Diaphorina citri psyllid: psy12650


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
VQSELHITHLLIPKQAGTADSCITHHEEEIFACQDKYNLITLGWIHWQLHITHLLIPKQAGTADSCITHHEEEIFACQDKYNLITLGWIH
ccccEEEEEEEEEcccccccccccccHHHHHHHHHccccEEEEEEEccccccCEEcECcccccHHccccccEEEEEEECccccCEEEEEc
**SELHITHLLIPKQAGTADSCITHHEEEIFACQDKYNLITLGWIHWQLHITHLLIPKQAGTADSCITHHEEEIFACQDKYNLITLGWIH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VQSELHITHLLIPKQAGTADSCITHHEEEIFACQDKYNLITLGWIHWQLHITHLLIPKQAGTADSCITHHEEEIFACQDKYNLITLGWIH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ubiquitin thioesterase DG1039 May be a zinc metalloprotease that specifically cleaves ubiquitin chains.confidentQ54Q40
AMSH-like protease sst2 Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains (By similarity). Plays a role in the multivesicular body (MVB) sorting pathway. Required for ubiquitin-dependent sorting of proteins into the endosome and subsequent trafficking to the vacuole. May regulate MVB sorting through deubiquitination of ubiquitinated ESCRT proteins.confidentQ9P371
STAM-binding protein Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains (By similarity). Functions at the endosome and is able to oppose the ubiquitin-dependent sorting of receptors to lysosomes. Plays a role in signal transduction for cell growth and MYC induction mediated by IL-2 and GM-CSF. Potentiates BMP (bone morphogenetic protein) signaling by antagonizing the inhibitory action of SMAD6 and SMAD7.confidentO95630

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0070536 [BP]protein K63-linked deubiquitinationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0016579
GO:0032154 [CC]cleavage furrowprobableGO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0071108 [BP]protein K48-linked deubiquitinationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0016579
GO:0000338 [BP]protein deneddylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0004843 [MF]ubiquitin-specific protease activityprobableGO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0019941 [BP]modification-dependent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0016926 [BP]protein desumoylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0030133 [CC]transport vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0006996 [BP]organelle organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RZV, chain A
Confidence level:very confident
Coverage over the Query: 29-90
View the alignment between query and template
View the model in PyMOL
Template: 3RZV, chain A
Confidence level:very confident
Coverage over the Query: 2-47
View the alignment between query and template
View the model in PyMOL