235566666554


No 64 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.71  E-value=0.13  Score=23.02  Aligned_cols=9  Identities=22%  Similarity=0.630  Sum_probs=4.3

Q ss_pred             eecCCCCCc
Q psy12639         43 YECCHCARS   51 (134)
Q Consensus        43 ~~C~~C~~~   51 (134)
                      |.|..||..
T Consensus         3 ~~C~~CG~i   11 (34)
T cd00729           3 WVCPVCGYI   11 (34)
T ss_pred             EECCCCCCE
Confidence            445555544


No 65 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=91.29  E-value=0.3  Score=22.13  Aligned_cols=32  Identities=22%  Similarity=0.711  Sum_probs=15.1

Q ss_pred             eCccchhhccChHHHHHHHhccccCCCceecCCCCCcc
Q psy12639         15 ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSF   52 (134)
Q Consensus        15 ~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~   52 (134)
                      .|+.|+..|.-....     . -.......|+.|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~-----i-p~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEK-----I-PPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHH-----C-CCCCcEEECCCCCCEe
Confidence            456666555554431     1 1222234566665544


No 66 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=91.07  E-value=0.17  Score=31.38  Aligned_cols=23  Identities=30%  Similarity=0.873  Sum_probs=17.9

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCccc
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCT   77 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~   77 (134)
                      .|+|++||.++             .++.|..||.||
T Consensus       134 ~~vC~vCGy~~-------------~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYTH-------------EGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCcc-------------cCCCCCcCCCCC
Confidence            58899998653             456788899998


No 67 
>KOG2893|consensus
Probab=91.04  E-value=0.048  Score=35.61  Aligned_cols=49  Identities=27%  Similarity=0.648  Sum_probs=32.0

Q ss_pred             CceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHHHHhhc
Q psy12639         41 EMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCH   94 (134)
Q Consensus        41 ~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~   94 (134)
                      +++ |=+|.+.|....-|.+|++.    +.|+|.+|.+.+-+...|..|....|
T Consensus        10 kpw-cwycnrefddekiliqhqka----khfkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   10 KPW-CWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             Cce-eeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCceeehhhhh
Confidence            444 55577777777777777653    44778888777766667766654333


No 68 
>KOG2186|consensus
Probab=90.93  E-value=0.16  Score=33.49  Aligned_cols=49  Identities=14%  Similarity=0.453  Sum_probs=32.2

Q ss_pred             ceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhh
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVH   65 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h   65 (134)
                      .|.|..||-+..-.. +..|+.. -.+ .-|.|-.|+..|.. .....|...-
T Consensus         3 ~FtCnvCgEsvKKp~-vekH~sr-Crn-~~fSCIDC~k~F~~-~sYknH~kCI   51 (276)
T KOG2186|consen    3 FFTCNVCGESVKKPQ-VEKHMSR-CRN-AYFSCIDCGKTFER-VSYKNHTKCI   51 (276)
T ss_pred             EEehhhhhhhccccc-hHHHHHh-ccC-CeeEEeeccccccc-chhhhhhhhc
Confidence            577888887766544 5667753 444 45788888888876 4556665543


No 69 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=90.86  E-value=0.19  Score=31.04  Aligned_cols=33  Identities=12%  Similarity=0.355  Sum_probs=22.2

Q ss_pred             CCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhh
Q psy12639         39 TGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRY   80 (134)
Q Consensus        39 ~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f   80 (134)
                      ...-|.|+.|+..|++...+.         ..|.|+.||...
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            444577888887777766653         257888887543


No 70 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=90.27  E-value=0.18  Score=34.85  Aligned_cols=23  Identities=26%  Similarity=0.719  Sum_probs=11.5

Q ss_pred             eeCcc--chhhccChHHHHHHHhcc
Q psy12639         14 YACTE--CDQKFNRNSKLKIHYNLA   36 (134)
Q Consensus        14 ~~C~~--C~~~f~~~~~l~~h~~~~   36 (134)
                      |.|+.  |.........|..|.+..
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~  176 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQ  176 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhh
Confidence            44543  444444455566666543


No 71 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=89.69  E-value=0.25  Score=30.04  Aligned_cols=35  Identities=14%  Similarity=0.467  Sum_probs=16.6

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhh
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRY   80 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f   80 (134)
                      -|.|+.|+..|.....+..   ... ...|.|+.||...
T Consensus        99 ~Y~Cp~C~~~y~~~ea~~~---~d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       99 YYKCPNCQSKYTFLEANQL---LDM-DGTFTCPRCGEEL  133 (147)
T ss_pred             EEECcCCCCEeeHHHHHHh---cCC-CCcEECCCCCCEE
Confidence            4666666666654333211   011 2226666666543


No 72 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=89.54  E-value=0.085  Score=34.22  Aligned_cols=23  Identities=17%  Similarity=0.382  Sum_probs=16.1

Q ss_pred             CCceeCccchhhccChHHHHHHH
Q psy12639         11 AKPYACTECDQKFNRNSKLKIHY   33 (134)
Q Consensus        11 ~~~~~C~~C~~~f~~~~~l~~h~   33 (134)
                      ++...||+|+..|....-.....
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~~   25 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGKI   25 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCCc
Confidence            35678999999998876444444


No 73 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=89.50  E-value=0.27  Score=30.99  Aligned_cols=33  Identities=15%  Similarity=0.381  Sum_probs=21.4

Q ss_pred             CCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhc
Q psy12639         40 GEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYL   81 (134)
Q Consensus        40 ~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~   81 (134)
                      ..-|.|+.|+..|++...+.         ..|.|+.||....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLE  147 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCe
Confidence            34577888887777666542         2578888875443


No 74 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=89.50  E-value=0.46  Score=27.49  Aligned_cols=78  Identities=18%  Similarity=0.347  Sum_probs=50.2

Q ss_pred             CceeCccchhhccChHHHHHHHhccccC-CCc------------eecCCCCCccCChhhHHhHHhhhcCCCCcccCccch
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCT-GEM------------YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTV   78 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~-~~~------------~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   78 (134)
                      -|..|+.||....+...|.+..-  |.- -++            -.|-.|...|........-  .-.....|.|+.|..
T Consensus        14 LP~~CpiCgLtLVss~HLARSyH--HLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~--~~~~~~~y~C~~C~~   89 (112)
T TIGR00622        14 LPVECPICGLTLILSTHLARSYH--HLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFD--ELKDSHRYVCAVCKN   89 (112)
T ss_pred             CCCcCCcCCCEEeccchHHHhhh--ccCCCcccccccccccCCCCcccCcCCCCCCccccccc--ccccccceeCCCCCC
Confidence            47889999999888888776542  211 111            1377888887654311100  012344699999999


Q ss_pred             hhcCHHHHHHHHHhh
Q psy12639         79 RYLRSYELVLHLKKC   93 (134)
Q Consensus        79 ~f~~~~~l~~H~~~~   93 (134)
                      .|--.-+.-.|-.+|
T Consensus        90 ~FC~dCD~fiHe~Lh  104 (112)
T TIGR00622        90 VFCVDCDVFVHESLH  104 (112)
T ss_pred             ccccccchhhhhhcc
Confidence            998887777776555


No 75 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=88.93  E-value=0.34  Score=24.53  Aligned_cols=31  Identities=19%  Similarity=0.625  Sum_probs=16.4

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCccc
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCT   77 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~   77 (134)
                      .|.|+.||+.....-     .+--....+|.|+.||
T Consensus        25 ~F~CPnCG~~~I~RC-----~~CRk~~~~Y~CP~CG   55 (59)
T PRK14890         25 KFLCPNCGEVIIYRC-----EKCRKQSNPYTCPKCG   55 (59)
T ss_pred             EeeCCCCCCeeEeec-----hhHHhcCCceECCCCC
Confidence            467777776522221     1222234567777776


No 76 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=88.34  E-value=0.68  Score=28.59  Aligned_cols=30  Identities=17%  Similarity=0.441  Sum_probs=15.9

Q ss_pred             CceeCccchhhccChHHHHHHHhccccCCCceecCCCCCc
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARS   51 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~   51 (134)
                      ..|.|+.|+..|.....+.          ..|.|+.||..
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~----------~~F~Cp~Cg~~  137 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME----------LNFTCPRCGAM  137 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH----------cCCcCCCCCCE
Confidence            4456666665555544432          13566666654


No 77 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=87.73  E-value=1.7  Score=24.86  Aligned_cols=80  Identities=21%  Similarity=0.302  Sum_probs=45.9

Q ss_pred             CceeCccchhhccChHHHHHHHhccccCCCceecCCCCCc-------cCChhhHH---------hHHhhhcCCCCccc--
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARS-------FPCKSYLI---------PHLRVHTGEKPYAC--   73 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~-------~~~~~~l~---------~h~~~h~~~~~~~C--   73 (134)
                      +...|..|+.+... +.+..|.+..|.......-..-...       ......+.         .....   ..-|.|  
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~---~~G~~C~~   85 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPV---YDGYRCQC   85 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCC---CCCeeeec
Confidence            45789999987766 7789999864543211100000000       00000000         00000   123899  


Q ss_pred             --CccchhhcCHHHHHHHHHhhcC
Q psy12639         74 --NLCTVRYLRSYELVLHLKKCHR   95 (134)
Q Consensus        74 --~~C~~~f~~~~~l~~H~~~~~~   95 (134)
                        ..|+....+...+..|.+.+|+
T Consensus        86 ~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   86 DPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCCCCcEeccHHHHHHHHHHhcC
Confidence              9999999999999999998774


No 78 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=87.43  E-value=0.32  Score=30.65  Aligned_cols=16  Identities=19%  Similarity=0.501  Sum_probs=7.4

Q ss_pred             CcccCccchhhcCHHH
Q psy12639         70 PYACNLCTVRYLRSYE   85 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~   85 (134)
                      -|.|+.|+..|+...+
T Consensus       117 ~Y~Cp~C~~rytf~eA  132 (178)
T PRK06266        117 FFFCPNCHIRFTFDEA  132 (178)
T ss_pred             EEECCCCCcEEeHHHH
Confidence            3445555544444433


No 79 
>KOG2482|consensus
Probab=87.20  E-value=0.76  Score=31.88  Aligned_cols=22  Identities=27%  Similarity=0.573  Sum_probs=20.2

Q ss_pred             eeCccchhhccChHHHHHHHhc
Q psy12639         14 YACTECDQKFNRNSKLKIHYNL   35 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~   35 (134)
                      +.|-.|.+.|+.+..|..||+.
T Consensus       196 ~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHh
Confidence            6899999999999999999974


No 80 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=86.31  E-value=0.93  Score=18.87  Aligned_cols=19  Identities=21%  Similarity=0.403  Sum_probs=11.9

Q ss_pred             ccCccchhhcCHHHHHHHHH
Q psy12639         72 ACNLCTVRYLRSYELVLHLK   91 (134)
Q Consensus        72 ~C~~C~~~f~~~~~l~~H~~   91 (134)
                      .||.|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            467777766 4456666655


No 81 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=86.24  E-value=0.54  Score=27.10  Aligned_cols=15  Identities=20%  Similarity=0.642  Sum_probs=8.9

Q ss_pred             CCcccCccchhhcCH
Q psy12639         69 KPYACNLCTVRYLRS   83 (134)
Q Consensus        69 ~~~~C~~C~~~f~~~   83 (134)
                      .|..||.||..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            455666666666544


No 82 
>PHA00626 hypothetical protein
Probab=85.80  E-value=0.45  Score=23.77  Aligned_cols=12  Identities=25%  Similarity=0.490  Sum_probs=6.0

Q ss_pred             CcccCccchhhc
Q psy12639         70 PYACNLCTVRYL   81 (134)
Q Consensus        70 ~~~C~~C~~~f~   81 (134)
                      .|.|+.||..|+
T Consensus        23 rYkCkdCGY~ft   34 (59)
T PHA00626         23 DYVCCDCGYNDS   34 (59)
T ss_pred             ceEcCCCCCeec
Confidence            355555555444


No 83 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=85.47  E-value=0.19  Score=30.88  Aligned_cols=16  Identities=25%  Similarity=0.532  Sum_probs=11.0

Q ss_pred             ceecCCCCCccCChhh
Q psy12639         42 MYECCHCARSFPCKSY   57 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~   57 (134)
                      .+.|+.||.+|.....
T Consensus        28 ~~~c~~c~~~f~~~e~   43 (154)
T PRK00464         28 RRECLACGKRFTTFER   43 (154)
T ss_pred             eeeccccCCcceEeEe
Confidence            3678888887766544


No 84 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=85.25  E-value=3.1  Score=29.08  Aligned_cols=75  Identities=27%  Similarity=0.480  Sum_probs=44.2

Q ss_pred             eCccchhhccChHHHHHHHhccccCCCceecCCCCC----ccCChhhHHhHHhhhcCCCCcccCc--cc----hhhcCHH
Q psy12639         15 ACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCAR----SFPCKSYLIPHLRVHTGEKPYACNL--CT----VRYLRSY   84 (134)
Q Consensus        15 ~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~----~~~~~~~l~~h~~~h~~~~~~~C~~--C~----~~f~~~~   84 (134)
                      .|..|...|-....|..|++..|.  +=+.|...+.    .|.....|..|.+..+    |.|..  |.    ..|....
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~HE--~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y~ct~qtc~~~k~~vf~~~~  295 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLRHE--ACHICDMVGPIRYQYFKSYEDLEAHFRNAH----YCCTFQTCRVGKCYVFPYHT  295 (493)
T ss_pred             hhhhccceecChHHHHHHHHhhhh--hhhhhhccCccchhhhhCHHHHHHHhhcCc----eEEEEEEEecCcEEEeccHH
Confidence            577788888888888888875432  2234443332    2555566666655432    55533  32    3577777


Q ss_pred             HHHHHHHhhcC
Q psy12639         85 ELVLHLKKCHR   95 (134)
Q Consensus        85 ~l~~H~~~~~~   95 (134)
                      .|..|+-.-|+
T Consensus       296 el~~h~~~~h~  306 (493)
T COG5236         296 ELLEHLTRFHK  306 (493)
T ss_pred             HHHHHHHHHhh
Confidence            77888766554


No 85 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=85.19  E-value=0.75  Score=21.88  Aligned_cols=10  Identities=40%  Similarity=1.072  Sum_probs=4.8

Q ss_pred             eeCccchhhc
Q psy12639         14 YACTECDQKF   23 (134)
Q Consensus        14 ~~C~~C~~~f   23 (134)
                      |.|..||..|
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            4455555443


No 86 
>KOG2893|consensus
Probab=84.44  E-value=0.29  Score=32.12  Aligned_cols=45  Identities=24%  Similarity=0.547  Sum_probs=34.0

Q ss_pred             CceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHH
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHL   62 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~   62 (134)
                      ||| |..|++.|....-|..|++.     +.|.|.+|-+...+-..|..|.
T Consensus        10 kpw-cwycnrefddekiliqhqka-----khfkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen   10 KPW-CWYCNREFDDEKILIQHQKA-----KHFKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             Cce-eeecccccchhhhhhhhhhh-----ccceeeeehhhhccCCCceeeh
Confidence            443 77799999999988888765     4689999987766655666554


No 87 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=84.15  E-value=1  Score=21.17  Aligned_cols=26  Identities=31%  Similarity=0.420  Sum_probs=14.1

Q ss_pred             CCCCcccCccchhhcC----HHHHHHHHHh
Q psy12639         67 GEKPYACNLCTVRYLR----SYELVLHLKK   92 (134)
Q Consensus        67 ~~~~~~C~~C~~~f~~----~~~l~~H~~~   92 (134)
                      +.....|..|++.+..    .+.|..|++.
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            3445677777776655    3677777743


No 88 
>KOG2186|consensus
Probab=83.95  E-value=0.76  Score=30.45  Aligned_cols=50  Identities=18%  Similarity=0.315  Sum_probs=37.5

Q ss_pred             eecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHHHHhhcC
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHR   95 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~   95 (134)
                      |.|..||....-+ .+..|+...++ .-|.|-.|++.|.. .+...|..--+.
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCITE   53 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCITE   53 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcch
Confidence            7788999877655 46778887766 55899999999988 677788764443


No 89 
>KOG2785|consensus
Probab=83.85  E-value=1.4  Score=31.07  Aligned_cols=49  Identities=14%  Similarity=0.385  Sum_probs=39.5

Q ss_pred             ecCCCCCccCChhhHHhHHhhhcC-----------------------CCCcccCccc---hhhcCHHHHHHHHHh
Q psy12639         44 ECCHCARSFPCKSYLIPHLRVHTG-----------------------EKPYACNLCT---VRYLRSYELVLHLKK   92 (134)
Q Consensus        44 ~C~~C~~~~~~~~~l~~h~~~h~~-----------------------~~~~~C~~C~---~~f~~~~~l~~H~~~   92 (134)
                      .|..|+..+.+......||..++|                       ...+.|-.|+   +.|.+....+.||..
T Consensus       168 ~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  168 DCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             ceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            577888888888888888887654                       2347888898   999999999999974


No 90 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=83.49  E-value=0.23  Score=23.31  Aligned_cols=13  Identities=38%  Similarity=1.002  Sum_probs=6.8

Q ss_pred             eeCccchhhccCh
Q psy12639         14 YACTECDQKFNRN   26 (134)
Q Consensus        14 ~~C~~C~~~f~~~   26 (134)
                      |.|..||..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (42)
T PF09723_consen    6 YRCEECGHEFEVL   18 (42)
T ss_pred             EEeCCCCCEEEEE
Confidence            4555555555443


No 91 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=83.46  E-value=0.4  Score=23.48  Aligned_cols=12  Identities=42%  Similarity=1.182  Sum_probs=6.4

Q ss_pred             eeCccchhhccC
Q psy12639         14 YACTECDQKFNR   25 (134)
Q Consensus        14 ~~C~~C~~~f~~   25 (134)
                      |.|..||..|..
T Consensus         6 y~C~~Cg~~fe~   17 (52)
T TIGR02605         6 YRCTACGHRFEV   17 (52)
T ss_pred             EEeCCCCCEeEE
Confidence            455555555543


No 92 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=83.01  E-value=0.93  Score=22.03  Aligned_cols=21  Identities=33%  Similarity=0.594  Sum_probs=12.8

Q ss_pred             cccCccchhhcCH-----HHHHHHHH
Q psy12639         71 YACNLCTVRYLRS-----YELVLHLK   91 (134)
Q Consensus        71 ~~C~~C~~~f~~~-----~~l~~H~~   91 (134)
                      -.|..|++.++..     ++|.+|++
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            4566666655443     56777776


No 93 
>KOG2231|consensus
Probab=82.80  E-value=2.4  Score=32.29  Aligned_cols=65  Identities=26%  Similarity=0.435  Sum_probs=37.3

Q ss_pred             hHHHHHHHhccccCCC----ceecCCCCCccCChhhHHhHHhhhcCCCCcccCcc------chhhcCHHHHHHHHHhhc
Q psy12639         26 NSKLKIHYNLAHCTGE----MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLC------TVRYLRSYELVLHLKKCH   94 (134)
Q Consensus        26 ~~~l~~h~~~~h~~~~----~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C------~~~f~~~~~l~~H~~~~~   94 (134)
                      ...|..|++..-.+..    .-.|..|...|.....|..|++.++    |.|..|      +..|.....|..|-+..|
T Consensus       162 ~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  162 RAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             HHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            4556666654211111    1347777777777777777776544    333333      456677777777766554


No 94 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=82.54  E-value=0.42  Score=21.98  Aligned_cols=11  Identities=36%  Similarity=1.274  Sum_probs=5.3

Q ss_pred             eeCccchhhcc
Q psy12639         14 YACTECDQKFN   24 (134)
Q Consensus        14 ~~C~~C~~~f~   24 (134)
                      |.|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            44555554443


No 95 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=81.14  E-value=0.51  Score=22.54  Aligned_cols=11  Identities=27%  Similarity=1.023  Sum_probs=5.7

Q ss_pred             ceeCccchhhc
Q psy12639         13 PYACTECDQKF   23 (134)
Q Consensus        13 ~~~C~~C~~~f   23 (134)
                      .|.|+.||..|
T Consensus         3 ~y~C~~CG~~~   13 (46)
T PRK00398          3 EYKCARCGREV   13 (46)
T ss_pred             EEECCCCCCEE
Confidence            35555555444


No 96 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=80.12  E-value=0.31  Score=36.96  Aligned_cols=56  Identities=23%  Similarity=0.523  Sum_probs=26.1

Q ss_pred             eCccchhhccChHHHHHHHhccccCCCce-ecCCCCCccCChhhHHhHHhhhcCCCCcccCccch
Q psy12639         15 ACTECDQKFNRNSKLKIHYNLAHCTGEMY-ECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTV   78 (134)
Q Consensus        15 ~C~~C~~~f~~~~~l~~h~~~~h~~~~~~-~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   78 (134)
                      .|..||-.|.....|-.-..  ++.-..| .|+.|.+-+....+    .|.|.  .|..|+.||-
T Consensus       125 ~CT~CGPRfTIi~alPYDR~--nTsM~~F~lC~~C~~EY~dP~n----RRfHA--Qp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRE--NTSMADFPLCPFCDKEYKDPLN----RRFHA--QPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCCCcc--cCccccCcCCHHHHHHhcCccc----ccccc--ccccCcccCC
Confidence            35566666655544432221  2222222 36666665555443    23333  4456666663


No 97 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=79.74  E-value=1.1  Score=29.07  Aligned_cols=28  Identities=18%  Similarity=0.360  Sum_probs=21.5

Q ss_pred             CCceeCccchhhccChHHHHHHHhcccc
Q psy12639         11 AKPYACTECDQKFNRNSKLKIHYNLAHC   38 (134)
Q Consensus        11 ~~~~~C~~C~~~f~~~~~l~~h~~~~h~   38 (134)
                      +.-|.|+.|++.|.-...+..|+...|.
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCH
Confidence            3458999999999999999999987775


No 98 
>KOG2807|consensus
Probab=79.37  E-value=3.2  Score=28.77  Aligned_cols=67  Identities=18%  Similarity=0.404  Sum_probs=39.1

Q ss_pred             CceeCccchhhccChHHHHHHHhccccC-CCce------------ecCCCCCccCChhhHHhHHhhhcCCCCcccCccch
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCT-GEMY------------ECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTV   78 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~-~~~~------------~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   78 (134)
                      -|.+|+.|+...-+...|.+-..  |.- -++|            .|-.|+.             .-.+...|.|..|..
T Consensus       289 LP~eCpiC~ltLVss~hLARSyh--hL~PL~~F~Eip~~~~~~~~~Cf~C~~-------------~~~~~~~y~C~~Ck~  353 (378)
T KOG2807|consen  289 LPIECPICSLTLVSSPHLARSYH--HLFPLKPFVEIPETEYNGSRFCFACQG-------------ELLSSGRYRCESCKN  353 (378)
T ss_pred             CCccCCccceeEecchHHHHHHH--hhcCCcchhhccccccCCCcceeeecc-------------ccCCCCcEEchhccc
Confidence            46788899988887777765543  211 1111            1333411             112233488888888


Q ss_pred             hhcCHHHHHHHHHhh
Q psy12639         79 RYLRSYELVLHLKKC   93 (134)
Q Consensus        79 ~f~~~~~l~~H~~~~   93 (134)
                      .|-..-+.--|-..|
T Consensus       354 ~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  354 VFCLDCDVFIHESLH  368 (378)
T ss_pred             eeeccchHHHHhhhh
Confidence            888777777775554


No 99 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=78.48  E-value=2  Score=24.64  Aligned_cols=26  Identities=31%  Similarity=0.522  Sum_probs=21.1

Q ss_pred             ceec----CCCCCccCChhhHHhHHhhhcC
Q psy12639         42 MYEC----CHCARSFPCKSYLIPHLRVHTG   67 (134)
Q Consensus        42 ~~~C----~~C~~~~~~~~~l~~h~~~h~~   67 (134)
                      -|.|    ..|+....+...+..|.+.++|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3788    8899999999999999887543


No 100
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=78.30  E-value=2  Score=28.76  Aligned_cols=76  Identities=21%  Similarity=0.442  Sum_probs=34.2

Q ss_pred             CCCceeCccchhhccChHHHHHHHhc-cccCCCceecCCCCCccCCh------hhHHhHHhh----hcCCCCcccCccch
Q psy12639         10 GAKPYACTECDQKFNRNSKLKIHYNL-AHCTGEMYECCHCARSFPCK------SYLIPHLRV----HTGEKPYACNLCTV   78 (134)
Q Consensus        10 ~~~~~~C~~C~~~f~~~~~l~~h~~~-~h~~~~~~~C~~C~~~~~~~------~~l~~h~~~----h~~~~~~~C~~C~~   78 (134)
                      |.+.|.|..|.........+ .|+.+ .-.....|.|..|.+.....      .....|.+.    ....+++.||.|+.
T Consensus       139 GGrif~CsfC~~flCEDDQF-EHQAsCQvLe~E~~KC~SCNrlGq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg~  217 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLCEDDQF-EHQASCQVLESETFKCQSCNRLGQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKCGY  217 (314)
T ss_pred             CCeEEEeecCCCeeeccchh-hhhhhhhhhhcccccccccccccchhhhheeeeehhhhhhhcccccccCCCCCCCCCCC
Confidence            44566777766444333322 23221 00112245565555543222      122334332    12346677777776


Q ss_pred             hhcCHHHH
Q psy12639         79 RYLRSYEL   86 (134)
Q Consensus        79 ~f~~~~~l   86 (134)
                      .......|
T Consensus       218 et~eTkdL  225 (314)
T PF06524_consen  218 ETQETKDL  225 (314)
T ss_pred             cccccccc
Confidence            55554444


No 101
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=76.44  E-value=1.5  Score=33.89  Aligned_cols=13  Identities=23%  Similarity=0.544  Sum_probs=8.7

Q ss_pred             CCCCcccCccchh
Q psy12639         67 GEKPYACNLCTVR   79 (134)
Q Consensus        67 ~~~~~~C~~C~~~   79 (134)
                      ...|..|+.||..
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            3467778888743


No 102
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=76.21  E-value=1.2  Score=28.93  Aligned_cols=26  Identities=19%  Similarity=0.336  Sum_probs=14.0

Q ss_pred             CcccCccchhhcCHHHHHHHHHhhcC
Q psy12639         70 PYACNLCTVRYLRSYELVLHLKKCHR   95 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~l~~H~~~~~~   95 (134)
                      .|.|+.|+|.|.-..-.++|+..-|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            36666666666666666666655443


No 103
>KOG3408|consensus
Probab=76.18  E-value=2.1  Score=25.12  Aligned_cols=26  Identities=23%  Similarity=0.520  Sum_probs=21.8

Q ss_pred             CCCCcccCccchhhcCHHHHHHHHHh
Q psy12639         67 GEKPYACNLCTVRYLRSYELVLHLKK   92 (134)
Q Consensus        67 ~~~~~~C~~C~~~f~~~~~l~~H~~~   92 (134)
                      |.-.|.|-.|.+.|.....|..|.+.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            44458899999999999999999764


No 104
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=74.87  E-value=2.1  Score=25.67  Aligned_cols=25  Identities=20%  Similarity=0.345  Sum_probs=16.2

Q ss_pred             CCCcccCccchhhcCHHHHHHHHHhhcC
Q psy12639         68 EKPYACNLCTVRYLRSYELVLHLKKCHR   95 (134)
Q Consensus        68 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~   95 (134)
                      .....|-+||+.|...   ++|++.||+
T Consensus        70 ~d~i~clecGk~~k~L---krHL~~~~g   94 (132)
T PF05443_consen   70 PDYIICLECGKKFKTL---KRHLRTHHG   94 (132)
T ss_dssp             SS-EE-TBT--EESBH---HHHHHHTT-
T ss_pred             cCeeEEccCCcccchH---HHHHHHccC
Confidence            3446899999999864   899999975


No 105
>KOG4173|consensus
Probab=74.84  E-value=1.3  Score=28.56  Aligned_cols=84  Identities=15%  Similarity=0.311  Sum_probs=57.7

Q ss_pred             ceecCC--CCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHHHHhhc----------CCCCCCCC----CCC
Q psy12639         42 MYECCH--CARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCH----------REDARNPY----APA  105 (134)
Q Consensus        42 ~~~C~~--C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~----------~~~~~~~~----~~~  105 (134)
                      .|.|++  |...|.....+..|.-.-++   -.|..|.+.|.+...|..|+.--|          +...|.|-    +..
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            466876  76777777767666644222   368999999999999988875433          33456665    446


Q ss_pred             cccchhhhhhhhhhhcCCceeee
Q psy12639        106 FVDVNTVAQVKQEYEELPVKVEL  128 (134)
Q Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~~  128 (134)
                      |.+......|....+..|...+.
T Consensus       156 FkT~r~RkdH~I~~Hk~Pa~frF  178 (253)
T KOG4173|consen  156 FKTSRDRKDHMIRMHKYPADFRF  178 (253)
T ss_pred             hhhhhhhhhHHHHhccCCcceee
Confidence            77777777777777777766554


No 106
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=73.90  E-value=1.7  Score=23.92  Aligned_cols=30  Identities=20%  Similarity=0.512  Sum_probs=16.4

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhc
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYL   81 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~   81 (134)
                      ++.|+.|++.-        +.+  .+...+.|..|+..|.
T Consensus        35 ~~~Cp~C~~~~--------VkR--~a~GIW~C~kCg~~fA   64 (89)
T COG1997          35 KHVCPFCGRTT--------VKR--IATGIWKCRKCGAKFA   64 (89)
T ss_pred             CCcCCCCCCcc--------eee--eccCeEEcCCCCCeec
Confidence            46777776541        112  1223477777776664


No 107
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=73.78  E-value=0.95  Score=24.05  Aligned_cols=12  Identities=25%  Similarity=0.755  Sum_probs=5.6

Q ss_pred             eecC--CCCCccCC
Q psy12639         43 YECC--HCARSFPC   54 (134)
Q Consensus        43 ~~C~--~C~~~~~~   54 (134)
                      +.|.  .||.+|..
T Consensus        28 ~qC~N~eCg~tF~t   41 (72)
T PRK09678         28 HQCQNVNCSATFIT   41 (72)
T ss_pred             eecCCCCCCCEEEE
Confidence            4444  45555443


No 108
>KOG3408|consensus
Probab=73.56  E-value=3  Score=24.50  Aligned_cols=24  Identities=29%  Similarity=0.656  Sum_probs=13.8

Q ss_pred             CceeCccchhhccChHHHHHHHhc
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNL   35 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~   35 (134)
                      ..|.|-.|.+-|.....|+.|.++
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhc
Confidence            345566666666666666655543


No 109
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=73.38  E-value=2.3  Score=20.77  Aligned_cols=10  Identities=30%  Similarity=1.142  Sum_probs=5.2

Q ss_pred             eeCccchhhc
Q psy12639         14 YACTECDQKF   23 (134)
Q Consensus        14 ~~C~~C~~~f   23 (134)
                      |.|-.||+.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            4555555554


No 110
>KOG2482|consensus
Probab=72.67  E-value=7.6  Score=27.23  Aligned_cols=22  Identities=23%  Similarity=0.464  Sum_probs=20.5

Q ss_pred             cccCccchhhcCHHHHHHHHHh
Q psy12639         71 YACNLCTVRYLRSYELVLHLKK   92 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~~   92 (134)
                      +.|-.|.+.|..+..|+.||+.
T Consensus       196 ~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             heeeeeccccCCcHHHHHHHHh
Confidence            7899999999999999999984


No 111
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=72.12  E-value=3.1  Score=24.65  Aligned_cols=15  Identities=7%  Similarity=0.169  Sum_probs=7.9

Q ss_pred             CCcccCccchhhcCH
Q psy12639         69 KPYACNLCTVRYLRS   83 (134)
Q Consensus        69 ~~~~C~~C~~~f~~~   83 (134)
                      .|..|+.||..|...
T Consensus        25 ~p~vcP~cg~~~~~~   39 (129)
T TIGR02300        25 RPAVSPYTGEQFPPE   39 (129)
T ss_pred             CCccCCCcCCccCcc
Confidence            455555555555433


No 112
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=71.17  E-value=2.6  Score=30.73  Aligned_cols=29  Identities=24%  Similarity=0.556  Sum_probs=23.9

Q ss_pred             CceeCccchhhccChHHHHHHHhccccCC
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCTG   40 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~~   40 (134)
                      +.+.|+.|.+.|.....+..|+...|.+.
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            35789999999999999999998777653


No 113
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=69.38  E-value=3  Score=19.57  Aligned_cols=16  Identities=13%  Similarity=0.410  Sum_probs=11.0

Q ss_pred             ccCccchhhcCHHHHH
Q psy12639         72 ACNLCTVRYLRSYELV   87 (134)
Q Consensus        72 ~C~~C~~~f~~~~~l~   87 (134)
                      .|+.|++.|+.+..+.
T Consensus        10 ~C~~C~rpf~WRKKW~   25 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKWA   25 (42)
T ss_pred             cCcccCCcchHHHHHH
Confidence            4778888887765443


No 114
>KOG2593|consensus
Probab=68.98  E-value=4  Score=29.38  Aligned_cols=38  Identities=21%  Similarity=0.611  Sum_probs=22.8

Q ss_pred             CCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCcc
Q psy12639         11 AKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSF   52 (134)
Q Consensus        11 ~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~   52 (134)
                      ..-|.|+.|.+.|.....++.-..    ....|.|..|+.-.
T Consensus       126 ~~~Y~Cp~C~kkyt~Lea~~L~~~----~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  126 VAGYVCPNCQKKYTSLEALQLLDN----ETGEFHCENCGGEL  163 (436)
T ss_pred             cccccCCccccchhhhHHHHhhcc----cCceEEEecCCCch
Confidence            345788888888777655442221    22357788777553


No 115
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=68.79  E-value=2.2  Score=17.77  Aligned_cols=9  Identities=22%  Similarity=0.759  Sum_probs=4.8

Q ss_pred             ccCccchhh
Q psy12639         72 ACNLCTVRY   80 (134)
Q Consensus        72 ~C~~C~~~f   80 (134)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            355555555


No 116
>KOG2785|consensus
Probab=68.73  E-value=6.4  Score=27.89  Aligned_cols=53  Identities=26%  Similarity=0.407  Sum_probs=42.3

Q ss_pred             CceeCccchhhccChHHHHHHHhccccC----------------------CCceecCCCC---CccCChhhHHhHHhh
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCT----------------------GEMYECCHCA---RSFPCKSYLIPHLRV   64 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~----------------------~~~~~C~~C~---~~~~~~~~l~~h~~~   64 (134)
                      .|-.|-.|++.+.+...-..||...|.=                      ...+.|..|.   +.|.+-.....||..
T Consensus       165 ~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  165 IPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             CCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            4567899999999999999999874421                      1247888888   889999999999874


No 117
>PF12907 zf-met2:  Zinc-binding
Probab=68.57  E-value=4.1  Score=18.95  Aligned_cols=27  Identities=30%  Similarity=0.476  Sum_probs=14.9

Q ss_pred             eeCccchhhcc---ChHHHHHHHhccccCC
Q psy12639         14 YACTECDQKFN---RNSKLKIHYNLAHCTG   40 (134)
Q Consensus        14 ~~C~~C~~~f~---~~~~l~~h~~~~h~~~   40 (134)
                      +.|.+|..+|.   ....|..|....|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            35667764444   3344666666555543


No 118
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=67.17  E-value=2.6  Score=18.26  Aligned_cols=7  Identities=29%  Similarity=0.899  Sum_probs=3.2

Q ss_pred             eecCCCC
Q psy12639         43 YECCHCA   49 (134)
Q Consensus        43 ~~C~~C~   49 (134)
                      +.|+.|+
T Consensus        20 ~vCp~C~   26 (30)
T PF08274_consen   20 LVCPECG   26 (30)
T ss_dssp             EEETTTT
T ss_pred             EeCCccc
Confidence            4444443


No 119
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=64.72  E-value=3  Score=20.15  Aligned_cols=12  Identities=25%  Similarity=0.885  Sum_probs=5.7

Q ss_pred             eeCccchhhccC
Q psy12639         14 YACTECDQKFNR   25 (134)
Q Consensus        14 ~~C~~C~~~f~~   25 (134)
                      |.|..|+..+..
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            445555544443


No 120
>KOG4167|consensus
Probab=64.53  E-value=1.9  Score=33.07  Aligned_cols=27  Identities=22%  Similarity=0.481  Sum_probs=23.0

Q ss_pred             CceeCccchhhccChHHHHHHHhccccC
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCT   39 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~   39 (134)
                      ..|.|.+|++.|--..++..||++ |.-
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~-Hr~  817 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKT-HRQ  817 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHH-HHH
Confidence            458999999999999999999987 653


No 121
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=64.21  E-value=4.9  Score=19.10  Aligned_cols=22  Identities=32%  Similarity=0.579  Sum_probs=17.7

Q ss_pred             eeCccchhhccChHHHHHHHhc
Q psy12639         14 YACTECDQKFNRNSKLKIHYNL   35 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~   35 (134)
                      |.|-.|..+...++.|-.||+-
T Consensus        21 ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHH
Confidence            6788888888888888888863


No 122
>KOG4167|consensus
Probab=64.11  E-value=2.5  Score=32.53  Aligned_cols=25  Identities=16%  Similarity=0.406  Sum_probs=22.5

Q ss_pred             CcccCccchhhcCHHHHHHHHHhhc
Q psy12639         70 PYACNLCTVRYLRSYELVLHLKKCH   94 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~l~~H~~~~~   94 (134)
                      .|.|..|+|.|..-..+..||+.|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            3899999999999999999998875


No 123
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=64.11  E-value=4  Score=16.68  Aligned_cols=8  Identities=25%  Similarity=0.990  Sum_probs=4.2

Q ss_pred             ceecCCCC
Q psy12639         42 MYECCHCA   49 (134)
Q Consensus        42 ~~~C~~C~   49 (134)
                      +|.|+.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            35555554


No 124
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=63.46  E-value=7.9  Score=16.99  Aligned_cols=7  Identities=29%  Similarity=0.804  Sum_probs=3.2

Q ss_pred             cccCccc
Q psy12639         71 YACNLCT   77 (134)
Q Consensus        71 ~~C~~C~   77 (134)
                      ..|+.||
T Consensus        18 irC~~CG   24 (32)
T PF03604_consen   18 IRCPECG   24 (32)
T ss_dssp             SSBSSSS
T ss_pred             EECCcCC
Confidence            3444444


No 125
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=62.74  E-value=5.5  Score=19.45  Aligned_cols=14  Identities=21%  Similarity=0.584  Sum_probs=7.3

Q ss_pred             ceecCCCCCccCCh
Q psy12639         42 MYECCHCARSFPCK   55 (134)
Q Consensus        42 ~~~C~~C~~~~~~~   55 (134)
                      .+.|..||..|...
T Consensus         4 ~l~C~dCg~~FvfT   17 (49)
T PF13451_consen    4 TLTCKDCGAEFVFT   17 (49)
T ss_pred             eEEcccCCCeEEEe
Confidence            45555565555443


No 126
>KOG1280|consensus
Probab=62.74  E-value=8.6  Score=26.96  Aligned_cols=26  Identities=15%  Similarity=0.255  Sum_probs=15.4

Q ss_pred             ceeCccchhhccChHHHHHHHhcccc
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNLAHC   38 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~~h~   38 (134)
                      .|+|+.|+..--+...|..|....|.
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hp  104 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHP  104 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCc
Confidence            46666666666666666666655443


No 127
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=62.24  E-value=4.6  Score=23.51  Aligned_cols=12  Identities=25%  Similarity=0.628  Sum_probs=7.7

Q ss_pred             eecCCCCCccCC
Q psy12639         43 YECCHCARSFPC   54 (134)
Q Consensus        43 ~~C~~C~~~~~~   54 (134)
                      ..|..|+..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (115)
T TIGR00100        71 CECEDCSEEVSP   82 (115)
T ss_pred             EEcccCCCEEec
Confidence            567777766543


No 128
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=61.27  E-value=3.8  Score=24.61  Aligned_cols=13  Identities=15%  Similarity=0.726  Sum_probs=8.1

Q ss_pred             ceecCCCCCccCC
Q psy12639         42 MYECCHCARSFPC   54 (134)
Q Consensus        42 ~~~C~~C~~~~~~   54 (134)
                      .+.|..||..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            3667777766544


No 129
>KOG2907|consensus
Probab=60.82  E-value=3.6  Score=23.79  Aligned_cols=38  Identities=24%  Similarity=0.495  Sum_probs=21.1

Q ss_pred             eecCCCCCccCChhhHHhHHhhh-cCC-CCcccCccchhhcC
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVH-TGE-KPYACNLCTVRYLR   82 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h-~~~-~~~~C~~C~~~f~~   82 (134)
                      ..|+.||..--....++  +|+. .|. .-|.|+.|+..|+.
T Consensus        75 ~kCpkCghe~m~Y~T~Q--lRSADEGQTVFYTC~kC~~k~~e  114 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQ--LRSADEGQTVFYTCPKCKYKFTE  114 (116)
T ss_pred             ccCcccCCchhhhhhhh--cccccCCceEEEEcCccceeeec
Confidence            46888876543333332  2322 222 34888888887753


No 130
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=60.53  E-value=0.83  Score=21.19  Aligned_cols=8  Identities=38%  Similarity=1.252  Sum_probs=3.6

Q ss_pred             eecCCCCC
Q psy12639         43 YECCHCAR   50 (134)
Q Consensus        43 ~~C~~C~~   50 (134)
                      |.|..|+.
T Consensus        29 y~C~~C~~   36 (40)
T smart00440       29 YVCTKCGH   36 (40)
T ss_pred             EEeCCCCC
Confidence            44444443


No 131
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=59.75  E-value=2.9  Score=20.61  Aligned_cols=20  Identities=25%  Similarity=0.559  Sum_probs=6.9

Q ss_pred             ceecCCCCCccCChhhHHhH
Q psy12639         42 MYECCHCARSFPCKSYLIPH   61 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h   61 (134)
                      .|.|+.|...|-..-.+-.|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTT
T ss_pred             eEECCCCCCccccCcChhhh
Confidence            45555555555444443333


No 132
>KOG1842|consensus
Probab=59.15  E-value=7.3  Score=28.27  Aligned_cols=27  Identities=26%  Similarity=0.389  Sum_probs=19.4

Q ss_pred             CcccCccchhhcCHHHHHHHHHhhcCC
Q psy12639         70 PYACNLCTVRYLRSYELVLHLKKCHRE   96 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~l~~H~~~~~~~   96 (134)
                      .|.||+|.+.|.+...|..|...-|.+
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhccc
Confidence            477777777777777777777665544


No 133
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=58.21  E-value=9.8  Score=18.03  Aligned_cols=9  Identities=33%  Similarity=1.143  Sum_probs=5.3

Q ss_pred             eecCCCCCc
Q psy12639         43 YECCHCARS   51 (134)
Q Consensus        43 ~~C~~C~~~   51 (134)
                      +.|+.|+..
T Consensus        19 ~~CP~Cg~~   27 (46)
T PF12760_consen   19 FVCPHCGST   27 (46)
T ss_pred             CCCCCCCCe
Confidence            556666653


No 134
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=58.05  E-value=5.4  Score=19.91  Aligned_cols=9  Identities=33%  Similarity=0.925  Sum_probs=4.0

Q ss_pred             ecCCCCCcc
Q psy12639         44 ECCHCARSF   52 (134)
Q Consensus        44 ~C~~C~~~~   52 (134)
                      .|+.|+..+
T Consensus         4 ~CP~CG~~i   12 (54)
T TIGR01206         4 ECPDCGAEI   12 (54)
T ss_pred             CCCCCCCEE
Confidence            444444433


No 135
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=57.72  E-value=6.4  Score=22.85  Aligned_cols=10  Identities=20%  Similarity=0.587  Sum_probs=6.5

Q ss_pred             eecCCCCCcc
Q psy12639         43 YECCHCARSF   52 (134)
Q Consensus        43 ~~C~~C~~~~   52 (134)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (113)
T PRK12380         71 AWCWDCSQVV   80 (113)
T ss_pred             EEcccCCCEE
Confidence            5677777555


No 136
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=57.30  E-value=2.9  Score=27.53  Aligned_cols=8  Identities=25%  Similarity=0.870  Sum_probs=5.2

Q ss_pred             cccCccch
Q psy12639         71 YACNLCTV   78 (134)
Q Consensus        71 ~~C~~C~~   78 (134)
                      ..||.|..
T Consensus        63 vvCP~C~y   70 (267)
T COG1655          63 VVCPICYY   70 (267)
T ss_pred             EEcchhhH
Confidence            36777764


No 137
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=56.80  E-value=13  Score=25.45  Aligned_cols=30  Identities=30%  Similarity=0.553  Sum_probs=24.9

Q ss_pred             CCCCcccCccchhhcCHHHHHHHHHhhcCC
Q psy12639         67 GEKPYACNLCTVRYLRSYELVLHLKKCHRE   96 (134)
Q Consensus        67 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   96 (134)
                      ....|.|..|-+.|.+...+.+|+..+...
T Consensus        45 ~~~lyiCe~Clky~~~~~~l~~H~~~C~~r   74 (290)
T PLN03238         45 CTKLYICEYCLKYMRKKKSLLRHLAKCDIR   74 (290)
T ss_pred             CCeEEEcCCCcchhCCHHHHHHHHHhCCCC
Confidence            355699999999999999999999876543


No 138
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=56.64  E-value=9.7  Score=19.10  Aligned_cols=10  Identities=20%  Similarity=0.753  Sum_probs=4.9

Q ss_pred             CCcccCccch
Q psy12639         69 KPYACNLCTV   78 (134)
Q Consensus        69 ~~~~C~~C~~   78 (134)
                      ..|.|+.||-
T Consensus        13 v~~~Cp~cGi   22 (55)
T PF13824_consen   13 VNFECPDCGI   22 (55)
T ss_pred             cCCcCCCCCC
Confidence            3455555553


No 139
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=56.56  E-value=7.4  Score=22.29  Aligned_cols=24  Identities=21%  Similarity=0.299  Sum_probs=19.8

Q ss_pred             CCCcccCccchhhcCHHHHHHHHH
Q psy12639         68 EKPYACNLCTVRYLRSYELVLHLK   91 (134)
Q Consensus        68 ~~~~~C~~C~~~f~~~~~l~~H~~   91 (134)
                      .-.+.|-.|.+.|.+...|..|.+
T Consensus        53 lGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          53 LGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CceeeeehhHHHHHHHHHHHHHhc
Confidence            334678899999999999999976


No 140
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=56.28  E-value=9  Score=19.75  Aligned_cols=15  Identities=13%  Similarity=0.456  Sum_probs=9.1

Q ss_pred             CCCCcccCccchhhc
Q psy12639         67 GEKPYACNLCTVRYL   81 (134)
Q Consensus        67 ~~~~~~C~~C~~~f~   81 (134)
                      ..+.|.|+.||..+.
T Consensus        43 ~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   43 SGRVFTCPNCGFEMD   57 (69)
T ss_pred             ccceEEcCCCCCEEC
Confidence            344577777776543


No 141
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=55.29  E-value=14  Score=18.34  Aligned_cols=34  Identities=21%  Similarity=0.548  Sum_probs=14.5

Q ss_pred             CceeCcc--chhhccChHHHHHHHhccccCCCceecCC
Q psy12639         12 KPYACTE--CDQKFNRNSKLKIHYNLAHCTGEMYECCH   47 (134)
Q Consensus        12 ~~~~C~~--C~~~f~~~~~l~~h~~~~h~~~~~~~C~~   47 (134)
                      .+..|+.  |...+. ...|..|+.. .-...+-.|..
T Consensus         8 ~~v~C~~~cc~~~i~-r~~l~~H~~~-~C~~~~v~C~~   43 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIP-RKELDDHLEN-ECPKRPVPCPY   43 (60)
T ss_dssp             SEEE-TT--S-BEEE-CCCHHHHHHT-TSTTSEEE-SS
T ss_pred             CEeeCCCCCccccee-HHHHHHHHHc-cCCCCcEECCC
Confidence            3455655  333233 3446666653 33334455555


No 142
>KOG0978|consensus
Probab=55.17  E-value=4.9  Score=30.92  Aligned_cols=19  Identities=11%  Similarity=0.277  Sum_probs=13.1

Q ss_pred             CCCCcccCccchhhcCHHH
Q psy12639         67 GEKPYACNLCTVRYLRSYE   85 (134)
Q Consensus        67 ~~~~~~C~~C~~~f~~~~~   85 (134)
                      .-+.-.||.|+.+|....-
T Consensus       675 etRqRKCP~Cn~aFganDv  693 (698)
T KOG0978|consen  675 ETRQRKCPKCNAAFGANDV  693 (698)
T ss_pred             HHhcCCCCCCCCCCCcccc
Confidence            3455678888888876544


No 143
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=54.41  E-value=7  Score=17.94  Aligned_cols=14  Identities=21%  Similarity=0.717  Sum_probs=11.3

Q ss_pred             ceeCccchhhccCh
Q psy12639         13 PYACTECDQKFNRN   26 (134)
Q Consensus        13 ~~~C~~C~~~f~~~   26 (134)
                      |+.|..|++.|...
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899898888764


No 144
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=54.22  E-value=6.9  Score=21.78  Aligned_cols=13  Identities=15%  Similarity=0.391  Sum_probs=8.4

Q ss_pred             CcccCccchhhcC
Q psy12639         70 PYACNLCTVRYLR   82 (134)
Q Consensus        70 ~~~C~~C~~~f~~   82 (134)
                      .+.|..|++.|.-
T Consensus        54 IW~C~~C~~~~AG   66 (90)
T PTZ00255         54 IWRCKGCKKTVAG   66 (90)
T ss_pred             EEEcCCCCCEEeC
Confidence            4677777766643


No 145
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=54.16  E-value=11  Score=23.80  Aligned_cols=32  Identities=16%  Similarity=0.502  Sum_probs=16.9

Q ss_pred             CCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchh
Q psy12639         39 TGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVR   79 (134)
Q Consensus        39 ~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~   79 (134)
                      ...-|.|+.|...++...+..      .   .|.|+.||..
T Consensus       110 ~~~~y~C~~~~~r~sfdeA~~------~---~F~Cp~Cg~~  141 (176)
T COG1675         110 ENNYYVCPNCHVKYSFDEAME------L---GFTCPKCGED  141 (176)
T ss_pred             cCCceeCCCCCCcccHHHHHH------h---CCCCCCCCch
Confidence            334566766665554443321      1   1677777743


No 146
>KOG0717|consensus
Probab=52.49  E-value=8  Score=28.27  Aligned_cols=28  Identities=29%  Similarity=0.479  Sum_probs=23.0

Q ss_pred             cccCccchhhcCHHHHHHHHHh-hcCCCC
Q psy12639         71 YACNLCTVRYLRSYELVLHLKK-CHREDA   98 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~~-~~~~~~   98 (134)
                      ..|..|+..|.++.-|..|++. .|+..+
T Consensus       461 ~~C~tCr~~FdSRnkLF~Hlk~tgHa~~~  489 (508)
T KOG0717|consen  461 ISCTTCRESFDSRNKLFAHLKKTGHARLP  489 (508)
T ss_pred             HhhhhhhhhccchhHHHHHhhhcCCeecc
Confidence            5789999999999999999874 555543


No 147
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=52.38  E-value=15  Score=25.52  Aligned_cols=77  Identities=21%  Similarity=0.461  Sum_probs=44.6

Q ss_pred             ceeCccchhhccChHHHHHHHhcccc-------------CCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchh
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNLAHC-------------TGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVR   79 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~~h~-------------~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~   79 (134)
                      |..|+.|.........|..-..  |.             ..+.--|-.|...|.....-.--  .-+....|.|+.|...
T Consensus       322 Pi~CP~Csl~LilsthLarSyh--hL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~~~~~--~~~ss~rY~Ce~CK~~  397 (421)
T COG5151         322 PISCPICSLQLILSTHLARSYH--HLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPVSPFD--ESTSSGRYQCELCKST  397 (421)
T ss_pred             CccCcchhHHHHHHHHHHHHHH--hhccCcccccccCCCCCCCccceeccCCCCCCCCCccc--ccccccceechhhhhh
Confidence            4567777766555555543331  11             11112366777777554321100  0123445999999999


Q ss_pred             hcCHHHHHHHHHhh
Q psy12639         80 YLRSYELVLHLKKC   93 (134)
Q Consensus        80 f~~~~~l~~H~~~~   93 (134)
                      |-..-+.-.|-..|
T Consensus       398 FC~dCdvfiHe~Lh  411 (421)
T COG5151         398 FCSDCDVFIHETLH  411 (421)
T ss_pred             hhhhhHHHHHHHHh
Confidence            99998888887765


No 148
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=52.18  E-value=8.5  Score=22.50  Aligned_cols=10  Identities=40%  Similarity=1.062  Sum_probs=6.1

Q ss_pred             eecCCCCCcc
Q psy12639         43 YECCHCARSF   52 (134)
Q Consensus        43 ~~C~~C~~~~   52 (134)
                      +.|..|+..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            5566666554


No 149
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=52.15  E-value=15  Score=16.79  Aligned_cols=21  Identities=19%  Similarity=0.295  Sum_probs=8.1

Q ss_pred             CcccCccchhhc--CHHHHHHHH
Q psy12639         70 PYACNLCTVRYL--RSYELVLHL   90 (134)
Q Consensus        70 ~~~C~~C~~~f~--~~~~l~~H~   90 (134)
                      .|-|+.|...|+  +.+..+.|.
T Consensus         3 ryyCdyC~~~~~~d~~~~Rk~H~   25 (38)
T PF06220_consen    3 RYYCDYCKKYLTHDSPSIRKQHE   25 (38)
T ss_dssp             S-B-TTT--B-S--SHHHHHHHT
T ss_pred             CeecccccceecCCChHHHHHhh
Confidence            366777777773  223445553


No 150
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=52.08  E-value=6.1  Score=19.12  Aligned_cols=15  Identities=13%  Similarity=0.441  Sum_probs=10.2

Q ss_pred             ccCccchhhcCHHHH
Q psy12639         72 ACNLCTVRYLRSYEL   86 (134)
Q Consensus        72 ~C~~C~~~f~~~~~l   86 (134)
                      .|+.|++.|+.+..+
T Consensus        14 ICpvCqRPFsWRkKW   28 (54)
T COG4338          14 ICPVCQRPFSWRKKW   28 (54)
T ss_pred             hhhhhcCchHHHHHH
Confidence            477777777766544


No 151
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=51.64  E-value=5.1  Score=19.73  Aligned_cols=12  Identities=25%  Similarity=0.534  Sum_probs=6.1

Q ss_pred             ccCccchhhcCH
Q psy12639         72 ACNLCTVRYLRS   83 (134)
Q Consensus        72 ~C~~C~~~f~~~   83 (134)
                      .||.|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            788888888654


No 152
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=50.65  E-value=8  Score=28.69  Aligned_cols=9  Identities=33%  Similarity=0.907  Sum_probs=5.3

Q ss_pred             CcccCccch
Q psy12639         70 PYACNLCTV   78 (134)
Q Consensus        70 ~~~C~~C~~   78 (134)
                      |..|+.|+.
T Consensus       253 ~~~Cp~C~s  261 (505)
T TIGR00595       253 PKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCC
Confidence            456666654


No 153
>KOG4727|consensus
Probab=49.99  E-value=8.8  Score=24.06  Aligned_cols=21  Identities=29%  Similarity=0.525  Sum_probs=19.8

Q ss_pred             eeCccchhhccChHHHHHHHh
Q psy12639         14 YACTECDQKFNRNSKLKIHYN   34 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~   34 (134)
                      |-|.+|.-.|....++..|++
T Consensus        76 yyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   76 YYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             eeeeecceeehhhHHHHHHhc
Confidence            899999999999999999996


No 154
>PLN02294 cytochrome c oxidase subunit Vb
Probab=49.87  E-value=8.7  Score=24.08  Aligned_cols=14  Identities=36%  Similarity=0.861  Sum_probs=10.4

Q ss_pred             CceeCccchhhccC
Q psy12639         12 KPYACTECDQKFNR   25 (134)
Q Consensus        12 ~~~~C~~C~~~f~~   25 (134)
                      +|..|+.||..|..
T Consensus       140 kp~RCpeCG~~fkL  153 (174)
T PLN02294        140 KSFECPVCTQYFEL  153 (174)
T ss_pred             CceeCCCCCCEEEE
Confidence            57788888877754


No 155
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=49.76  E-value=8.4  Score=21.49  Aligned_cols=12  Identities=17%  Similarity=0.803  Sum_probs=7.9

Q ss_pred             CcccCccchhhc
Q psy12639         70 PYACNLCTVRYL   81 (134)
Q Consensus        70 ~~~C~~C~~~f~   81 (134)
                      .+.|..|++.|.
T Consensus        53 IW~C~~C~~~~A   64 (91)
T TIGR00280        53 IWTCRKCGAKFA   64 (91)
T ss_pred             EEEcCCCCCEEe
Confidence            467777776664


No 156
>PRK14873 primosome assembly protein PriA; Provisional
Probab=49.59  E-value=8.3  Score=29.71  Aligned_cols=9  Identities=22%  Similarity=0.763  Sum_probs=5.9

Q ss_pred             CcccCccch
Q psy12639         70 PYACNLCTV   78 (134)
Q Consensus        70 ~~~C~~C~~   78 (134)
                      ++.|+.||.
T Consensus       422 p~~Cp~Cgs  430 (665)
T PRK14873        422 DWRCPRCGS  430 (665)
T ss_pred             CccCCCCcC
Confidence            566777764


No 157
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=48.65  E-value=5.3  Score=18.03  Aligned_cols=10  Identities=20%  Similarity=0.976  Sum_probs=5.2

Q ss_pred             eCccchhhcc
Q psy12639         15 ACTECDQKFN   24 (134)
Q Consensus        15 ~C~~C~~~f~   24 (134)
                      .|+.||..|.
T Consensus         3 ~C~~Cg~~Yh   12 (36)
T PF05191_consen    3 ICPKCGRIYH   12 (36)
T ss_dssp             EETTTTEEEE
T ss_pred             CcCCCCCccc
Confidence            4555555543


No 158
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=47.56  E-value=6.8  Score=18.31  Aligned_cols=16  Identities=25%  Similarity=0.812  Sum_probs=9.9

Q ss_pred             CceeCccchhhccChH
Q psy12639         12 KPYACTECDQKFNRNS   27 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~   27 (134)
                      -|+.|..|+..|-...
T Consensus        12 ~~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLKH   27 (43)
T ss_dssp             SHEE-TTTS-EE-TTT
T ss_pred             CCeECCCCCcccCccc
Confidence            4788999998887643


No 159
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=47.34  E-value=32  Score=19.64  Aligned_cols=41  Identities=10%  Similarity=0.094  Sum_probs=31.8

Q ss_pred             CceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCC
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPC   54 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~   54 (134)
                      ..|.|+.-|..|.+...+...+..  -..+.|.|...|+.-.+
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~--y~~~vwtC~~TGk~~LT   42 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMIL--YNQRVWTCEITGKSNLT   42 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHH--HhCCeeEEecCCCCCCC
Confidence            457889999999999998887753  45567899988876544


No 160
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=46.89  E-value=9.5  Score=21.58  Aligned_cols=21  Identities=24%  Similarity=0.509  Sum_probs=15.0

Q ss_pred             hHHhhhcCCCCcccCccchhhc
Q psy12639         60 PHLRVHTGEKPYACNLCTVRYL   81 (134)
Q Consensus        60 ~h~~~h~~~~~~~C~~C~~~f~   81 (134)
                      ..+..+.+ ++..|+.||..|.
T Consensus        70 ~W~~l~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          70 IWMWLEKG-KPKRCPECGHVFK   90 (97)
T ss_pred             EEEEEeCC-CceeCCCCCcEEE
Confidence            33445555 7899999998875


No 161
>KOG1842|consensus
Probab=46.70  E-value=13  Score=27.16  Aligned_cols=27  Identities=22%  Similarity=0.420  Sum_probs=23.8

Q ss_pred             ceeCccchhhccChHHHHHHHhccccC
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNLAHCT   39 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~~h~~   39 (134)
                      -|.||+|..-|.....|..|....|.+
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~eH~~   41 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDVEHFE   41 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhhhccc
Confidence            389999999999999999999876754


No 162
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=46.65  E-value=9.4  Score=22.12  Aligned_cols=12  Identities=25%  Similarity=0.894  Sum_probs=5.3

Q ss_pred             eeCccchhhccC
Q psy12639         14 YACTECDQKFNR   25 (134)
Q Consensus        14 ~~C~~C~~~f~~   25 (134)
                      +.|..||..|..
T Consensus        71 ~~C~~Cg~~~~~   82 (113)
T PF01155_consen   71 ARCRDCGHEFEP   82 (113)
T ss_dssp             EEETTTS-EEEC
T ss_pred             EECCCCCCEEec
Confidence            345555555433


No 163
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=46.37  E-value=72  Score=19.93  Aligned_cols=52  Identities=19%  Similarity=0.248  Sum_probs=32.8

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCc--cchhhcCHHHHHHHHHhhcC
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNL--CTVRYLRSYELVLHLKKCHR   95 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~   95 (134)
                      ...|+.|.......... .-.+.+...|+-.|..  |.. -.+...|++|.+..|.
T Consensus        80 ~L~CPLCRG~V~GWtvv-e~AR~~LN~K~RsC~~e~C~F-~GtY~eLrKHar~~HP  133 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVV-EPARRFLNAKKRSCSQESCSF-SGTYSELRKHARSEHP  133 (162)
T ss_pred             cccCccccCceeceEEc-hHHHHHhccCCccCccccccc-ccCHHHHHHHHHhhCC
Confidence            46788887665544333 3356666777766654  442 3567788999887554


No 164
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=45.72  E-value=18  Score=26.46  Aligned_cols=29  Identities=34%  Similarity=0.623  Sum_probs=24.7

Q ss_pred             CCCcccCccchhhcCHHHHHHHHHhhcCC
Q psy12639         68 EKPYACNLCTVRYLRSYELVLHLKKCHRE   96 (134)
Q Consensus        68 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   96 (134)
                      ...|.|..|-+.|.....+.+|+..+...
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~C~~~  224 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKKCDLK  224 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhcCCCC
Confidence            45699999999999999999999876543


No 165
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=45.29  E-value=15  Score=17.62  Aligned_cols=7  Identities=29%  Similarity=1.203  Sum_probs=3.3

Q ss_pred             cccCccc
Q psy12639         71 YACNLCT   77 (134)
Q Consensus        71 ~~C~~C~   77 (134)
                      +.|+.||
T Consensus        21 ~vC~~Cg   27 (52)
T smart00661       21 FVCRKCG   27 (52)
T ss_pred             EECCcCC
Confidence            4444444


No 166
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=45.19  E-value=18  Score=26.69  Aligned_cols=32  Identities=13%  Similarity=0.367  Sum_probs=25.7

Q ss_pred             hcCCCCcccCccchhhcCHHHHHHHHHhhcCC
Q psy12639         65 HTGEKPYACNLCTVRYLRSYELVLHLKKCHRE   96 (134)
Q Consensus        65 h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   96 (134)
                      +...+-+.|+.|.+.|.....+..|+...|..
T Consensus        52 n~sWrFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   52 NKSWRFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             cCceeEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            34456689999999999999999999865543


No 167
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=44.72  E-value=9.3  Score=22.22  Aligned_cols=10  Identities=20%  Similarity=0.481  Sum_probs=6.3

Q ss_pred             eecCCCCCcc
Q psy12639         43 YECCHCARSF   52 (134)
Q Consensus        43 ~~C~~C~~~~   52 (134)
                      +.|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            5677777544


No 168
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=44.69  E-value=15  Score=26.56  Aligned_cols=14  Identities=21%  Similarity=0.612  Sum_probs=7.9

Q ss_pred             CcccCccchhhcCH
Q psy12639         70 PYACNLCTVRYLRS   83 (134)
Q Consensus        70 ~~~C~~C~~~f~~~   83 (134)
                      -|.|+.||..+...
T Consensus       367 g~rC~kCg~~~~~~  380 (421)
T COG1571         367 GFRCKKCGTRARET  380 (421)
T ss_pred             CcccccccccCCcc
Confidence            56666666555443


No 169
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=44.12  E-value=8.4  Score=21.46  Aligned_cols=30  Identities=27%  Similarity=0.652  Sum_probs=16.8

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhc
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYL   81 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~   81 (134)
                      .|.|+.|++.-..        +...  -.+.|..|++.|.
T Consensus        35 ky~Cp~Cgk~~vk--------R~a~--GIW~C~~C~~~~A   64 (90)
T PF01780_consen   35 KYTCPFCGKTSVK--------RVAT--GIWKCKKCGKKFA   64 (90)
T ss_dssp             -BEESSSSSSEEE--------EEET--TEEEETTTTEEEE
T ss_pred             CCcCCCCCCceeE--------Eeee--EEeecCCCCCEEe
Confidence            5778888765311        1122  2377888877664


No 170
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=44.09  E-value=13  Score=18.17  Aligned_cols=9  Identities=22%  Similarity=0.796  Sum_probs=4.8

Q ss_pred             CcccCccch
Q psy12639         70 PYACNLCTV   78 (134)
Q Consensus        70 ~~~C~~C~~   78 (134)
                      .+.|..||.
T Consensus        37 r~~C~~Cgy   45 (50)
T PRK00432         37 RWHCGKCGY   45 (50)
T ss_pred             cEECCCcCC
Confidence            355555554


No 171
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=43.84  E-value=14  Score=22.80  Aligned_cols=34  Identities=29%  Similarity=0.606  Sum_probs=19.7

Q ss_pred             CceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchh
Q psy12639         41 EMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVR   79 (134)
Q Consensus        41 ~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~   79 (134)
                      -+|.|. |+..+...   ..|-..-.|+ .|.|..|+-.
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            367888 88776543   2233333344 6888887643


No 172
>KOG4602|consensus
Probab=43.71  E-value=9.1  Score=25.69  Aligned_cols=38  Identities=16%  Similarity=0.324  Sum_probs=23.2

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcC-------CCCcccCccchh
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTG-------EKPYACNLCTVR   79 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~-------~~~~~C~~C~~~   79 (134)
                      +..|.+|...-....-+..|......       .+.|.|++||-.
T Consensus       233 ~l~CvFC~nN~E~~A~y~tH~lkd~dgRVLCPkLR~YVCPiCGAT  277 (318)
T KOG4602|consen  233 PLCCVFCFNNAEEFARYHTHPLKDKDGRVLCPKLRSYVCPICGAT  277 (318)
T ss_pred             ceeEEeecCCCchhhheecccccCCCCcEechhHhhhcCcccccc
Confidence            45677777666555566666543332       244888888853


No 173
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=43.62  E-value=16  Score=19.60  Aligned_cols=9  Identities=56%  Similarity=1.494  Sum_probs=4.5

Q ss_pred             eeCccchhh
Q psy12639         14 YACTECDQK   22 (134)
Q Consensus        14 ~~C~~C~~~   22 (134)
                      |+|..|+..
T Consensus        13 Y~c~~cg~~   21 (82)
T COG2331          13 YECTECGNR   21 (82)
T ss_pred             EeecccchH
Confidence            445555544


No 174
>KOG0782|consensus
Probab=43.44  E-value=3.2  Score=31.12  Aligned_cols=50  Identities=22%  Similarity=0.452  Sum_probs=23.8

Q ss_pred             HHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCC-CCcccCccchhhcCHH
Q psy12639         28 KLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGE-KPYACNLCTVRYLRSY   84 (134)
Q Consensus        28 ~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~-~~~~C~~C~~~f~~~~   84 (134)
                      .+..|-.. |.....-.|..|++.|..+-.+      |..+ ....|.+|..+|-...
T Consensus       240 ~fvrHHWV-HrrRqeGkC~~CgKgFQQKf~F------hsKEivAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  240 GFVRHHWV-HRRRQEGKCNTCGKGFQQKFFF------HSKEIVAISCSWCKQAYHLKV  290 (1004)
T ss_pred             cchHHhHh-hHhhhccccchhhhhhhhheee------ccccEEEEEehHHHHHhhcch
Confidence            44444443 4444444566666665443222      2222 2345666665554443


No 175
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=43.20  E-value=12  Score=20.90  Aligned_cols=12  Identities=17%  Similarity=0.786  Sum_probs=7.9

Q ss_pred             CcccCccchhhc
Q psy12639         70 PYACNLCTVRYL   81 (134)
Q Consensus        70 ~~~C~~C~~~f~   81 (134)
                      .+.|..|++.|.
T Consensus        54 IW~C~~C~~~~A   65 (90)
T PRK03976         54 IWECRKCGAKFA   65 (90)
T ss_pred             EEEcCCCCCEEe
Confidence            467777776664


No 176
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=42.88  E-value=9.5  Score=17.73  Aligned_cols=11  Identities=27%  Similarity=1.056  Sum_probs=5.8

Q ss_pred             ceeCccchhhc
Q psy12639         13 PYACTECDQKF   23 (134)
Q Consensus        13 ~~~C~~C~~~f   23 (134)
                      +..|+.|+..|
T Consensus        29 ~~~CpYCg~~y   39 (40)
T PF10276_consen   29 PVVCPYCGTRY   39 (40)
T ss_dssp             EEEETTTTEEE
T ss_pred             eEECCCCCCEE
Confidence            45555555544


No 177
>PTZ00064 histone acetyltransferase; Provisional
Probab=42.80  E-value=24  Score=26.31  Aligned_cols=29  Identities=24%  Similarity=0.489  Sum_probs=24.9

Q ss_pred             CCCcccCccchhhcCHHHHHHHHHhhcCC
Q psy12639         68 EKPYACNLCTVRYLRSYELVLHLKKCHRE   96 (134)
Q Consensus        68 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   96 (134)
                      ...|.|..|-+.|.....|.+|+..+...
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~C~~r  306 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSRCQLR  306 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhcCCCC
Confidence            45699999999999999999999877543


No 178
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=42.58  E-value=9.8  Score=21.18  Aligned_cols=29  Identities=21%  Similarity=0.638  Sum_probs=19.2

Q ss_pred             CceeCccchhhccChHHHHHHHhccccCCCceecCCCCCc
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARS   51 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~   51 (134)
                      .|..|..||..|....           -..|-.|+.|-.-
T Consensus        57 ~Pa~CkkCGfef~~~~-----------ik~pSRCP~CKSE   85 (97)
T COG3357          57 RPARCKKCGFEFRDDK-----------IKKPSRCPKCKSE   85 (97)
T ss_pred             cChhhcccCccccccc-----------cCCcccCCcchhh
Confidence            5778999998886611           1236678887543


No 179
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=42.48  E-value=3.3  Score=21.87  Aligned_cols=58  Identities=19%  Similarity=0.372  Sum_probs=26.7

Q ss_pred             eeCccchhhccChHH---HHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhh
Q psy12639         14 YACTECDQKFNRNSK---LKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRY   80 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~---l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f   80 (134)
                      +.++-|++.|.=..-   +..|... ........|..|+..+.....       ..+ ..+.|+.|+..|
T Consensus        11 ~~~~cC~~~y~C~~CHde~~~H~~~-~~~~~~v~Cg~C~~~~~~~~~-------~c~-~~~~C~~C~~~~   71 (71)
T PF05495_consen   11 IRFPCCGKYYPCRFCHDELEDHPFD-RWPVKRVICGKCRTEQPIDEY-------SCG-ADYFCPICGLYF   71 (71)
T ss_dssp             EEETTTTEEESSHHHHHHCSSS----TTT--EEEETTT--EEES-SB-------TT---SEEETTTTEEE
T ss_pred             EECCcccCeecHHHHHHHhccCccc-cccccCeECCCCCCccChhhh-------hcC-CCccCcCcCCCC
Confidence            455666666654321   1122221 222335778888877655544       111 457888887544


No 180
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=42.33  E-value=21  Score=17.60  Aligned_cols=32  Identities=19%  Similarity=0.510  Sum_probs=16.2

Q ss_pred             ecCCCCCccCChhhHHhHHhhhcCCCCcccCccchh
Q psy12639         44 ECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVR   79 (134)
Q Consensus        44 ~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~   79 (134)
                      .|..|.-.......  .  ....+.....|+.||+.
T Consensus        24 ~C~gC~~~l~~~~~--~--~i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMELPPQEL--N--EIRKGDEIVFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEcCHHHH--H--HHHcCCCeEECcCCCcc
Confidence            56666655433221  1  22233455677777764


No 181
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=42.25  E-value=3.4  Score=23.38  Aligned_cols=8  Identities=25%  Similarity=1.269  Sum_probs=3.8

Q ss_pred             eeCccchh
Q psy12639         14 YACTECDQ   21 (134)
Q Consensus        14 ~~C~~C~~   21 (134)
                      |.|+.|+.
T Consensus        23 FtCp~Cgh   30 (104)
T COG4888          23 FTCPRCGH   30 (104)
T ss_pred             EecCccCC
Confidence            44554443


No 182
>PHA02998 RNA polymerase subunit; Provisional
Probab=41.63  E-value=4.4  Score=25.55  Aligned_cols=38  Identities=18%  Similarity=0.336  Sum_probs=20.1

Q ss_pred             eecCCCCCccCChhhHHhHHhhhcCC---CCcccCccchhhcCH
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVHTGE---KPYACNLCTVRYLRS   83 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h~~~---~~~~C~~C~~~f~~~   83 (134)
                      -.|+.|+..-...-.++  .|+. .+   ..|.|..||..|..+
T Consensus       144 v~CPkCg~~~A~f~qlQ--TRSA-DEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        144 TPCPNCKSKNTTPMMIQ--TRAA-DEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCCceEEEEEe--eccC-CCCceEEEEcCCCCCccCCc
Confidence            46888875533332222  2221 12   237888888777654


No 183
>PTZ00448 hypothetical protein; Provisional
Probab=40.97  E-value=18  Score=25.67  Aligned_cols=24  Identities=21%  Similarity=0.538  Sum_probs=19.5

Q ss_pred             ceeCccchhhccChHHHHHHHhcc
Q psy12639         13 PYACTECDQKFNRNSKLKIHYNLA   36 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~~l~~h~~~~   36 (134)
                      .|.|..|+..|.+......|+++.
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            577999999998888888888763


No 184
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=40.72  E-value=23  Score=16.41  Aligned_cols=21  Identities=19%  Similarity=0.521  Sum_probs=14.6

Q ss_pred             eeCccchhhccCh--HHHHHHHh
Q psy12639         14 YACTECDQKFNRN--SKLKIHYN   34 (134)
Q Consensus        14 ~~C~~C~~~f~~~--~~l~~h~~   34 (134)
                      -.|+.||..|...  .+-..|.+
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~   36 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKK   36 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHH
Confidence            5799999888754  44555554


No 185
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=40.64  E-value=5.2  Score=18.44  Aligned_cols=10  Identities=20%  Similarity=0.780  Sum_probs=4.2

Q ss_pred             CceecCCCCC
Q psy12639         41 EMYECCHCAR   50 (134)
Q Consensus        41 ~~~~C~~C~~   50 (134)
                      +.+.|..|+.
T Consensus        23 ~~w~C~~C~~   32 (40)
T PF04810_consen   23 KTWICNFCGT   32 (40)
T ss_dssp             TEEEETTT--
T ss_pred             CEEECcCCCC
Confidence            3455555543


No 186
>KOG2636|consensus
Probab=40.46  E-value=26  Score=25.69  Aligned_cols=58  Identities=14%  Similarity=0.332  Sum_probs=35.4

Q ss_pred             hhhcCCCCcccCccc-hhhcCHHHHHHHHH--hh-cCCCCCCCC-CCCcccchhhhhhhhhhh
Q psy12639         63 RVHTGEKPYACNLCT-VRYLRSYELVLHLK--KC-HREDARNPY-APAFVDVNTVAQVKQEYE  120 (134)
Q Consensus        63 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~--~~-~~~~~~~~~-~~~~~~~~~~~~~~~~~~  120 (134)
                      +.|.-..-|.|.+|| .++.-+..+.+|-.  .| ++=+....+ ..-|.....+......+.
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~EwRH~hGmrCLGIpnt~~F~~IT~I~eA~~LW~  456 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFNEWRHAHGMRCLGIPNTSVFKGITKIEEALELWK  456 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhHHHHHhhcceecCCCCcHHhcccccHHHHHHHHH
Confidence            456666779999999 77877888888853  12 222222222 456666666666654444


No 187
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=39.96  E-value=17  Score=21.86  Aligned_cols=22  Identities=32%  Similarity=0.532  Sum_probs=10.4

Q ss_pred             eecCCCCCccCChhhHHhHHhhhcC
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVHTG   67 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h~~   67 (134)
                      ..|..+|+.|.+   |.+|..+|.+
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~g   98 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYG   98 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccC
Confidence            445555544432   4455555444


No 188
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=39.90  E-value=15  Score=21.76  Aligned_cols=10  Identities=30%  Similarity=0.607  Sum_probs=5.8

Q ss_pred             eecCCCCCccC
Q psy12639         43 YECCHCARSFP   53 (134)
Q Consensus        43 ~~C~~C~~~~~   53 (134)
                      +.| .|+..|.
T Consensus        71 ~~C-~Cg~~~~   80 (124)
T PRK00762         71 IEC-ECGYEGV   80 (124)
T ss_pred             EEe-eCcCccc
Confidence            556 6665554


No 189
>KOG1280|consensus
Probab=39.68  E-value=29  Score=24.55  Aligned_cols=29  Identities=17%  Similarity=0.423  Sum_probs=18.4

Q ss_pred             CcccCccchhhcCHHHHHHHHHhhcCCCC
Q psy12639         70 PYACNLCTVRYLRSYELVLHLKKCHREDA   98 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~   98 (134)
                      -|.|+.|+++=.+...+..|....|.+..
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~Hpda~  107 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQHPEAS  107 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhcCcccC
Confidence            46677777666666666667666555544


No 190
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=39.48  E-value=32  Score=23.16  Aligned_cols=11  Identities=36%  Similarity=1.186  Sum_probs=6.7

Q ss_pred             CceeCccchhh
Q psy12639         12 KPYACTECDQK   22 (134)
Q Consensus        12 ~~~~C~~C~~~   22 (134)
                      +.|.|..|...
T Consensus       111 rqFaC~~Cd~~  121 (278)
T PF15135_consen  111 RQFACSSCDHM  121 (278)
T ss_pred             eeeeccccchH
Confidence            55677766543


No 191
>PF14353 CpXC:  CpXC protein
Probab=38.75  E-value=5  Score=23.67  Aligned_cols=23  Identities=26%  Similarity=0.545  Sum_probs=17.5

Q ss_pred             CceeCccchhhccChHHHHHHHh
Q psy12639         12 KPYACTECDQKFNRNSKLKIHYN   34 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~h~~   34 (134)
                      ..+.|+.||..|.-...+..|..
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D~   59 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHDP   59 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEcC
Confidence            34899999999987777666554


No 192
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=38.01  E-value=19  Score=25.44  Aligned_cols=23  Identities=26%  Similarity=0.417  Sum_probs=20.0

Q ss_pred             CCcccCccchhhcCHHHHHHHHH
Q psy12639         69 KPYACNLCTVRYLRSYELVLHLK   91 (134)
Q Consensus        69 ~~~~C~~C~~~f~~~~~l~~H~~   91 (134)
                      ..+.|+.|++.|.....+..|+.
T Consensus       237 ~~~YC~~C~r~f~~~~VFe~Hl~  259 (470)
T COG5188         237 PKVYCVKCGREFSRSKVFEYHLE  259 (470)
T ss_pred             cceeeHhhhhHhhhhHHHHHHHh
Confidence            34789999999999999999975


No 193
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=37.41  E-value=27  Score=17.03  Aligned_cols=9  Identities=44%  Similarity=1.213  Sum_probs=4.2

Q ss_pred             ecCCCCCcc
Q psy12639         44 ECCHCARSF   52 (134)
Q Consensus        44 ~C~~C~~~~   52 (134)
                      .|..||..|
T Consensus        20 ~Cr~Cg~~~   28 (57)
T cd00065          20 HCRNCGRIF   28 (57)
T ss_pred             ccCcCcCCc
Confidence            444444444


No 194
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=37.36  E-value=18  Score=18.37  Aligned_cols=30  Identities=30%  Similarity=0.709  Sum_probs=15.6

Q ss_pred             eecCCCCCccCChhhHHhHHhhhcCCCCcccCccch
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTV   78 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~   78 (134)
                      |+|+ ||-.|.-.  |.   -...|++.-.|+.|..
T Consensus        23 yPCP-CGDRFeIs--Le---Dl~~GE~VArCPSCSL   52 (67)
T COG5216          23 YPCP-CGDRFEIS--LE---DLRNGEVVARCPSCSL   52 (67)
T ss_pred             ecCC-CCCEeEEE--HH---HhhCCceEEEcCCceE
Confidence            5565 66555322  11   1235666667777753


No 195
>KOG0717|consensus
Probab=37.27  E-value=17  Score=26.73  Aligned_cols=21  Identities=19%  Similarity=0.396  Sum_probs=18.8

Q ss_pred             cccCccchhhcCHHHHHHHHH
Q psy12639         71 YACNLCTVRYLRSYELVLHLK   91 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~   91 (134)
                      +.|..|++.|.+...|..|..
T Consensus       293 lyC~vCnKsFKseKq~kNHEn  313 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHEN  313 (508)
T ss_pred             eEEeeccccccchHHHHhhHH
Confidence            779999999999999988864


No 196
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=37.05  E-value=9.8  Score=16.19  Aligned_cols=6  Identities=33%  Similarity=1.315  Sum_probs=2.3

Q ss_pred             cchhhc
Q psy12639         18 ECDQKF   23 (134)
Q Consensus        18 ~C~~~f   23 (134)
                      .|++.|
T Consensus         5 DC~~~F   10 (28)
T PF08790_consen    5 DCSKDF   10 (28)
T ss_dssp             TTTEEE
T ss_pred             cCCCCc
Confidence            333333


No 197
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=36.76  E-value=7  Score=22.73  Aligned_cols=37  Identities=22%  Similarity=0.423  Sum_probs=19.7

Q ss_pred             eecCCCCCccCChhhHHhHHhh-hcC-CCCcccCccchhhc
Q psy12639         43 YECCHCARSFPCKSYLIPHLRV-HTG-EKPYACNLCTVRYL   81 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~-h~~-~~~~~C~~C~~~f~   81 (134)
                      ..|+.|+..=.....+  ..+. ... -..|.|..||..+.
T Consensus        73 ~~CpkCg~~ea~y~~~--QtRsaDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          73 EKCPKCGNKEAYYWQL--QTRSADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             ccCCCCCCceeEEEee--ehhccCCCceEEEEecccCCEee
Confidence            4588887543332222  2222 111 13489999998764


No 198
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=36.29  E-value=22  Score=18.20  Aligned_cols=10  Identities=40%  Similarity=1.069  Sum_probs=4.0

Q ss_pred             eCccchhhcc
Q psy12639         15 ACTECDQKFN   24 (134)
Q Consensus        15 ~C~~C~~~f~   24 (134)
                      .|..|++.|.
T Consensus        11 ~C~~C~~~F~   20 (69)
T PF01363_consen   11 NCMICGKKFS   20 (69)
T ss_dssp             B-TTT--B-B
T ss_pred             cCcCcCCcCC
Confidence            5777777774


No 199
>PRK04023 DNA polymerase II large subunit; Validated
Probab=35.46  E-value=30  Score=28.22  Aligned_cols=10  Identities=20%  Similarity=0.767  Sum_probs=7.0

Q ss_pred             ceeCccchhh
Q psy12639         13 PYACTECDQK   22 (134)
Q Consensus        13 ~~~C~~C~~~   22 (134)
                      ...|+.||..
T Consensus       626 ~RfCpsCG~~  635 (1121)
T PRK04023        626 RRKCPSCGKE  635 (1121)
T ss_pred             CccCCCCCCc
Confidence            3568888865


No 200
>PRK05978 hypothetical protein; Provisional
Probab=34.86  E-value=16  Score=22.44  Aligned_cols=30  Identities=17%  Similarity=0.414  Sum_probs=16.6

Q ss_pred             eecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhc
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYL   81 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~   81 (134)
                      ..|+.|++.-.....|.         ..-.|+.||..|.
T Consensus        34 grCP~CG~G~LF~g~Lk---------v~~~C~~CG~~~~   63 (148)
T PRK05978         34 GRCPACGEGKLFRAFLK---------PVDHCAACGEDFT   63 (148)
T ss_pred             CcCCCCCCCcccccccc---------cCCCccccCCccc
Confidence            36777776644433221         2245777776665


No 201
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=34.34  E-value=33  Score=23.51  Aligned_cols=10  Identities=20%  Similarity=0.886  Sum_probs=4.6

Q ss_pred             cccCccchhh
Q psy12639         71 YACNLCTVRY   80 (134)
Q Consensus        71 ~~C~~C~~~f   80 (134)
                      |.|+.|.-.|
T Consensus       256 yvCs~Clsi~  265 (279)
T TIGR00627       256 FVCSVCLSVL  265 (279)
T ss_pred             EECCCccCCc
Confidence            4444444444


No 202
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG2071|consensus
Probab=34.18  E-value=27  Score=26.46  Aligned_cols=28  Identities=25%  Similarity=0.474  Sum_probs=22.6

Q ss_pred             CCCCcccCccchhhcCHHHHHHHHHhhc
Q psy12639         67 GEKPYACNLCTVRYLRSYELVLHLKKCH   94 (134)
Q Consensus        67 ~~~~~~C~~C~~~f~~~~~l~~H~~~~~   94 (134)
                      ...+-.|..||..|........|+-.|-
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhh
Confidence            4567899999999999988887776664


No 204
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=33.64  E-value=25  Score=20.15  Aligned_cols=13  Identities=31%  Similarity=0.687  Sum_probs=8.1

Q ss_pred             CceeCccchhhcc
Q psy12639         12 KPYACTECDQKFN   24 (134)
Q Consensus        12 ~~~~C~~C~~~f~   24 (134)
                      ||-.|+.||..-.
T Consensus         1 ~p~~CpYCg~~~~   13 (102)
T PF11672_consen    1 KPIICPYCGGPAE   13 (102)
T ss_pred             CCcccCCCCCeeE
Confidence            4567777775443


No 205
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=33.60  E-value=21  Score=17.84  Aligned_cols=20  Identities=20%  Similarity=0.463  Sum_probs=15.7

Q ss_pred             CceeCccchhhccChHHHHH
Q psy12639         12 KPYACTECDQKFNRNSKLKI   31 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~~l~~   31 (134)
                      .-+-|-+||..|.+...|..
T Consensus        26 ~~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   26 EHNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             hCceeeeeCCccCCHHHHHh
Confidence            45679999999998877653


No 206
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=33.54  E-value=23  Score=16.22  Aligned_cols=18  Identities=17%  Similarity=0.194  Sum_probs=9.8

Q ss_pred             ceecCCCCCccCChhhHH
Q psy12639         42 MYECCHCARSFPCKSYLI   59 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~   59 (134)
                      -..|+.|+..+.....|.
T Consensus        19 id~C~~C~G~W~d~~el~   36 (41)
T PF13453_consen   19 IDVCPSCGGIWFDAGELE   36 (41)
T ss_pred             EEECCCCCeEEccHHHHH
Confidence            345666666655554443


No 207
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.40  E-value=53  Score=16.88  Aligned_cols=38  Identities=18%  Similarity=0.300  Sum_probs=17.7

Q ss_pred             ecCCCCCc-cCChhhHHhHHhhhcCCCCcccCccchhhc
Q psy12639         44 ECCHCARS-FPCKSYLIPHLRVHTGEKPYACNLCTVRYL   81 (134)
Q Consensus        44 ~C~~C~~~-~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~   81 (134)
                      .|.+|.+. +.....+..-.-.....+.|.|+.|.....
T Consensus         4 kCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~Rva   42 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHRVA   42 (68)
T ss_pred             eEEEecceeeecchhHHHHHhhCCCceeEechhhHhhhc
Confidence            45556543 223333333222233334577777765444


No 208
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=33.36  E-value=19  Score=21.57  Aligned_cols=15  Identities=40%  Similarity=0.933  Sum_probs=9.7

Q ss_pred             ceeCccchhhccChH
Q psy12639         13 PYACTECDQKFNRNS   27 (134)
Q Consensus        13 ~~~C~~C~~~f~~~~   27 (134)
                      |+.|..||+.|..-+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            456777777776543


No 209
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=32.42  E-value=22  Score=21.25  Aligned_cols=36  Identities=22%  Similarity=0.494  Sum_probs=21.4

Q ss_pred             eecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCH
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRS   83 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   83 (134)
                      -.|+.|+........     ..-.+...|.|+.|++.|...
T Consensus        31 ~~cP~C~s~~~~k~g-----~~~~~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          31 VNCPRCKSSNVVKIG-----GIRRGHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             CcCCCCCccceeeEC-----CccccccccccCCcCcceeee
Confidence            368888765411111     112235669999999988643


No 210
>KOG2747|consensus
Probab=32.20  E-value=35  Score=24.59  Aligned_cols=29  Identities=34%  Similarity=0.624  Sum_probs=25.4

Q ss_pred             CCCcccCccchhhcCHHHHHHHHHhhcCC
Q psy12639         68 EKPYACNLCTVRYLRSYELVLHLKKCHRE   96 (134)
Q Consensus        68 ~~~~~C~~C~~~f~~~~~l~~H~~~~~~~   96 (134)
                      ...|.|..|-+.+.....|..|+..+...
T Consensus       156 ~~lYiCEfCLkY~~s~~~l~rH~~kC~~r  184 (396)
T KOG2747|consen  156 DKLYICEFCLKYMKSRTSLQRHLKKCKLR  184 (396)
T ss_pred             CeEEEehHHHhHhchHHHHHHHHHhcCCC
Confidence            45689999999999999999999988654


No 211
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=32.18  E-value=17  Score=18.31  Aligned_cols=8  Identities=38%  Similarity=1.153  Sum_probs=4.1

Q ss_pred             cccCccch
Q psy12639         71 YACNLCTV   78 (134)
Q Consensus        71 ~~C~~C~~   78 (134)
                      |.|+.|..
T Consensus        32 YmC~eC~~   39 (56)
T PF09963_consen   32 YMCDECKE   39 (56)
T ss_pred             eeChhHHH
Confidence            55555543


No 212
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=32.15  E-value=42  Score=14.83  Aligned_cols=21  Identities=24%  Similarity=0.379  Sum_probs=8.4

Q ss_pred             cccCccchhhcCHHHHHHHHHh
Q psy12639         71 YACNLCTVRYLRSYELVLHLKK   92 (134)
Q Consensus        71 ~~C~~C~~~f~~~~~l~~H~~~   92 (134)
                      +.|+.|++.... +-+..|+..
T Consensus         5 ~~C~nC~R~v~a-~RfA~HLek   25 (33)
T PF08209_consen    5 VECPNCGRPVAA-SRFAPHLEK   25 (33)
T ss_dssp             EE-TTTSSEEEG-GGHHHHHHH
T ss_pred             EECCCCcCCcch-hhhHHHHHH
Confidence            445555553332 233444443


No 213
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=32.04  E-value=26  Score=21.22  Aligned_cols=32  Identities=22%  Similarity=0.585  Sum_probs=19.2

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhh
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRY   80 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f   80 (134)
                      .|.|..|+..+.      .+ +.+.....|.|..|+-.+
T Consensus       112 ~y~C~~C~~~~~------~~-rr~~~~~~y~C~~C~g~l  143 (146)
T smart00731      112 PYRCTGCGQRYL------RV-RRSNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEECCCCCCCCc------eE-ccccCcceEEcCCCCCEE
Confidence            578888887653      11 223222558888887654


No 214
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=31.73  E-value=12  Score=16.86  Aligned_cols=7  Identities=43%  Similarity=1.289  Sum_probs=3.0

Q ss_pred             ceecCCC
Q psy12639         42 MYECCHC   48 (134)
Q Consensus        42 ~~~C~~C   48 (134)
                      .|.|..|
T Consensus        29 ryrC~~C   35 (36)
T PF03811_consen   29 RYRCKDC   35 (36)
T ss_pred             eEecCcC
Confidence            3444443


No 215
>PLN02748 tRNA dimethylallyltransferase
Probab=31.02  E-value=37  Score=25.18  Aligned_cols=24  Identities=21%  Similarity=0.299  Sum_probs=20.8

Q ss_pred             CCCcccCccch-hhcCHHHHHHHHH
Q psy12639         68 EKPYACNLCTV-RYLRSYELVLHLK   91 (134)
Q Consensus        68 ~~~~~C~~C~~-~f~~~~~l~~H~~   91 (134)
                      .+.|.|..|++ .+.....+..|++
T Consensus       416 ~~~~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        416 WTQYVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             cccccccCCCCcccCCHHHHHHHhc
Confidence            46689999997 8999999999986


No 216
>KOG4124|consensus
Probab=30.27  E-value=9.2  Score=26.91  Aligned_cols=69  Identities=33%  Similarity=0.672  Sum_probs=39.0

Q ss_pred             CCceeCcc--chhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHH
Q psy12639         11 AKPYACTE--CDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVL   88 (134)
Q Consensus        11 ~~~~~C~~--C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~   88 (134)
                      .+++.|++  |.+.++....|..|-...|..  +..   -+    .+ .-..|.-.-...|+|.|++|.+.+.....|.-
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s--~i~---~~----s~-~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~  416 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCS--PIT---TP----TP-APIPHQGFVVENKPYRCEVCSKRYKNLNGLKY  416 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCC--CCC---CC----CC-CCCCcceeeeccCcccChhhhhhhccCCCCCc
Confidence            46788876  999988888877776432211  100   00    00 11122222334578888888887776655544


Q ss_pred             H
Q psy12639         89 H   89 (134)
Q Consensus        89 H   89 (134)
                      |
T Consensus       417 ~  417 (442)
T KOG4124|consen  417 H  417 (442)
T ss_pred             e
Confidence            4


No 217
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=29.66  E-value=20  Score=18.52  Aligned_cols=17  Identities=18%  Similarity=0.546  Sum_probs=9.9

Q ss_pred             ccCCCceeCccchhhcc
Q psy12639          8 HTGAKPYACTECDQKFN   24 (134)
Q Consensus         8 h~~~~~~~C~~C~~~f~   24 (134)
                      +..+.-..|+.|++.|.
T Consensus        48 ~i~eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   48 EIVEGELICPECGREYP   64 (68)
T ss_dssp             ETTTTEEEETTTTEEEE
T ss_pred             cccCCEEEcCCCCCEEe
Confidence            34445566666666664


No 218
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=29.47  E-value=12  Score=17.81  Aligned_cols=9  Identities=33%  Similarity=0.925  Sum_probs=4.5

Q ss_pred             Cccchhhcc
Q psy12639         16 CTECDQKFN   24 (134)
Q Consensus        16 C~~C~~~f~   24 (134)
                      |+.||-...
T Consensus         2 CP~Cg~~a~   10 (47)
T PF04606_consen    2 CPHCGSKAR   10 (47)
T ss_pred             cCCCCCeeE
Confidence            555554433


No 219
>PTZ00448 hypothetical protein; Provisional
Probab=29.38  E-value=43  Score=23.95  Aligned_cols=24  Identities=13%  Similarity=0.391  Sum_probs=21.1

Q ss_pred             CcccCccchhhcCHHHHHHHHHhh
Q psy12639         70 PYACNLCTVRYLRSYELVLHLKKC   93 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~l~~H~~~~   93 (134)
                      .|.|..|+-.|......+.|.+.-
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSD  337 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSE  337 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhh
Confidence            588999999999999999998863


No 220
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=29.10  E-value=17  Score=22.07  Aligned_cols=10  Identities=30%  Similarity=0.770  Sum_probs=6.2

Q ss_pred             cccCccchhh
Q psy12639         71 YACNLCTVRY   80 (134)
Q Consensus        71 ~~C~~C~~~f   80 (134)
                      |.|..|+..|
T Consensus       144 ~~C~~C~~~l  153 (157)
T PF10263_consen  144 YRCGRCGGPL  153 (157)
T ss_pred             EECCCCCCEE
Confidence            6676666544


No 221
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=28.56  E-value=26  Score=20.04  Aligned_cols=14  Identities=21%  Similarity=0.541  Sum_probs=9.8

Q ss_pred             CcccCccchhhcCH
Q psy12639         70 PYACNLCTVRYLRS   83 (134)
Q Consensus        70 ~~~C~~C~~~f~~~   83 (134)
                      |..|..||..|...
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            45677777777764


No 222
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=28.23  E-value=29  Score=15.74  Aligned_cols=12  Identities=25%  Similarity=0.747  Sum_probs=6.4

Q ss_pred             CceeCccchhhc
Q psy12639         12 KPYACTECDQKF   23 (134)
Q Consensus        12 ~~~~C~~C~~~f   23 (134)
                      +.|.|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            458888888654


No 223
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=27.88  E-value=56  Score=15.98  Aligned_cols=9  Identities=22%  Similarity=1.003  Sum_probs=3.9

Q ss_pred             eecCCCCCc
Q psy12639         43 YECCHCARS   51 (134)
Q Consensus        43 ~~C~~C~~~   51 (134)
                      +.|+.|+..
T Consensus        29 W~C~~Cgh~   37 (55)
T PF14311_consen   29 WKCPKCGHE   37 (55)
T ss_pred             EECCCCCCe
Confidence            344444433


No 224
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=27.82  E-value=8.7  Score=17.12  Aligned_cols=8  Identities=25%  Similarity=0.604  Sum_probs=4.1

Q ss_pred             eecCCCCC
Q psy12639         43 YECCHCAR   50 (134)
Q Consensus        43 ~~C~~C~~   50 (134)
                      +.|+.|+.
T Consensus        23 ~vC~~Cg~   30 (34)
T PF14803_consen   23 LVCPACGF   30 (34)
T ss_dssp             EEETTTTE
T ss_pred             eECCCCCC
Confidence            45555553


No 225
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=27.68  E-value=18  Score=22.37  Aligned_cols=20  Identities=25%  Similarity=0.378  Sum_probs=15.1

Q ss_pred             CCCCcccCccchhhcCHHHH
Q psy12639         67 GEKPYACNLCTVRYLRSYEL   86 (134)
Q Consensus        67 ~~~~~~C~~C~~~f~~~~~l   86 (134)
                      ...|..|..||+.|.+...-
T Consensus        65 ~~~PsYC~~CGkpyPWt~~~   84 (158)
T PF10083_consen   65 YEAPSYCHNCGKPYPWTENA   84 (158)
T ss_pred             CCCChhHHhCCCCCchHHHH
Confidence            34677899999999887543


No 226
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=27.48  E-value=35  Score=23.38  Aligned_cols=16  Identities=19%  Similarity=0.422  Sum_probs=10.4

Q ss_pred             CCCcccCccchhhcCH
Q psy12639         68 EKPYACNLCTVRYLRS   83 (134)
Q Consensus        68 ~~~~~C~~C~~~f~~~   83 (134)
                      .+.|.|+.||..+...
T Consensus       320 ~r~~~C~~cg~~~~rD  335 (364)
T COG0675         320 GRLFKCPRCGFVHDRD  335 (364)
T ss_pred             ceeEECCCCCCeehhh
Confidence            4557888888654433


No 227
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=27.32  E-value=30  Score=22.93  Aligned_cols=16  Identities=44%  Similarity=0.694  Sum_probs=12.3

Q ss_pred             CCceeCccchhhccCh
Q psy12639         11 AKPYACTECDQKFNRN   26 (134)
Q Consensus        11 ~~~~~C~~C~~~f~~~   26 (134)
                      .++.+|+.||..|...
T Consensus       179 GkpqRCpECGqVFKLV  194 (268)
T PTZ00043        179 GFLYRCGECDQIFMLV  194 (268)
T ss_pred             CCCccCCCCCcEEEEE
Confidence            3578899999888763


No 228
>PRK04351 hypothetical protein; Provisional
Probab=27.13  E-value=37  Score=20.84  Aligned_cols=32  Identities=31%  Similarity=0.722  Sum_probs=20.7

Q ss_pred             ceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhc
Q psy12639         42 MYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYL   81 (134)
Q Consensus        42 ~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~   81 (134)
                      .|.|..|+..+...       +.+ ....|.|..|+-.+.
T Consensus       112 ~Y~C~~Cg~~~~r~-------Rr~-n~~~yrCg~C~g~L~  143 (149)
T PRK04351        112 LYECQSCGQQYLRK-------RRI-NTKRYRCGKCRGKLK  143 (149)
T ss_pred             EEECCCCCCEeeee-------eec-CCCcEEeCCCCcEee
Confidence            48898898765332       223 235689999986554


No 229
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=27.09  E-value=20  Score=21.71  Aligned_cols=19  Identities=26%  Similarity=0.592  Sum_probs=13.6

Q ss_pred             HhhhcCCCCcccCccchhhc
Q psy12639         62 LRVHTGEKPYACNLCTVRYL   81 (134)
Q Consensus        62 ~~~h~~~~~~~C~~C~~~f~   81 (134)
                      +..+. .++..|+.||..|.
T Consensus       105 ~~l~~-g~~~RCpeCG~~fk  123 (136)
T PF01215_consen  105 FWLHK-GKPQRCPECGQVFK  123 (136)
T ss_dssp             EEEET-TSEEEETTTEEEEE
T ss_pred             EEEeC-CCccCCCCCCeEEE
Confidence            34444 45889999998874


No 230
>PLN03239 histone acetyltransferase; Provisional
Probab=26.73  E-value=66  Score=22.88  Aligned_cols=25  Identities=24%  Similarity=0.368  Sum_probs=22.0

Q ss_pred             CCCcccCccchhhcCHHHHHHHHHh
Q psy12639         68 EKPYACNLCTVRYLRSYELVLHLKK   92 (134)
Q Consensus        68 ~~~~~C~~C~~~f~~~~~l~~H~~~   92 (134)
                      ...|.|..|-+.|.+...+.+|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            4579999999999999999999864


No 231
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=26.27  E-value=26  Score=21.49  Aligned_cols=18  Identities=17%  Similarity=0.316  Sum_probs=13.8

Q ss_pred             CCcccCccchhhcCHHHH
Q psy12639         69 KPYACNLCTVRYLRSYEL   86 (134)
Q Consensus        69 ~~~~C~~C~~~f~~~~~l   86 (134)
                      +.-+|..|++.|++....
T Consensus        27 RRReC~~C~~RFTTyErv   44 (147)
T TIGR00244        27 RRRECLECHERFTTFERA   44 (147)
T ss_pred             ecccCCccCCccceeeec
Confidence            346899999999987543


No 233
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=26.08  E-value=14  Score=16.56  Aligned_cols=10  Identities=20%  Similarity=0.923  Sum_probs=3.8

Q ss_pred             eecCCCCCcc
Q psy12639         43 YECCHCARSF   52 (134)
Q Consensus        43 ~~C~~C~~~~   52 (134)
                      ..|..||-.+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            3456665443


No 234
>COG1773 Rubredoxin [Energy production and conversion]
Probab=26.06  E-value=29  Score=17.40  Aligned_cols=13  Identities=15%  Similarity=0.726  Sum_probs=7.4

Q ss_pred             ceeCccchhhccC
Q psy12639         13 PYACTECDQKFNR   25 (134)
Q Consensus        13 ~~~C~~C~~~f~~   25 (134)
                      -|.|..||..|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            3566666665543


No 235
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=26.00  E-value=20  Score=21.91  Aligned_cols=11  Identities=18%  Similarity=0.582  Sum_probs=7.6

Q ss_pred             CceecCCCCCc
Q psy12639         41 EMYECCHCARS   51 (134)
Q Consensus        41 ~~~~C~~C~~~   51 (134)
                      ..|.|..||..
T Consensus       111 G~l~C~~Cg~~  121 (146)
T PF07295_consen  111 GTLVCENCGHE  121 (146)
T ss_pred             ceEecccCCCE
Confidence            35778888765


No 236
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=25.73  E-value=26  Score=17.14  Aligned_cols=13  Identities=31%  Similarity=0.853  Sum_probs=10.0

Q ss_pred             cccCccchhhcCH
Q psy12639         71 YACNLCTVRYLRS   83 (134)
Q Consensus        71 ~~C~~C~~~f~~~   83 (134)
                      |.|..||..|...
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            6788898877654


No 237
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=25.37  E-value=39  Score=19.57  Aligned_cols=10  Identities=20%  Similarity=0.594  Sum_probs=4.6

Q ss_pred             eecCCCCCcc
Q psy12639         43 YECCHCARSF   52 (134)
Q Consensus        43 ~~C~~C~~~~   52 (134)
                      |.|+.|+..+
T Consensus        20 ~iCpeC~~EW   29 (109)
T TIGR00686        20 LICPSCLYEW   29 (109)
T ss_pred             eECccccccc
Confidence            4455554433


No 238
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=25.32  E-value=18  Score=16.36  Aligned_cols=14  Identities=21%  Similarity=0.461  Sum_probs=7.4

Q ss_pred             ccCccchhhcCHHH
Q psy12639         72 ACNLCTVRYLRSYE   85 (134)
Q Consensus        72 ~C~~C~~~f~~~~~   85 (134)
                      .|+.|++.|-+.+.
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            46677776665544


No 239
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=25.28  E-value=27  Score=25.86  Aligned_cols=15  Identities=13%  Similarity=0.394  Sum_probs=10.2

Q ss_pred             CceecCCCCCccCCh
Q psy12639         41 EMYECCHCARSFPCK   55 (134)
Q Consensus        41 ~~~~C~~C~~~~~~~   55 (134)
                      ..|.|..|+..+...
T Consensus       424 ~~~~c~~c~~~yd~~  438 (479)
T PRK05452        424 PRMQCSVCQWIYDPA  438 (479)
T ss_pred             CeEEECCCCeEECCC
Confidence            457788888776543


No 240
>PF07911 DUF1677:  Protein of unknown function (DUF1677);  InterPro: IPR012876 The sequences found in this family are all derived from hypothetical plant proteins of unknown function. The region features a number of highly conserved cysteine residues. 
Probab=25.24  E-value=1.4e+02  Score=16.79  Aligned_cols=65  Identities=11%  Similarity=0.144  Sum_probs=35.5

Q ss_pred             eeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHHHHhh
Q psy12639         14 YACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKC   93 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~   93 (134)
                      ..|.-||..=---..+...++..+.|  .|.|..|.......      +..  +         +...+....|..|+..+
T Consensus         5 akCeCCG~~EECT~~YI~~VR~ry~G--rWvCGLC~EAVkeE------~~r--~---------~~~~~~eeAl~~Hm~fC   65 (91)
T PF07911_consen    5 AKCECCGLTEECTPEYIARVRERYGG--RWVCGLCSEAVKEE------VGR--S---------KPGISVEEALDRHMSFC   65 (91)
T ss_pred             eeecCCCCchhccHHHHHHHHHHhCC--eehhhcCHHHHHHH------Hhc--c---------CCCCCHHHHHHHHHHHH
Confidence            35666765544445566666655555  35888887653221      111  1         11335556777888776


Q ss_pred             cCCC
Q psy12639         94 HRED   97 (134)
Q Consensus        94 ~~~~   97 (134)
                      ..-+
T Consensus        66 ~~f~   69 (91)
T PF07911_consen   66 RKFN   69 (91)
T ss_pred             HHcC
Confidence            5433


No 241
>KOG2923|consensus
Probab=24.60  E-value=55  Score=16.96  Aligned_cols=13  Identities=31%  Similarity=0.767  Sum_probs=7.9

Q ss_pred             cCCCCcccCccch
Q psy12639         66 TGEKPYACNLCTV   78 (134)
Q Consensus        66 ~~~~~~~C~~C~~   78 (134)
                      .|+..-.|+.|..
T Consensus        40 ~ge~Va~CpsCSL   52 (67)
T KOG2923|consen   40 NGEDVARCPSCSL   52 (67)
T ss_pred             CCCeeecCCCceE
Confidence            4555566777653


No 242
>KOG3352|consensus
Probab=24.47  E-value=35  Score=21.02  Aligned_cols=14  Identities=14%  Similarity=0.373  Sum_probs=10.6

Q ss_pred             CCCcccCccchhhc
Q psy12639         68 EKPYACNLCTVRYL   81 (134)
Q Consensus        68 ~~~~~C~~C~~~f~   81 (134)
                      .+...|++||..|.
T Consensus       131 ge~~rc~eCG~~fk  144 (153)
T KOG3352|consen  131 GETQRCPECGHYFK  144 (153)
T ss_pred             CCcccCCcccceEE
Confidence            45577999998774


No 243
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=24.43  E-value=35  Score=17.12  Aligned_cols=12  Identities=17%  Similarity=0.564  Sum_probs=7.8

Q ss_pred             cccCccchhhcC
Q psy12639         71 YACNLCTVRYLR   82 (134)
Q Consensus        71 ~~C~~C~~~f~~   82 (134)
                      --|+.|++.|..
T Consensus        40 ngCPfC~~~~~~   51 (55)
T PF14447_consen   40 NGCPFCGTPFEF   51 (55)
T ss_pred             cCCCCCCCcccC
Confidence            357777776654


No 244
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=24.29  E-value=30  Score=17.11  Aligned_cols=10  Identities=20%  Similarity=0.484  Sum_probs=5.9

Q ss_pred             ccCccchhhc
Q psy12639         72 ACNLCTVRYL   81 (134)
Q Consensus        72 ~C~~C~~~f~   81 (134)
                      .||.||..+.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            4666765543


No 245
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=24.18  E-value=64  Score=13.79  Aligned_cols=16  Identities=19%  Similarity=0.698  Sum_probs=8.4

Q ss_pred             CceeCccchhhccChH
Q psy12639         12 KPYACTECDQKFNRNS   27 (134)
Q Consensus        12 ~~~~C~~C~~~f~~~~   27 (134)
                      ..|.|+.|+..+-+..
T Consensus        12 ~kY~Cp~C~~~~CSl~   27 (30)
T PF04438_consen   12 AKYRCPRCGARYCSLA   27 (30)
T ss_dssp             ESEE-TTT--EESSHH
T ss_pred             CEEECCCcCCceeCcE
Confidence            4578888887766543


No 246
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=23.54  E-value=27  Score=22.58  Aligned_cols=26  Identities=23%  Similarity=0.469  Sum_probs=0.0

Q ss_pred             hcCCCCcccCccch-hhcCHHHHHHHH
Q psy12639         65 HTGEKPYACNLCTV-RYLRSYELVLHL   90 (134)
Q Consensus        65 h~~~~~~~C~~C~~-~f~~~~~l~~H~   90 (134)
                      |--.+-|.|.+||- .|--+..+.+|-
T Consensus        96 hGL~~ey~CEICGN~~Y~GrkaFekHF  122 (196)
T PF11931_consen   96 HGLGVEYKCEICGNQSYKGRKAFEKHF  122 (196)
T ss_dssp             ---------------------------
T ss_pred             hCCCCeeeeEeCCCcceecHHHHHHhc
Confidence            33345577777763 444455555553


No 247
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=23.33  E-value=40  Score=23.36  Aligned_cols=33  Identities=21%  Similarity=0.219  Sum_probs=18.7

Q ss_pred             eecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHH
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSY   84 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~   84 (134)
                      ..|+.|+...-.+.         .....+.|+.|+.-|.-.+
T Consensus        39 ~kc~~C~~~~~~~~---------l~~~~~vcp~c~~h~rltA   71 (296)
T CHL00174         39 VQCENCYGLNYKKF---------LKSKMNICEQCGYHLKMSS   71 (296)
T ss_pred             eECCCccchhhHHH---------HHHcCCCCCCCCCCcCCCH
Confidence            35777776532211         2233478888888776443


No 248
>PRK12722 transcriptional activator FlhC; Provisional
Probab=23.13  E-value=62  Score=20.79  Aligned_cols=10  Identities=30%  Similarity=0.820  Sum_probs=5.6

Q ss_pred             ecCCCCCccC
Q psy12639         44 ECCHCARSFP   53 (134)
Q Consensus        44 ~C~~C~~~~~   53 (134)
                      .|..|+..|.
T Consensus       136 ~C~~Cgg~fv  145 (187)
T PRK12722        136 SCNCCGGHFV  145 (187)
T ss_pred             cCCCCCCCee
Confidence            4666665554


No 249
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=22.78  E-value=25  Score=15.70  Aligned_cols=12  Identities=25%  Similarity=0.780  Sum_probs=4.8

Q ss_pred             ccCccchhhcCH
Q psy12639         72 ACNLCTVRYLRS   83 (134)
Q Consensus        72 ~C~~C~~~f~~~   83 (134)
                      .|..|++.|..+
T Consensus         5 ~C~eC~~~f~dS   16 (34)
T PF01286_consen    5 KCDECGKPFMDS   16 (34)
T ss_dssp             E-TTT--EES-S
T ss_pred             hHhHhCCHHHHH
Confidence            466677666543


No 250
>KOG1994|consensus
Probab=22.67  E-value=47  Score=22.07  Aligned_cols=24  Identities=25%  Similarity=0.478  Sum_probs=20.2

Q ss_pred             CCceecCCCCCccCChhhHHhHHh
Q psy12639         40 GEMYECCHCARSFPCKSYLIPHLR   63 (134)
Q Consensus        40 ~~~~~C~~C~~~~~~~~~l~~h~~   63 (134)
                      ...|-|-+||..|.+...|..|..
T Consensus       237 ~eh~YC~fCG~~y~~~edl~ehCP  260 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEHCP  260 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHhCC
Confidence            346889999999999999988854


No 251
>PRK01343 zinc-binding protein; Provisional
Probab=22.62  E-value=41  Score=17.02  Aligned_cols=12  Identities=17%  Similarity=0.307  Sum_probs=9.0

Q ss_pred             CcccCccchhhc
Q psy12639         70 PYACNLCTVRYL   81 (134)
Q Consensus        70 ~~~C~~C~~~f~   81 (134)
                      ...|+.|++.+.
T Consensus         9 ~~~CP~C~k~~~   20 (57)
T PRK01343          9 TRPCPECGKPST   20 (57)
T ss_pred             CCcCCCCCCcCc
Confidence            456888888775


No 252
>KOG2071|consensus
Probab=22.54  E-value=62  Score=24.68  Aligned_cols=27  Identities=19%  Similarity=0.557  Sum_probs=21.8

Q ss_pred             cCCCceeCccchhhccChHHHHHHHhc
Q psy12639          9 TGAKPYACTECDQKFNRNSKLKIHYNL   35 (134)
Q Consensus         9 ~~~~~~~C~~C~~~f~~~~~l~~h~~~   35 (134)
                      ....|..|..||..|........||..
T Consensus       414 y~~~pnqC~~CG~R~~~~ee~sk~md~  440 (579)
T KOG2071|consen  414 YKDSPNQCKSCGLRFDDSEERSKHMDI  440 (579)
T ss_pred             ccCCcchhcccccccccchhhhhHhhh
Confidence            345678999999999998887777764


No 253
>PRK12860 transcriptional activator FlhC; Provisional
Probab=22.49  E-value=65  Score=20.76  Aligned_cols=10  Identities=40%  Similarity=1.341  Sum_probs=5.4

Q ss_pred             ecCCCCCccC
Q psy12639         44 ECCHCARSFP   53 (134)
Q Consensus        44 ~C~~C~~~~~   53 (134)
                      .|..|+..|.
T Consensus       136 ~C~~Cgg~fv  145 (189)
T PRK12860        136 RCCRCGGKFV  145 (189)
T ss_pred             cCCCCCCCee
Confidence            4555655553


No 254
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=22.30  E-value=80  Score=21.18  Aligned_cols=36  Identities=17%  Similarity=0.375  Sum_probs=21.1

Q ss_pred             eecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcC
Q psy12639         43 YECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLR   82 (134)
Q Consensus        43 ~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~   82 (134)
                      -.|..|.-....  ....-++.  +.....||.||+..-.
T Consensus       198 ~~C~GC~m~l~~--~~~~~V~~--~d~iv~CP~CgRILy~  233 (239)
T COG1579         198 RVCGGCHMKLPS--QTLSKVRK--KDEIVFCPYCGRILYY  233 (239)
T ss_pred             CcccCCeeeecH--HHHHHHhc--CCCCccCCccchHHHh
Confidence            457777655433  23333333  5566789999986543


No 255
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=22.28  E-value=34  Score=19.47  Aligned_cols=7  Identities=43%  Similarity=1.412  Sum_probs=3.5

Q ss_pred             eecCCCC
Q psy12639         43 YECCHCA   49 (134)
Q Consensus        43 ~~C~~C~   49 (134)
                      |.|+.|+
T Consensus        22 f~CP~Cg   28 (99)
T PRK14892         22 FECPRCG   28 (99)
T ss_pred             eECCCCC
Confidence            4455554


No 256
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.24  E-value=32  Score=17.65  Aligned_cols=11  Identities=36%  Similarity=0.996  Sum_probs=7.2

Q ss_pred             cccCccchhhc
Q psy12639         71 YACNLCTVRYL   81 (134)
Q Consensus        71 ~~C~~C~~~f~   81 (134)
                      ..|+.|+..|.
T Consensus        49 v~CPYC~t~y~   59 (62)
T COG4391          49 VVCPYCSTRYR   59 (62)
T ss_pred             EecCccccEEE
Confidence            46777776664


No 257
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=22.16  E-value=43  Score=23.02  Aligned_cols=14  Identities=14%  Similarity=0.242  Sum_probs=9.2

Q ss_pred             CcccCccchhhcCH
Q psy12639         70 PYACNLCTVRYLRS   83 (134)
Q Consensus        70 ~~~C~~C~~~f~~~   83 (134)
                      .+.|+.|+.-|.-.
T Consensus        45 ~~vc~~c~~h~rl~   58 (285)
T TIGR00515        45 LEVCPKCDHHMRMD   58 (285)
T ss_pred             CCCCCCCCCcCcCC
Confidence            36777887766544


No 258
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=21.77  E-value=34  Score=15.05  Aligned_cols=10  Identities=20%  Similarity=0.747  Sum_probs=4.4

Q ss_pred             cccCccchhh
Q psy12639         71 YACNLCTVRY   80 (134)
Q Consensus        71 ~~C~~C~~~f   80 (134)
                      +.|..|+..|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            3444444433


No 259
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=21.74  E-value=46  Score=16.12  Aligned_cols=8  Identities=25%  Similarity=1.140  Sum_probs=2.7

Q ss_pred             cccCccch
Q psy12639         71 YACNLCTV   78 (134)
Q Consensus        71 ~~C~~C~~   78 (134)
                      |.|+.|++
T Consensus        42 W~CPiC~~   49 (50)
T PF02891_consen   42 WKCPICNK   49 (50)
T ss_dssp             -B-TTT--
T ss_pred             eECcCCcC
Confidence            66666654


No 260
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=21.68  E-value=36  Score=21.02  Aligned_cols=16  Identities=19%  Similarity=0.308  Sum_probs=13.0

Q ss_pred             CcccCccchhhcCHHH
Q psy12639         70 PYACNLCTVRYLRSYE   85 (134)
Q Consensus        70 ~~~C~~C~~~f~~~~~   85 (134)
                      .-.|+.|+..|++...
T Consensus        28 RReC~~C~~RFTTfE~   43 (156)
T COG1327          28 RRECLECGERFTTFER   43 (156)
T ss_pred             hhcccccccccchhhe
Confidence            4689999999998744


No 261
>PF14369 zf-RING_3:  zinc-finger
Probab=21.47  E-value=32  Score=15.33  Aligned_cols=10  Identities=30%  Similarity=0.810  Sum_probs=6.9

Q ss_pred             ecCCCCCccC
Q psy12639         44 ECCHCARSFP   53 (134)
Q Consensus        44 ~C~~C~~~~~   53 (134)
                      .|+.|+..|.
T Consensus        23 ~CP~C~~gFv   32 (35)
T PF14369_consen   23 ACPRCHGGFV   32 (35)
T ss_pred             CCcCCCCcEe
Confidence            4777777664


No 262
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=21.36  E-value=26  Score=22.61  Aligned_cols=35  Identities=20%  Similarity=0.330  Sum_probs=19.5

Q ss_pred             eeCccchhhccChHHHHHHHhc---cccCC---CceecCCCCCccCC
Q psy12639         14 YACTECDQKFNRNSKLKIHYNL---AHCTG---EMYECCHCARSFPC   54 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~h~~~---~h~~~---~~~~C~~C~~~~~~   54 (134)
                      ..||.||..+      ..|+..   -|.|.   ....|..||+.+..
T Consensus        15 ~~CPvCg~~l------~~~~~~~~IPyFG~V~i~t~~C~~CgYR~~D   55 (201)
T COG1779          15 IDCPVCGGTL------KAHMYLYDIPYFGEVLISTGVCERCGYRSTD   55 (201)
T ss_pred             ecCCccccee------eEEEeeecCCccceEEEEEEEccccCCcccc
Confidence            5788888643      333322   12232   23578888877653


No 263
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=21.03  E-value=44  Score=15.25  Aligned_cols=14  Identities=14%  Similarity=0.446  Sum_probs=9.6

Q ss_pred             CceecCCCCCccCC
Q psy12639         41 EMYECCHCARSFPC   54 (134)
Q Consensus        41 ~~~~C~~C~~~~~~   54 (134)
                      ..+.|+.||..+.+
T Consensus        31 p~~~C~~CGE~~~~   44 (46)
T TIGR03831        31 PALVCPQCGEEYLD   44 (46)
T ss_pred             CccccccCCCEeeC
Confidence            34678888877643


No 264
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=20.97  E-value=45  Score=15.48  Aligned_cols=8  Identities=38%  Similarity=1.144  Sum_probs=4.8

Q ss_pred             ceeCccch
Q psy12639         13 PYACTECD   20 (134)
Q Consensus        13 ~~~C~~C~   20 (134)
                      |..|+.||
T Consensus         2 ~~~Cp~Cg    9 (47)
T PF14690_consen    2 PPRCPHCG    9 (47)
T ss_pred             CccCCCcC
Confidence            44566666


No 265
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=20.51  E-value=31  Score=19.47  Aligned_cols=13  Identities=23%  Similarity=0.713  Sum_probs=3.7

Q ss_pred             CceeCccchhhcc
Q psy12639         12 KPYACTECDQKFN   24 (134)
Q Consensus        12 ~~~~C~~C~~~f~   24 (134)
                      +.-.|..||.++.
T Consensus        13 ke~~CalCG~tWg   25 (105)
T PF11494_consen   13 KEMGCALCGATWG   25 (105)
T ss_dssp             GGGS-SS---S--
T ss_pred             ccccccccCCcHH
Confidence            4445666665554


No 266
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=20.38  E-value=71  Score=20.21  Aligned_cols=22  Identities=14%  Similarity=0.258  Sum_probs=16.7

Q ss_pred             CCCcccCccchhhcCHHHHHHH
Q psy12639         68 EKPYACNLCTVRYLRSYELVLH   89 (134)
Q Consensus        68 ~~~~~C~~C~~~f~~~~~l~~H   89 (134)
                      .....|..||+.|.....+..=
T Consensus       112 ~~~~~C~~Cg~~f~~~k~i~~~  133 (181)
T PRK08222        112 FHLQRCSRCERPFAPQKTVALA  133 (181)
T ss_pred             cccCcCcccCCccCcHhHHHHH
Confidence            3568899999999977665443


No 267
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=20.37  E-value=89  Score=18.96  Aligned_cols=46  Identities=17%  Similarity=0.344  Sum_probs=25.5

Q ss_pred             eeCccchhhccChHHHHH--HHh--ccccCCCceecCCCCCccCChhhHH
Q psy12639         14 YACTECDQKFNRNSKLKI--HYN--LAHCTGEMYECCHCARSFPCKSYLI   59 (134)
Q Consensus        14 ~~C~~C~~~f~~~~~l~~--h~~--~~h~~~~~~~C~~C~~~~~~~~~l~   59 (134)
                      -.|..|+..+.....-..  -+.  +.-....-+.|+.|++.|..-+.+.
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~  141 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWR  141 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHH
Confidence            579999876544322110  000  0011223578999999998766554


No 268
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=20.20  E-value=88  Score=15.65  Aligned_cols=13  Identities=15%  Similarity=0.345  Sum_probs=5.0

Q ss_pred             ceecCCCCCccCC
Q psy12639         42 MYECCHCARSFPC   54 (134)
Q Consensus        42 ~~~C~~C~~~~~~   54 (134)
                      |.....|+-.|..
T Consensus        24 PV~s~~C~H~fek   36 (57)
T PF11789_consen   24 PVKSKKCGHTFEK   36 (57)
T ss_dssp             EEEESSS--EEEH
T ss_pred             CcCcCCCCCeecH
Confidence            3444455555533


No 269
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.06  E-value=42  Score=20.01  Aligned_cols=15  Identities=27%  Similarity=0.651  Sum_probs=8.4

Q ss_pred             CCcccCccchhhcCH
Q psy12639         69 KPYACNLCTVRYLRS   83 (134)
Q Consensus        69 ~~~~C~~C~~~f~~~   83 (134)
                      .|--|.-||+.|.+.
T Consensus        67 ~psfchncgs~fpwt   81 (160)
T COG4306          67 PPSFCHNCGSRFPWT   81 (160)
T ss_pred             CcchhhcCCCCCCcH
Confidence            344555666666554


Done!