Diaphorina citri psyllid: psy12669


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MLPCRLAAFSVLILVLSDVVVGSVNNSQVIELDTDNVDYVRDNYDFVLILFYVKWCRFSVAMLPTFDEVLVTLINLLPEPRKFAITKINCDDYESVCEDYNIVKYPTVKIMRHGSIEKLEYRRERTVEALVKYVREELMDPTIEIPEEENLVNVENC
ccHHHHHHHHHHHHHHHHHHcccccccccEEcccccHHHHHccccEEEEEEEccccHHHccccccHHHHHHHHHHHcccccccEEEEcccccccHHHHHccccccccEEEEcccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHccc
**PCRLAAFSVLILVLSDVVVGSVNNSQVIELDTDNVDYVRDNYDFVLILFYVKWCRFSVAMLPTFDEVLVTLINLLPEPRKFAITKINCDDYESVCEDYNIVKYPTVKIMRHGSIEKLEYRRERTVEALVKYVREELMD***********V*V***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPCRLAAFSVLILVLSDVVVGSVNNSQVIELDTDNVDYVRDNYDFVLILFYVKWCRFSVAMLPTFDEVLVTLINLLPEPRKFAITKINCDDYESVCEDYNIVKYPTVKIMRHGSIEKLEYRRERTVEALVKYVREELMDPTIEIPEEENLVNVENC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003674 [MF]molecular_functionprobable
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 27-154
View the alignment between query and template
View the model in PyMOL