Diaphorina citri psyllid: psy12660


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MSHVGVYAEYQKANAGLVYDFQLINVEDFNGVGESEPNPYFYQNLAEAEYCVALFMYMRLLGYPAHKITILSTYNGQKHLIRDVINTRCADNPLIGRPHKVTTVDKYQGQQNDYILLSLVRTASVGHLRDVRRLIVAMSRARLGLYVFARVSLFRNCFELTPAFNQLMIRPQQLHIVPHETFPTSRLNTSRVPNSVAIQDMVHMTTLVYNFYMDKVNGMKKEFYSKAKLNADKWKKPGDIEEFYSKAKLNADKWKKPGDIEVKDVETHVAIHPGGDSDESGDEEEKEEEKMDTE
cccccccccHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHHHHHcccccccccccEEEEccccccccccEEEEEEEEcccccccccccHHHHHHHHcccccEEEEcHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHccc
*SHVGVYAEYQKANAGLVYDFQLINVEDFNGVGESEPNPYFYQNLAEAEYCVALFMYMRLLGYPAHKITILSTYNGQKHLIRDVINTRCADNPLIGRPHKVTTVDKYQGQQNDYILLSLVRTASVGHLRDVRRLIVAMSRARLGLYVFARVSLFRNCFELTPAFNQLMIRPQQLHIVPHETFPTSRLNTSRVPNSVAIQDMVHMTTLVYNFYMDKVNGMKKEFY**********************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHVGVYAEYQKANAGLVYDFQLINVEDFNGVGESEPNPYFYQNLAEAEYCVALFMYMRLLGYPAHKITILSTYNGQKHLIRDVINTRCADNPLIGRPHKVTTVDKYQGQQNDYILLSLVRTASVGHLRDVRRLIVAMSRARLGLYVFARVSLFRNCFELTPAFNQLMIRPQQLHIVPHETFPTSRLNTSRVPNSVAIQDMVHMTTLVYNFYMDKVNGMKKEFYSKAKLNADKWKKPGDIEEFYSKAKLNADKWKKPGDIEVKDVETHVAIHPGGDSDESGDEEEKEEEKMDTE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Intron-binding protein aquarius Intron-binding spliceosomal protein required to link pre-mRNA splicing and snoRNP (small nucleolar ribonucleoprotein) biogenesis. Plays a key role in position-dependent assembly of intron-encoded box C/D small snoRNP, splicing being required for snoRNP assembly. May act by helping the folding of the snoRNA sequence. Binds to intron of pre-mRNAs in a sequence-independent manner, contacting the region between snoRNA and the branchpoint of introns (40 nucleotides upstream of the branchpoint) during the late stages of splicing.confidentO60306
Intron-binding protein aquarius Intron-binding spliceosomal protein required to link pre-mRNA splicing and snoRNP (small nucleolar ribonucleoprotein) biogenesis. Plays a key role in position-dependent assembly of intron-encoded box C/D small snoRNP, splicing being required for snoRNP assembly. May act by helping the folding of the snoRNA sequence. Binds to intron of pre-mRNAs in a sequence-independent manner, contacting the region between snoRNA and the branchpoint of introns (40 nucleotides upstream of the branchpoint) during the late stages of splicing.confidentQ8CFQ3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0000398 [BP]mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0097157 [MF]pre-mRNA intronic bindingprobableGO:0036002, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XZL, chain A
Confidence level:very confident
Coverage over the Query: 20-178
View the alignment between query and template
View the model in PyMOL