Query         psy12689
Match_columns 72
No_of_seqs    100 out of 250
Neff          5.3 
Searched_HMMs 46136
Date          Fri Aug 16 17:06:19 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12689.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12689hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01107 Na_K_ATPase_bet Sodi 100.0 4.3E-34 9.2E-39  209.3   8.8   72    1-72    211-288 (289)
  2 PF00287 Na_K-ATPase:  Sodium / 100.0 3.7E-31   8E-36  193.1   4.5   68    1-68    216-289 (289)
  3 KOG3927|consensus               99.9 1.5E-27 3.3E-32  175.7   7.2   72    1-72    222-297 (300)
  4 cd08690 C2_Freud-1 C2 domain f  73.9      20 0.00044   24.1   6.3   27   44-70     79-105 (155)
  5 COG1709 Predicted transcriptio  47.5      19  0.0004   26.6   2.5   23   22-44    178-200 (241)
  6 cd08394 C2A_Munc13 C2 domain f  46.1      44 0.00094   22.0   3.9   41   27-69     42-82  (127)
  7 PF09112 N-glycanase_N:  Peptid  45.4      73  0.0016   22.4   5.1   35   28-65     31-66  (177)
  8 PF12249 AftA_C:  Arabinofurano  43.9     7.9 0.00017   27.3   0.1   16   14-29     63-82  (178)
  9 PF13895 Ig_2:  Immunoglobulin   43.8      29 0.00062   18.6   2.4   25   28-52      2-26  (80)
 10 cd05752 Ig1_FcgammaR_like Frst  38.1      30 0.00065   20.0   2.0   17   36-52     11-27  (78)
 11 COG1607 Acyl-CoA hydrolase [Li  38.1      64  0.0014   22.0   3.8   21   38-58     85-105 (157)
 12 PF04126 Cyclophil_like:  Cyclo  36.2      52  0.0011   21.0   3.0   46    1-46     62-120 (120)
 13 PF13927 Ig_3:  Immunoglobulin   36.1      36 0.00078   17.8   2.0   10   43-52     18-27  (75)
 14 cd03452 MaoC_C MaoC_C  The C-t  35.8 1.2E+02  0.0025   19.3   4.8   39   31-71     82-121 (142)
 15 PF02162 XYPPX:  XYPPX repeat (  34.8      22 0.00049   15.6   0.8   12    7-18      2-13  (15)
 16 PF01870 Hjc:  Archaeal hollida  33.6      91   0.002   19.2   3.7   21   28-53     27-47  (88)
 17 cd05739 Ig3_RPTP_IIa_LAR_like   32.7      44 0.00095   18.7   2.0   16   40-55      1-16  (69)
 18 cd08385 C2A_Synaptotagmin-1-5-  32.6      89  0.0019   18.9   3.6   25   44-69     83-107 (124)
 19 cd05857 Ig2_FGFR Second immuno  32.1      45 0.00097   18.6   2.0   16   37-52      6-21  (85)
 20 cd08387 C2A_Synaptotagmin-8 C2  31.8      96  0.0021   18.8   3.6   25   44-69     83-107 (124)
 21 cd08391 C2A_C2C_Synaptotagmin_  31.8      83  0.0018   18.7   3.3   22   46-69     71-92  (121)
 22 cd05856 Ig2_FGFRL1-like Second  31.8      54  0.0012   17.9   2.3   16   37-52      6-21  (82)
 23 cd04010 C2B_RasA3 C2 domain se  31.4 1.1E+02  0.0023   20.1   4.0   27   43-70     79-105 (148)
 24 cd04967 Ig1_Contactin First Ig  31.3      69  0.0015   18.4   2.8   15   38-52     17-31  (91)
 25 PF01190 Pollen_Ole_e_I:  Polle  30.8      45 0.00098   20.0   2.0   33   37-69     20-55  (97)
 26 cd05729 Ig2_FGFR_like Second i  30.2      41  0.0009   18.3   1.6   16   37-52      6-21  (85)
 27 PRK07274 single-stranded DNA-b  29.6 1.6E+02  0.0034   19.0   4.5   14   37-50     65-78  (131)
 28 cd05740 Ig_CEACAM_D4 Fourth im  28.9      59  0.0013   19.2   2.3   16   37-52     15-30  (91)
 29 cd05758 Ig5_KIRREL3-like Fifth  28.2      52  0.0011   19.3   1.9   15   38-52     14-28  (98)
 30 cd04968 Ig3_Contactin_like Thi  27.9      57  0.0012   18.6   2.0   15   38-52     14-28  (88)
 31 cd08389 C2A_Synaptotagmin-14_1  27.5 1.2E+02  0.0026   18.8   3.5   27   42-69     81-107 (124)
 32 cd05866 Ig1_NCAM-2 First immun  27.4   1E+02  0.0023   18.4   3.2   15   37-51     12-26  (92)
 33 cd05737 Ig_Myomesin_like_C C-t  27.0 1.1E+02  0.0025   17.5   3.2   16   38-53     14-29  (92)
 34 cd04047 C2B_Copine C2 domain s  26.3   1E+02  0.0023   18.2   3.0   25   44-69     71-95  (110)
 35 cd04974 Ig3_FGFR Third immunog  26.1      65  0.0014   18.7   2.0   14   40-53      1-14  (90)
 36 cd08393 C2A_SLP-1_2 C2 domain   26.0 1.4E+02   0.003   18.5   3.6   25   44-69     85-109 (125)
 37 PF07117 DUF1373:  Protein of u  25.4      71  0.0015   22.8   2.4   22    1-22     11-35  (210)
 38 cd05735 Ig8_DSCAM Eight immuno  25.0      77  0.0017   18.4   2.2   13   40-52      1-13  (88)
 39 cd04022 C2A_MCTP_PRT_plant C2   24.4 1.2E+02  0.0027   18.5   3.2   26   44-69     65-90  (127)
 40 cd07693 Ig1_Robo First immunog  24.4      62  0.0013   18.1   1.7   17   37-53     13-29  (100)
 41 cd05848 Ig1_Contactin-5 First   24.3 1.1E+02  0.0023   18.0   2.8   14   39-52     18-31  (94)
 42 cd04481 RPA1_DBD_B_like RPA1_D  24.1      44 0.00095   20.4   1.1   24   27-53     22-45  (106)
 43 cd05861 Ig1_PDGFR-alphabeta Fr  24.1      71  0.0015   18.4   1.9   15   40-54      1-15  (84)
 44 cd05749 Ig2_Tyro3_like Second   23.7      68  0.0015   18.7   1.8   18   38-55     11-28  (81)
 45 cd08680 C2_Kibra C2 domain fou  23.6 1.2E+02  0.0026   19.2   3.1   27   42-69     82-108 (124)
 46 cd04977 Ig1_NCAM-1_like First   23.4 1.2E+02  0.0027   17.6   2.9   16   37-52     12-27  (92)
 47 cd08381 C2B_PI3K_class_II C2 d  23.2 1.6E+02  0.0035   18.2   3.6   25   44-69     82-106 (122)
 48 cd08682 C2_Rab11-FIP_classI C2  23.1 1.3E+02  0.0029   18.3   3.2   12   58-69     79-90  (126)
 49 cd05745 Ig3_Peroxidasin Third   23.1      66  0.0014   17.7   1.6   13   40-52      2-14  (74)
 50 TIGR03357 VI_zyme type VI secr  22.9 2.1E+02  0.0045   18.1   5.6   27   30-56     88-117 (133)
 51 cd05764 Ig_2 Subgroup of the i  22.8      76  0.0017   17.2   1.8   13   40-52      1-13  (74)
 52 cd05722 Ig1_Neogenin First imm  22.6      61  0.0013   18.7   1.5   14   39-52     13-26  (95)
 53 cd05851 Ig3_Contactin-1 Third   22.4      78  0.0017   18.3   1.9   15   38-52     14-28  (88)
 54 cd06152 YjgF_YER057c_UK114_lik  22.4 1.4E+02   0.003   18.7   3.2   22   29-50     92-114 (114)
 55 cd00448 YjgF_YER057c_UK114_fam  22.4 1.6E+02  0.0035   17.0   3.3   23   27-49     85-107 (107)
 56 cd08675 C2B_RasGAP C2 domain s  22.2 1.6E+02  0.0036   18.6   3.5   25   44-69     79-103 (137)
 57 PF12997 DUF3881:  Domain of un  22.0   1E+02  0.0023   23.2   2.9   25   14-50     68-92  (283)
 58 cd05743 Ig_Perlecan_D2_like Im  21.9      93   0.002   17.3   2.1   14   40-53      1-14  (78)
 59 cd05754 Ig3_Perlecan_like Thir  21.8      76  0.0016   17.9   1.7   15   38-52     14-28  (85)
 60 KOG0937|consensus               21.5 1.6E+02  0.0035   23.4   3.9   46    3-51    251-298 (424)
 61 cd05852 Ig5_Contactin-1 Fifth   21.3      75  0.0016   17.9   1.6   13   40-52      1-13  (73)
 62 PF14485 DUF4431:  Domain of un  21.1 1.5E+02  0.0033   16.2   2.8   20   39-58     18-37  (48)
 63 PF05560 Bt_P21:  Bacillus thur  21.1 1.3E+02  0.0029   20.8   3.0   29   41-69    145-175 (182)
 64 PLN03200 cellulose synthase-in  21.0 1.2E+02  0.0027   28.7   3.5   31   35-69   2035-2065(2102)
 65 PF09458 H_lectin:  H-type lect  20.8 1.7E+02  0.0037   16.2   3.1   28   27-56     16-45  (72)
 66 cd08386 C2A_Synaptotagmin-7 C2  20.8   2E+02  0.0043   17.3   3.6   25   45-70     85-109 (125)
 67 cd04975 Ig4_SCFR_like Fourth i  20.6 1.6E+02  0.0035   17.8   3.1   13   39-51     17-29  (101)
 68 cd04031 C2A_RIM1alpha C2 domai  20.5   2E+02  0.0043   17.2   3.5   26   44-70     86-111 (125)
 69 PRK11401 putative endoribonucl  20.2 1.6E+02  0.0036   18.5   3.2   20   31-50    107-126 (129)
 70 cd08388 C2A_Synaptotagmin-4-11  20.2   2E+02  0.0044   17.9   3.6   25   44-69     85-109 (128)
 71 cd04981 IgV_H Immunoglobulin (  20.2 1.5E+02  0.0031   18.3   2.9   15   38-52     10-24  (117)
 72 cd06156 eu_AANH_C_2 A group of  20.1 1.6E+02  0.0035   18.5   3.1   24   26-49     95-118 (118)

No 1  
>TIGR01107 Na_K_ATPase_bet Sodium Potassium ATPase beta subunit. This model describes the Na+/K+ ATPase beta subunit in eukaryotes. Na+/K+ ATPase(also called Sodium-Potassium pump) is intimately associated with the plasma membrane. It couples the energy released by the hydrolysis of ATP to extrude 3 Na+ ions, with the concomitant uptake of 2K+ ions, against their ionic gradients.
Probab=100.00  E-value=4.3e-34  Score=209.34  Aligned_cols=72  Identities=35%  Similarity=0.781  Sum_probs=68.5

Q ss_pred             CcceeEecCCC-CCCCceeccC---CCCCcCCeEEEEeeCCCCCcEEEEEEEeecCCCcCC--CCCceeeEEEEEEeC
Q psy12689          1 MGTLSYYPWKG-FPGYFFPFQN---TEGYLAPVIAVHFESPAIGVLINIECKAWAHNIHHD--RHERRGSVHFELMID   72 (72)
Q Consensus         1 ig~i~Y~P~~g-f~~~YfPy~~---~~~Y~~PlVAVqf~n~~~n~~i~IeCk~~a~NI~~d--~~~~~G~v~F~l~vd   72 (72)
                      +|+|+|||++| ||++||||+|   |++|+||||||||+|+++|++|+||||+||+||.++  +++++|||+|+|+||
T Consensus       211 ~g~i~YyP~~G~f~~~YfPY~gk~~q~~YlqPLVAVqf~~~~~n~~v~VeCk~~a~NI~~~~~~d~~~G~v~f~l~i~  288 (289)
T TIGR01107       211 IGNVEYYPMNGGFPLQYFPYYGKKLQPNYLQPLVAVQFTNLTMNTEVRIECKIYGENIAYSNEKDRFLGRVDFKITIK  288 (289)
T ss_pred             ccceEECCCCCCcCcccccccCcccCcCCcCCeEEEEeecCCCCcEEEEEEEEeccCCccCCCccccCCeEEEEEEec
Confidence            68999999998 9999999999   999999999999999999999999999999999994  466999999999997


No 2  
>PF00287 Na_K-ATPase:  Sodium / potassium ATPase beta chain;  InterPro: IPR000402 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles []. P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H+, Na+, K+, Mg2+, Ca2+, Ag+ and Ag2+, Zn2+, Co2+, Pb2+, Ni2+, Cd2+, Cu+ and Cu2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2.  This entry represents the beta subunit found in the P-type cation exchange ATPases located in the plasma membranes of animal cells. These P-ATPases include both H+/K+-ATPases (3.6.3.10 from EC) and Na+/K+-ATPases (3.6.3.9 from EC), which belong to the IIC subfamily of ATPases [, ]. These ATPases catalyse the hydrolysis of ATP coupled with the exchange of cations, pumping one cation out of the cell (H+ or Na+) in exchange for K+. These ATPases contain an alpha subunit (IPR005775 from INTERPRO) that is the catalytic component, and a glycosylated beta subunit that regulates the number of sodium pumps transported to the plasma membrane through the assembly of alpha/beta heterodimers. The beta subunit has three highly conserved disulphide bonds within the extracellular domain that stabilise the alpha subunit, the alpha/beta interaction, and the catalytic activity of the alpha subunit []. Different beta isoforms exist, permitting greater regulatory control. An example of a H+/K+-ATPase is the gastric pump responsible for acid secretion in the stomach, transporting protons from the cytoplasm of parietal cells to create a large pH gradient in exchange for the internalisation of potassium ions, using ATP hydrolysis to drive the pump []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0005391 sodium:potassium-exchanging ATPase activity, 0006754 ATP biosynthetic process, 0006813 potassium ion transport, 0006814 sodium ion transport, 0016020 membrane; PDB: 2XZB_B 3A3Y_B 3N2F_D 3B8E_D 3KDP_D 3N23_D.
Probab=99.97  E-value=3.7e-31  Score=193.14  Aligned_cols=68  Identities=49%  Similarity=0.998  Sum_probs=45.4

Q ss_pred             CcceeEecCC-CCCCCceeccC---CCCCcCCeEEEEeeCCCCCcEEEEEEEeecCCCcCCC--CCceeeEEEE
Q psy12689          1 MGTLSYYPWK-GFPGYFFPFQN---TEGYLAPVIAVHFESPAIGVLINIECKAWAHNIHHDR--HERRGSVHFE   68 (72)
Q Consensus         1 ig~i~Y~P~~-gf~~~YfPy~~---~~~Y~~PlVAVqf~n~~~n~~i~IeCk~~a~NI~~d~--~~~~G~v~F~   68 (72)
                      +|+++|||++ |||.+||||+|   |++|+||||||||+|+++|++|+||||+||+||++|+  ++++|+|+||
T Consensus       216 i~~i~y~P~~ggf~~~YfPy~~k~~~~~Y~~PlVAVqf~n~~~n~~i~veCk~wakNI~~d~~~~~~~G~V~F~  289 (289)
T PF00287_consen  216 IGPIEYYPSNGGFPLMYFPYYGKKAQPGYLSPLVAVQFTNPPRNVEINVECKAWAKNIPYDDERDKFLGRVHFK  289 (289)
T ss_dssp             ---EEEE-STSEEEGGG-SB-TTTTSTT-----EEEEESSS-SSS-EEEEEEE-STT----SSS-TTSSB--EE
T ss_pred             eeeEEEECCCCCcceeECCccCCccCCCCcCCeEEEEEecCCCCcEEEEEEEEeCCCCCCCCcCCcccEEEEeC
Confidence            5889999999 79999999999   9999999999999999999999999999999999976  5699999997


No 3  
>KOG3927|consensus
Probab=99.94  E-value=1.5e-27  Score=175.72  Aligned_cols=72  Identities=47%  Similarity=0.955  Sum_probs=69.2

Q ss_pred             CcceeEecCCC-CCCCceecc---CCCCCcCCeEEEEeeCCCCCcEEEEEEEeecCCCcCCCCCceeeEEEEEEeC
Q psy12689          1 MGTLSYYPWKG-FPGYFFPFQ---NTEGYLAPVIAVHFESPAIGVLINIECKAWAHNIHHDRHERRGSVHFELMID   72 (72)
Q Consensus         1 ig~i~Y~P~~g-f~~~YfPy~---~~~~Y~~PlVAVqf~n~~~n~~i~IeCk~~a~NI~~d~~~~~G~v~F~l~vd   72 (72)
                      +|.++|||++| ||.+||||+   +|++|+||||||||+|+++|++|.||||+||+||.++++++.|+|+|+|+|+
T Consensus       222 i~~~~y~p~~g~f~~~Y~Py~gk~~~~~y~~plvavkf~ni~~n~~v~IeCka~a~n~~~~~~~~~g~V~f~l~i~  297 (300)
T KOG3927|consen  222 IGKVAYFPETGDFPLEYYPYYGKKNQPGYLQPLVAVKFTNIPRNEEVNIECKAWAENINHDRDTFGGRVRFELLIE  297 (300)
T ss_pred             ccceeeeccCCCCCceecCccccccCCCccCceEEEecCCCCCCceEEEEeecccccCcchhhhhcceEEEEEecc
Confidence            57899999999 999999999   8999999999999999999999999999999998888888999999999985


No 4  
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1). Freud-1 is a novel calcium-regulated repressor that negatively regulates basal 5-HT1A receptor expression in neurons.  It may also play a role in the altered regulation of 5-HT1A receptors associated with anxiety or major depression. Freud-1 contains two DM-14 basic repeats, a helix-loop-helix DNA binding domain, and a C2 domain. The Freud-1 C2 domain is thought to be calcium insensitive and it lacks several acidic residues that mediate calcium binding of the PKC C2 domain. In addition, it contains a poly-basic insert that is not present in calcium-dependent C2 domains and may function as a nuclear localization signal. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules tha
Probab=73.94  E-value=20  Score=24.07  Aligned_cols=27  Identities=7%  Similarity=0.151  Sum_probs=20.1

Q ss_pred             EEEEEeecCCCcCCCCCceeeEEEEEE
Q psy12689         44 NIECKAWAHNIHHDRHERRGSVHFELM   70 (72)
Q Consensus        44 ~IeCk~~a~NI~~d~~~~~G~v~F~l~   70 (72)
                      .+.|.+|.++--...++.+|++.+.|.
T Consensus        79 ~L~~~V~d~~~f~~~D~~iG~~~i~L~  105 (155)
T cd08690          79 GLKFEVYHKGGFLRSDKLLGTAQVKLE  105 (155)
T ss_pred             cEEEEEEeCCCcccCCCeeEEEEEEcc
Confidence            488999999753323569999998873


No 5  
>COG1709 Predicted transcriptional regulator [Transcription]
Probab=47.53  E-value=19  Score=26.56  Aligned_cols=23  Identities=9%  Similarity=0.151  Sum_probs=18.3

Q ss_pred             CCCCcCCeEEEEeeCCCCCcEEE
Q psy12689         22 TEGYLAPVIAVHFESPAIGVLIN   44 (72)
Q Consensus        22 ~~~Y~~PlVAVqf~n~~~n~~i~   44 (72)
                      -..-.||+|||+..++++...|.
T Consensus       178 VstGRSPMVAirV~~lKP~aVVl  200 (241)
T COG1709         178 VSTGRSPMVAIRVSPLKPAAVVL  200 (241)
T ss_pred             ccCCCCceEEEEccCCCccEEEE
Confidence            34567999999999998886653


No 6  
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, synaptobrevi
Probab=46.10  E-value=44  Score=21.98  Aligned_cols=41  Identities=15%  Similarity=0.226  Sum_probs=26.9

Q ss_pred             CCeEEEEeeCCCCCcEEEEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         27 APVIAVHFESPAIGVLINIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        27 ~PlVAVqf~n~~~n~~i~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      +|-+--+|.-...+..-.++=++|.++..  .+|+.|++.|.|
T Consensus        42 nP~WnE~F~F~~~~~~~~L~v~V~dkd~~--~DD~lG~v~i~L   82 (127)
T cd08394          42 QPCWEQDFMFEINRLDLGLVIELWNKGLI--WDTLVGTVWIPL   82 (127)
T ss_pred             CCceeeEEEEEEcCCCCEEEEEEEeCCCc--CCCceEEEEEEh
Confidence            67666665543333223366678998853  567999999876


No 7  
>PF09112 N-glycanase_N:  Peptide-N-glycosidase F, N terminal;  InterPro: IPR015196 This domain adopts an eight-stranded antiparallel beta jelly roll configuration, with the beta strands arranged into two sheets. It is similar in topology to many viral capsid proteins, as well as lectins and several glucanases. This domain allows the protein to bind sugars and catalyses the complete removal of N-linked oligosaccharide chains from glycoproteins []. ; PDB: 3PMS_A 3KS7_D 1PNF_A 1PNG_A 1PGS_A.
Probab=45.42  E-value=73  Score=22.39  Aligned_cols=35  Identities=23%  Similarity=0.265  Sum_probs=22.2

Q ss_pred             CeEEEEeeCCCCCc-EEEEEEEeecCCCcCCCCCceeeE
Q psy12689         28 PVIAVHFESPAIGV-LINIECKAWAHNIHHDRHERRGSV   65 (72)
Q Consensus        28 PlVAVqf~n~~~n~-~i~IeCk~~a~NI~~d~~~~~G~v   65 (72)
                      =|-+|++....++. .|.++-+.-+.+   |.-|+.|+|
T Consensus        31 ilkkVklP~~~~~~~~v~l~vt~~snG---D~wDrtGsv   66 (177)
T PF09112_consen   31 ILKKVKLPEYKKNVMTVFLEVTQSSNG---DAWDRTGSV   66 (177)
T ss_dssp             EEEEEEE-S--TTEEEEEEEEEEEEGG-----S--EEEE
T ss_pred             EEEEEeCCcccccceEEEEEEEecCCC---CcccccceE
Confidence            35688899988998 888887776665   667899998


No 8  
>PF12249 AftA_C:  Arabinofuranosyltransferase A C terminal;  InterPro: IPR020959 The arabinofuranosyltransferase enzyme AftA is involved in cell wall arabinan biosynthesis in bacteria []. It catalyses the addition of the first key arabinofuranosyl residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol to the galactan domain of the cell wall, thus priming the galactan for further elaboration by the arabinofuranosyltransferases. As this enzyme is important for cell growth and is found in some important pathogens, such as Mycobacterium tuberculosis, it represents a potential target for the devlopment of new antibacterial drugs. This entry represents the C-terminal domain of AftA.; GO: 0016757 transferase activity, transferring glycosyl groups, 0044038 cell wall macromolecule biosynthetic process, 0005886 plasma membrane, 0016021 integral to membrane
Probab=43.88  E-value=7.9  Score=27.34  Aligned_cols=16  Identities=25%  Similarity=0.652  Sum_probs=12.2

Q ss_pred             CCceeccC----CCCCcCCe
Q psy12689         14 GYFFPFQN----TEGYLAPV   29 (72)
Q Consensus        14 ~~YfPy~~----~~~Y~~Pl   29 (72)
                      ..||||.|    +.+|-.||
T Consensus        63 lsyyPY~gFQalTsHYANPL   82 (178)
T PF12249_consen   63 LSYYPYWGFQALTSHYANPL   82 (178)
T ss_pred             eEecccccccccchhhcCch
Confidence            46778876    77888887


No 9  
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=43.80  E-value=29  Score=18.60  Aligned_cols=25  Identities=20%  Similarity=0.365  Sum_probs=16.9

Q ss_pred             CeEEEEeeCCCCCcEEEEEEEeecC
Q psy12689         28 PVIAVHFESPAIGVLINIECKAWAH   52 (72)
Q Consensus        28 PlVAVqf~n~~~n~~i~IeCk~~a~   52 (72)
                      |.+-..-.....+..+.+.|.+.+.
T Consensus         2 P~l~~~~~~v~~g~~~~l~C~~~~~   26 (80)
T PF13895_consen    2 PVLSSSPQSVEEGDSVTLTCSVSGN   26 (80)
T ss_dssp             -EEEEESSEEETTSEEEEEEEEESS
T ss_pred             cEEEccceEEeCCCcEEEEEEEEcc
Confidence            3344444455678999999999854


No 10 
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=38.14  E-value=30  Score=20.05  Aligned_cols=17  Identities=12%  Similarity=0.384  Sum_probs=13.6

Q ss_pred             CCCCCcEEEEEEEeecC
Q psy12689         36 SPAIGVLINIECKAWAH   52 (72)
Q Consensus        36 n~~~n~~i~IeCk~~a~   52 (72)
                      ....+..|.++|.+.+.
T Consensus        11 ~v~~G~~V~L~C~~~~~   27 (78)
T cd05752          11 TIFQGEKVTLTCNGFNS   27 (78)
T ss_pred             EeeCCCCEEEEEeCCCC
Confidence            44578999999999874


No 11 
>COG1607 Acyl-CoA hydrolase [Lipid metabolism]
Probab=38.10  E-value=64  Score=22.05  Aligned_cols=21  Identities=14%  Similarity=0.384  Sum_probs=17.8

Q ss_pred             CCCcEEEEEEEeecCCCcCCC
Q psy12689         38 AIGVLINIECKAWAHNIHHDR   58 (72)
Q Consensus        38 ~~n~~i~IeCk~~a~NI~~d~   58 (72)
                      .-.+.+.|++++|++|+..+.
T Consensus        85 ~GrTSm~V~Vev~~~~~~~~~  105 (157)
T COG1607          85 TGRTSMEVGVEVWAEDIRSGE  105 (157)
T ss_pred             cCcccEEEEEEEEEecccCCc
Confidence            456899999999999998753


No 12 
>PF04126 Cyclophil_like:  Cyclophilin-like;  InterPro: IPR007256 Proteins of this family have no known function.; PDB: 2KA0_A 1ZX8_C 2NNZ_A.
Probab=36.16  E-value=52  Score=21.04  Aligned_cols=46  Identities=22%  Similarity=0.413  Sum_probs=21.7

Q ss_pred             CcceeEecCCC-CCCCc--eecc--CCCCCcCCeEEEE--------eeCCCCCcEEEEE
Q psy12689          1 MGTLSYYPWKG-FPGYF--FPFQ--NTEGYLAPVIAVH--------FESPAIGVLINIE   46 (72)
Q Consensus         1 ig~i~Y~P~~g-f~~~Y--fPy~--~~~~Y~~PlVAVq--------f~n~~~n~~i~Ie   46 (72)
                      .|+|.|||..+ |=..|  +|+.  +.+...+|++-+=        |.++..+..|+||
T Consensus        62 ~GDi~Yw~pg~~l~ifyg~~p~S~~~~~~~~~~v~~lG~i~~~~~~l~~~~~~~~V~ie  120 (120)
T PF04126_consen   62 AGDIAYWPPGGALAIFYGDTPISEGGEIRPASPVNVLGRIVSDLENLKEVKGGEKVRIE  120 (120)
T ss_dssp             TTEEEEECCCTEEEEESS--TT--TTSB--SSSEEEEEEEEC-GGGGGG--TTEEEEEE
T ss_pred             CceEEEeCCCCEEEEEecCcccccccccccCCcceEEEEECCCHHHHhhCCCCCeEEeC
Confidence            48899997665 33333  2333  2335566665442        3344455555554


No 13 
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=36.10  E-value=36  Score=17.80  Aligned_cols=10  Identities=20%  Similarity=0.504  Sum_probs=8.6

Q ss_pred             EEEEEEeecC
Q psy12689         43 INIECKAWAH   52 (72)
Q Consensus        43 i~IeCk~~a~   52 (72)
                      +.++|++.+.
T Consensus        18 ~~l~C~~~~~   27 (75)
T PF13927_consen   18 VTLTCSAEGG   27 (75)
T ss_dssp             EEEEEEESSE
T ss_pred             EEEEEEEccc
Confidence            8999999766


No 14 
>cd03452 MaoC_C MaoC_C  The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein. Orthologs of MaoC include PaaZ [Escherichia coli] and PaaN [Pseudomonas putida], which are putative ring-opening enzymes involved in phenylacetic acid degradation. The C-terminal domain of MaoC has sequence similarity to (R)-specific enoyl-CoA hydratase,Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  MaoC also has an N-terminal PutA domain like that found in the E. coli PutA proline dehydrogenase and other members of the aldehyde dehydrogenase family.
Probab=35.78  E-value=1.2e+02  Score=19.30  Aligned_cols=39  Identities=15%  Similarity=0.251  Sum_probs=24.3

Q ss_pred             EEEeeCCCC-CcEEEEEEEeecCCCcCCCCCceeeEEEEEEe
Q psy12689         31 AVHFESPAI-GVLINIECKAWAHNIHHDRHERRGSVHFELMI   71 (72)
Q Consensus        31 AVqf~n~~~-n~~i~IeCk~~a~NI~~d~~~~~G~v~F~l~v   71 (72)
                      -++|..|-. +..|++++++-.+.  ...++..|.|.+++.+
T Consensus        82 ~~rf~~PV~~GDtl~~~~~V~~~~--~~~~~~~~~v~~~~~~  121 (142)
T cd03452          82 NLRFLEPVYPGDTIQVRLTCKRKI--PRDGQDYGVVRWDAEV  121 (142)
T ss_pred             eEEECCCCCCCCEEEEEEEEEEEe--ecCCCCcEEEEEEEEE
Confidence            466777554 78888888874433  2223456778777654


No 15 
>PF02162 XYPPX:  XYPPX repeat (two copies);  InterPro: IPR006031 This repeat is found in a wide variety of proteins and generally consists of the motif XYPPX where X can be any amino acid. The family includes annexin VII ANX7_DICDI, the carboxy tail of certain rhodopsins OPSD_LOLSU. This family also includes plaque matrix proteins, however this motif is embedded in a ten residue repeat in FP1_MYTED. The molecular function of this repeat is unknown. It is also not clear is all the members of this family share a common evolutionary ancestor due to its short length and biased amino acid composition. 
Probab=34.80  E-value=22  Score=15.60  Aligned_cols=12  Identities=42%  Similarity=0.982  Sum_probs=7.6

Q ss_pred             ecCCCCCCCcee
Q psy12689          7 YPWKGFPGYFFP   18 (72)
Q Consensus         7 ~P~~gf~~~YfP   18 (72)
                      ||.+|+|.+=||
T Consensus         2 ~ppqG~pPQ~~P   13 (15)
T PF02162_consen    2 YPPQGYPPQGYP   13 (15)
T ss_pred             CCCcCCCCCCCC
Confidence            567777765554


No 16 
>PF01870 Hjc:  Archaeal holliday junction resolvase (hjc);  InterPro: IPR002732 This entry represents Holliday junction resolvases (hjc gene) and related proteins, primarily from archaeal species []. The Holliday junction is an essential intermediate of homologous recombination. Holliday junctions are four-stranded DNA complexes that are formed during recombination and related DNA repair events. In the presence of divalent cations, these junctions exist predominantly as the stacked-X form in which the double-helical segments are coaxially stacked and twisted by 60 degrees in a right-handed direction across the junction cross-over. In this structure, the stacked arms resemble two adjacent double-helices, but are linked at the junction by two common strands that cross-over between the duplexes []. During homologous recombination, genetic information is physically exchanged between parental DNAs via crossing single strands of the same polarity within the four-way Holliday structure. This process is terminated by the endonucleolytic activity of resolvases, which convert the four-way DNA back to two double strands.; PDB: 2WJ0_A 2WIZ_B 2WIW_B 2WCW_C 2WCZ_A 1HH1_A 1GEF_D 1IPI_B 2EO0_B 1OB9_A ....
Probab=33.61  E-value=91  Score=19.19  Aligned_cols=21  Identities=29%  Similarity=0.335  Sum_probs=17.2

Q ss_pred             CeEEEEeeCCCCCcEEEEEEEeecCC
Q psy12689         28 PVIAVHFESPAIGVLINIECKAWAHN   53 (72)
Q Consensus        28 PlVAVqf~n~~~n~~i~IeCk~~a~N   53 (72)
                      =+||++     .++.+-||||...++
T Consensus        27 DiiA~~-----~~~~l~IEvKs~~~~   47 (88)
T PF01870_consen   27 DIIAGK-----GGRYLAIEVKSTSKD   47 (88)
T ss_dssp             SEEEEE-----TTEEEEEEEEEESSS
T ss_pred             CEEEEC-----CCEEEEEEEeeccCC
Confidence            578876     677889999998876


No 17 
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=32.68  E-value=44  Score=18.67  Aligned_cols=16  Identities=25%  Similarity=0.430  Sum_probs=11.7

Q ss_pred             CcEEEEEEEeecCCCc
Q psy12689         40 GVLINIECKAWAHNIH   55 (72)
Q Consensus        40 n~~i~IeCk~~a~NI~   55 (72)
                      +..+.++|.+.+.=.+
T Consensus         1 G~~v~L~C~a~G~P~P   16 (69)
T cd05739           1 GGSVNLTCVAVGAPMP   16 (69)
T ss_pred             CCeEEEEEEeeecCCC
Confidence            3568999999876443


No 18 
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a member of class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules.  It functions as a Ca2+ sensor for fast exocytosis as do synaptotagmins 5, 6, and 10. It is distinguished from the other synaptotagmins by having an N-glycosylated N-terminus. Synaptotagmins 5, 6, and 10, members of class 3 synaptotagmins, are located primarily in the brain and localized to the active zone and plasma membrane.  They is distinguished from the other synaptotagmins by having disulfide bonds at its N-terminus.  Synaptotagmin 6 also regulates the acrosome reaction, a unique Ca2+-regulated exocytosis, in sperm. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and
Probab=32.63  E-value=89  Score=18.91  Aligned_cols=25  Identities=16%  Similarity=0.347  Sum_probs=16.3

Q ss_pred             EEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         44 NIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        44 ~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      .+++.+|..+- ...++.+|++.|.|
T Consensus        83 ~l~~~V~d~d~-~~~~~~lG~~~i~l  107 (124)
T cd08385          83 TLVFSVYDFDR-FSKHDLIGEVRVPL  107 (124)
T ss_pred             EEEEEEEeCCC-CCCCceeEEEEEec
Confidence            46666666642 22356999999876


No 19 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=32.10  E-value=45  Score=18.63  Aligned_cols=16  Identities=13%  Similarity=0.239  Sum_probs=13.3

Q ss_pred             CCCCcEEEEEEEeecC
Q psy12689         37 PAIGVLINIECKAWAH   52 (72)
Q Consensus        37 ~~~n~~i~IeCk~~a~   52 (72)
                      .+.+..+.++|.+.|.
T Consensus         6 v~~G~~~~L~C~~~g~   21 (85)
T cd05857           6 VPAANTVKFRCPAAGN   21 (85)
T ss_pred             cCCCCEEEEEEEcCCC
Confidence            4578999999998775


No 20 
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involv
Probab=31.84  E-value=96  Score=18.82  Aligned_cols=25  Identities=24%  Similarity=0.361  Sum_probs=16.3

Q ss_pred             EEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         44 NIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        44 ~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      .+++.+|..+-. .++++.|++.|.|
T Consensus        83 ~l~i~V~d~~~~-~~~~~iG~~~i~l  107 (124)
T cd08387          83 TLEVLLYDFDQF-SRDECIGVVELPL  107 (124)
T ss_pred             EEEEEEEECCCC-CCCceeEEEEEec
Confidence            456666766432 2356999999876


No 21 
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular
Probab=31.82  E-value=83  Score=18.70  Aligned_cols=22  Identities=14%  Similarity=0.339  Sum_probs=13.3

Q ss_pred             EEEeecCCCcCCCCCceeeEEEEE
Q psy12689         46 ECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        46 eCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      +..+|.++..  .++..|++.+.|
T Consensus        71 ~i~v~d~~~~--~~~~iG~~~i~l   92 (121)
T cd08391          71 EIELFDEDPD--KDDFLGRLSIDL   92 (121)
T ss_pred             EEEEEecCCC--CCCcEEEEEEEH
Confidence            3334555443  345889888875


No 22 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=31.77  E-value=54  Score=17.86  Aligned_cols=16  Identities=19%  Similarity=0.501  Sum_probs=12.5

Q ss_pred             CCCCcEEEEEEEeecC
Q psy12689         37 PAIGVLINIECKAWAH   52 (72)
Q Consensus        37 ~~~n~~i~IeCk~~a~   52 (72)
                      .+.+..+.++|++.+.
T Consensus         6 ~~~G~~v~L~C~~~g~   21 (82)
T cd05856           6 RPVGSSVRLKCVASGN   21 (82)
T ss_pred             ccCCCeEEEEEEeeEe
Confidence            4568899999998653


No 23 
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3). RasA3 are members of GTPase activating protein 1 (GAP1), a Ras-specific GAP, which suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  RasA3 contains an N-terminal C2 domain,  a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain
Probab=31.39  E-value=1.1e+02  Score=20.11  Aligned_cols=27  Identities=15%  Similarity=0.330  Sum_probs=18.3

Q ss_pred             EEEEEEeecCCCcCCCCCceeeEEEEEE
Q psy12689         43 INIECKAWAHNIHHDRHERRGSVHFELM   70 (72)
Q Consensus        43 i~IeCk~~a~NI~~d~~~~~G~v~F~l~   70 (72)
                      ..+++.+|...-. ..++++|.+.+.|.
T Consensus        79 ~~L~i~V~d~~~~-~~ddfLG~v~i~l~  105 (148)
T cd04010          79 LELRVDLWHASMG-GGDVFLGEVRIPLR  105 (148)
T ss_pred             EEEEEEEEcCCCC-CCCceeEEEEEecc
Confidence            4566777777542 34569999998763


No 24 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=31.33  E-value=69  Score=18.43  Aligned_cols=15  Identities=13%  Similarity=0.315  Sum_probs=11.0

Q ss_pred             CCCcEEEEEEEeecC
Q psy12689         38 AIGVLINIECKAWAH   52 (72)
Q Consensus        38 ~~n~~i~IeCk~~a~   52 (72)
                      ..+..+.++|++++.
T Consensus        17 ~~~~~~~l~C~~~g~   31 (91)
T cd04967          17 SDEGKVSLNCRARGS   31 (91)
T ss_pred             CCCCEEEEEEeeeEc
Confidence            344678999999764


No 25 
>PF01190 Pollen_Ole_e_I:  Pollen proteins Ole e I like;  InterPro: IPR006041 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Ole e 1. A number of plant pollen proteins, whose biological function is not yet known, are structurally related []. These proteins are most probably secreted and consist of about 145 residues. There are six cysteines which are conserved in the sequence of these proteins. They seem to be involved in disulphide bonds. 
Probab=30.79  E-value=45  Score=20.04  Aligned_cols=33  Identities=24%  Similarity=0.485  Sum_probs=22.5

Q ss_pred             CCCCcEEEEEEEeecCCCcC---CCCCceeeEEEEE
Q psy12689         37 PAIGVLINIECKAWAHNIHH---DRHERRGSVHFEL   69 (72)
Q Consensus        37 ~~~n~~i~IeCk~~a~NI~~---d~~~~~G~v~F~l   69 (72)
                      +=.+..|.|+|+--.++...   ...|..|...++|
T Consensus        20 ~l~GA~V~v~C~~~~~~~~~~~~~~Td~~G~F~i~l   55 (97)
T PF01190_consen   20 PLPGAKVSVECKDGNGGVVFSAEAKTDENGYFSIEL   55 (97)
T ss_pred             cCCCCEEEEECCCCCCCcEEEEEEEeCCCCEEEEEe
Confidence            34678999999986554332   2366778777776


No 26 
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=30.24  E-value=41  Score=18.35  Aligned_cols=16  Identities=19%  Similarity=0.441  Sum_probs=12.4

Q ss_pred             CCCCcEEEEEEEeecC
Q psy12689         37 PAIGVLINIECKAWAH   52 (72)
Q Consensus        37 ~~~n~~i~IeCk~~a~   52 (72)
                      ...+..+.++|.+.+.
T Consensus         6 ~~~G~~~~l~C~~~~~   21 (85)
T cd05729           6 VPAGSTVRLKCPASGN   21 (85)
T ss_pred             ecCCCcEEEEEEcCCC
Confidence            3468889999998764


No 27 
>PRK07274 single-stranded DNA-binding protein; Provisional
Probab=29.58  E-value=1.6e+02  Score=18.95  Aligned_cols=14  Identities=29%  Similarity=0.404  Sum_probs=6.9

Q ss_pred             CCCCcEEEEEEEee
Q psy12689         37 PAIGVLINIECKAW   50 (72)
Q Consensus        37 ~~~n~~i~IeCk~~   50 (72)
                      +.++..|.|++++.
T Consensus        65 l~KG~~V~V~Grl~   78 (131)
T PRK07274         65 ASKGSLISIDGELR   78 (131)
T ss_pred             cCCCCEEEEEEEEE
Confidence            34455555555553


No 28 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=28.86  E-value=59  Score=19.17  Aligned_cols=16  Identities=19%  Similarity=0.401  Sum_probs=13.1

Q ss_pred             CCCCcEEEEEEEeecC
Q psy12689         37 PAIGVLINIECKAWAH   52 (72)
Q Consensus        37 ~~~n~~i~IeCk~~a~   52 (72)
                      ...+..+.++|.+.+.
T Consensus        15 v~~g~~v~l~C~a~g~   30 (91)
T cd05740          15 PEDNQPVTLTCEAEGQ   30 (91)
T ss_pred             cccCCcEEEEEEeCCC
Confidence            4568899999999875


No 29 
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=28.19  E-value=52  Score=19.29  Aligned_cols=15  Identities=20%  Similarity=0.399  Sum_probs=13.2

Q ss_pred             CCCcEEEEEEEeecC
Q psy12689         38 AIGVLINIECKAWAH   52 (72)
Q Consensus        38 ~~n~~i~IeCk~~a~   52 (72)
                      ..+..+.++|++.|.
T Consensus        14 ~~G~~v~L~C~~~g~   28 (98)
T cd05758          14 ILGDKGRVECFIFST   28 (98)
T ss_pred             eCCCcEEEEEEEccc
Confidence            578999999999986


No 30 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=27.89  E-value=57  Score=18.56  Aligned_cols=15  Identities=27%  Similarity=0.454  Sum_probs=12.1

Q ss_pred             CCCcEEEEEEEeecC
Q psy12689         38 AIGVLINIECKAWAH   52 (72)
Q Consensus        38 ~~n~~i~IeCk~~a~   52 (72)
                      ..+..+.++|.+.+.
T Consensus        14 ~~g~~v~l~C~~~g~   28 (88)
T cd04968          14 LKGQNVTLECFALGN   28 (88)
T ss_pred             eCCCcEEEEEEeeEe
Confidence            467899999998664


No 31 
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16. Synaptotagmin 14 and 16 are membrane-trafficking proteins in specific tissues outside the brain.   Both of these contain C-terminal tandem C2 repeats, but only Synaptotagmin 14 has an N-terminal transmembrane domain and a putative fatty-acylation site. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium and this is indeed the case here.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicle
Probab=27.45  E-value=1.2e+02  Score=18.81  Aligned_cols=27  Identities=7%  Similarity=0.103  Sum_probs=18.6

Q ss_pred             EEEEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         42 LINIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        42 ~i~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      +..+.+++|+..- ..+++..|.+.+.|
T Consensus        81 ~~~L~~~V~~~~~-~~~~~~lG~~~i~L  107 (124)
T cd08389          81 NMALRFRLYGVER-MRKERLIGEKVVPL  107 (124)
T ss_pred             cCEEEEEEEECCC-cccCceEEEEEEec
Confidence            3456788887742 34466899998876


No 32 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=27.41  E-value=1e+02  Score=18.35  Aligned_cols=15  Identities=20%  Similarity=0.288  Sum_probs=12.6

Q ss_pred             CCCCcEEEEEEEeec
Q psy12689         37 PAIGVLINIECKAWA   51 (72)
Q Consensus        37 ~~~n~~i~IeCk~~a   51 (72)
                      ...+..+.++|++.|
T Consensus        12 v~~G~~v~l~C~~~G   26 (92)
T cd05866          12 LSVGESKFFTCTAIG   26 (92)
T ss_pred             EcCCCeEEEEEEEEE
Confidence            567899999999866


No 33 
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=27.00  E-value=1.1e+02  Score=17.54  Aligned_cols=16  Identities=19%  Similarity=0.517  Sum_probs=12.8

Q ss_pred             CCCcEEEEEEEeecCC
Q psy12689         38 AIGVLINIECKAWAHN   53 (72)
Q Consensus        38 ~~n~~i~IeCk~~a~N   53 (72)
                      ..+..+.++|++.+.-
T Consensus        14 ~~G~~v~L~C~v~G~P   29 (92)
T cd05737          14 MEGKTLNLTCTVFGDP   29 (92)
T ss_pred             eCCCcEEEEEEEEecC
Confidence            3678899999998764


No 34 
>cd04047 C2B_Copine C2 domain second repeat in Copine. There are 2 copies of the C2 domain present in copine, a protein involved in membrane trafficking, protein-protein interactions, and perhaps even cell division and growth.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1.  However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain.  C2 dom
Probab=26.26  E-value=1e+02  Score=18.19  Aligned_cols=25  Identities=16%  Similarity=0.298  Sum_probs=15.2

Q ss_pred             EEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         44 NIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        44 ~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      .+++.+|..+.. ..+++.|++++.|
T Consensus        71 ~l~~~V~d~d~~-~~d~~iG~~~~~l   95 (110)
T cd04047          71 PIKIEVYDYDSS-GKHDLIGEFETTL   95 (110)
T ss_pred             EEEEEEEEeCCC-CCCcEEEEEEEEH
Confidence            444555555432 2356999998864


No 35 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=26.06  E-value=65  Score=18.66  Aligned_cols=14  Identities=21%  Similarity=0.646  Sum_probs=10.5

Q ss_pred             CcEEEEEEEeecCC
Q psy12689         40 GVLINIECKAWAHN   53 (72)
Q Consensus        40 n~~i~IeCk~~a~N   53 (72)
                      +..+.++|++.+.-
T Consensus         1 G~~v~l~C~v~g~P   14 (90)
T cd04974           1 GSDVEFHCKVYSDA   14 (90)
T ss_pred             CCcEEEEEEEeCCC
Confidence            35789999987663


No 36 
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike Slp3 and Slp4/granuphilin which are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain.  In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety 
Probab=25.98  E-value=1.4e+02  Score=18.49  Aligned_cols=25  Identities=20%  Similarity=0.413  Sum_probs=15.5

Q ss_pred             EEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         44 NIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        44 ~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      .+++.+|..+- ..+++..|.+.|.|
T Consensus        85 ~L~~~V~d~~~-~~~~~~iG~~~i~L  109 (125)
T cd08393          85 VLNLSVWHRDS-LGRNSFLGEVEVDL  109 (125)
T ss_pred             EEEEEEEeCCC-CCCCcEeEEEEEec
Confidence            45566666531 23456899998876


No 37 
>PF07117 DUF1373:  Protein of unknown function (DUF1373);  InterPro: IPR009803 This family consists of several hypothetical proteins which seem to be specific to Oryzias latipes (Japanese ricefish). Members of this family are typically around 200 residues in length. The function of this family is unknown.
Probab=25.37  E-value=71  Score=22.82  Aligned_cols=22  Identities=27%  Similarity=0.730  Sum_probs=18.5

Q ss_pred             CcceeEecCCC---CCCCceeccCC
Q psy12689          1 MGTLSYYPWKG---FPGYFFPFQNT   22 (72)
Q Consensus         1 ig~i~Y~P~~g---f~~~YfPy~~~   22 (72)
                      ||.|.-||..|   ++...+||.+|
T Consensus        11 iGsi~C~PQg~~~~~~~~~~~ysGQ   35 (210)
T PF07117_consen   11 IGSISCFPQGGGGNMPSPMPPYSGQ   35 (210)
T ss_pred             ccceeeeccCCCCCCCCCcccccCc
Confidence            68999999764   88889999986


No 38 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=25.00  E-value=77  Score=18.39  Aligned_cols=13  Identities=23%  Similarity=0.478  Sum_probs=10.4

Q ss_pred             CcEEEEEEEeecC
Q psy12689         40 GVLINIECKAWAH   52 (72)
Q Consensus        40 n~~i~IeCk~~a~   52 (72)
                      ++.+.++|++-|.
T Consensus         1 g~~~~l~C~~~g~   13 (88)
T cd05735           1 GQKKEMSCTAHGE   13 (88)
T ss_pred             CCeEEEEEEEECC
Confidence            4678999998766


No 39 
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset. MCTPs are involved in Ca2+ signaling at the membrane.  Plant-MCTPs are composed of a variable N-terminal sequence, four C2 domains, two transmembrane regions (TMRs), and a short C-terminal sequence.  It is one of four protein classes that are anchored to membranes via a transmembrane region; the others being synaptotagmins, extended synaptotagmins, and ferlins. MCTPs are the only membrane-bound C2 domain proteins that contain two functional TMRs. MCTPs are unique in that they bind Ca2+ but not phospholipids. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates
Probab=24.36  E-value=1.2e+02  Score=18.51  Aligned_cols=26  Identities=15%  Similarity=0.126  Sum_probs=15.5

Q ss_pred             EEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         44 NIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        44 ~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      .++..+|..+-..+.++++|++.+.|
T Consensus        65 ~l~~~V~d~~~~~~~d~~lG~v~i~l   90 (127)
T cd04022          65 VLEVYVYNDRRSGRRRSFLGRVRISG   90 (127)
T ss_pred             eEEEEEeeCCCCcCCCCeeeEEEEcH
Confidence            45555666532222456899988865


No 40 
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=24.35  E-value=62  Score=18.14  Aligned_cols=17  Identities=24%  Similarity=0.296  Sum_probs=13.4

Q ss_pred             CCCCcEEEEEEEeecCC
Q psy12689         37 PAIGVLINIECKAWAHN   53 (72)
Q Consensus        37 ~~~n~~i~IeCk~~a~N   53 (72)
                      ...+..+.++|++.+.-
T Consensus        13 v~~G~~~~l~C~~~g~P   29 (100)
T cd07693          13 VSKGDPATLNCKAEGRP   29 (100)
T ss_pred             EcCCCeEEEEeeCCcCC
Confidence            35788999999997753


No 41 
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=24.33  E-value=1.1e+02  Score=18.02  Aligned_cols=14  Identities=14%  Similarity=0.259  Sum_probs=11.2

Q ss_pred             CCcEEEEEEEeecC
Q psy12689         39 IGVLINIECKAWAH   52 (72)
Q Consensus        39 ~n~~i~IeCk~~a~   52 (72)
                      .+..+.++|++.|.
T Consensus        18 ~g~~v~l~C~~~G~   31 (94)
T cd05848          18 DEKKVILNCEARGN   31 (94)
T ss_pred             CCCEEEEEEEeeec
Confidence            46789999998664


No 42 
>cd04481 RPA1_DBD_B_like RPA1_DBD_B_like: A subgroup of uncharacterized, plant OB folds with similarity to the third OB fold, the ssDNA-binding domain (DBD)-B, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-B, RPA1 contains three other OB folds: DBD-A, DBD-C, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in trimerization. The ssDNA binding mechanism is believed to be multistep and to involve conformational change.
Probab=24.12  E-value=44  Score=20.37  Aligned_cols=24  Identities=8%  Similarity=0.333  Sum_probs=14.6

Q ss_pred             CCeEEEEeeCCCCCcEEEEEEEeecCC
Q psy12689         27 APVIAVHFESPAIGVLINIECKAWAHN   53 (72)
Q Consensus        27 ~PlVAVqf~n~~~n~~i~IeCk~~a~N   53 (72)
                      +.-.-+++.+..   .-.++|.+|++-
T Consensus        22 ~~kr~~~i~D~~---~~~l~~tlwG~~   45 (106)
T cd04481          22 SRKLDFEIRDLS---DERLKCTLWGEY   45 (106)
T ss_pred             ceEEEEEEEeCC---CCEEEEEEEHHH
Confidence            333444444433   348999999983


No 43 
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=24.07  E-value=71  Score=18.39  Aligned_cols=15  Identities=20%  Similarity=0.543  Sum_probs=11.3

Q ss_pred             CcEEEEEEEeecCCC
Q psy12689         40 GVLINIECKAWAHNI   54 (72)
Q Consensus        40 n~~i~IeCk~~a~NI   54 (72)
                      +..+.++|.+++...
T Consensus         1 Ge~~~l~C~~~~~~~   15 (84)
T cd05861           1 GETITVNCIVQGNEV   15 (84)
T ss_pred             CCcEEEEEEEECCCc
Confidence            457899999988633


No 44 
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=23.71  E-value=68  Score=18.72  Aligned_cols=18  Identities=17%  Similarity=0.241  Sum_probs=14.3

Q ss_pred             CCCcEEEEEEEeecCCCc
Q psy12689         38 AIGVLINIECKAWAHNIH   55 (72)
Q Consensus        38 ~~n~~i~IeCk~~a~NI~   55 (72)
                      ..+..+.++|++.|..-+
T Consensus        11 ~~G~~v~l~C~a~G~P~P   28 (81)
T cd05749          11 TANTPFNLTCQAVGPPEP   28 (81)
T ss_pred             cCCCCEEEEEEeeeecCC
Confidence            467889999999887543


No 45 
>cd08680 C2_Kibra C2 domain found in Human protein Kibra. Kibra is thought to be a regulator of the Salvador (Sav)/Warts (Wts)/Hippo (Hpo) (SWH) signaling network, which limits tissue growth by inhibiting cell proliferation and promoting apoptosis. The core of the pathway consists of a MST and LATS family kinase cascade that ultimately phosphorylates and inactivates the YAP/Yorkie (Yki) transcription coactivator. The FERM domain proteins Merlin (Mer) and Expanded (Ex) are part of the upstream regulation controlling pathway mechanism.  Kibra colocalizes and associates with Mer and Ex and is thought to transduce an extracellular signal via the SWH network. The apical scaffold machinery that contains Hpo, Wts, and Ex recruits Yki to the apical membrane facilitating its inhibitory phosphorlyation by Wts.  Since Kibra associates with Ex and is apically located it is hypothesized that KIBRA is part of the scaffold, helps in the Hpo/Wts complex, and helps recruit Yki for inactivation that prom
Probab=23.59  E-value=1.2e+02  Score=19.17  Aligned_cols=27  Identities=11%  Similarity=0.190  Sum_probs=18.5

Q ss_pred             EEEEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         42 LINIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        42 ~i~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      ...++-.+|+.+ ...+++..|.+.|.|
T Consensus        82 ~~~L~~~V~~~~-~~~~~~~lG~~~i~L  108 (124)
T cd08680          82 QKTLQVDVCSVG-PDQQEECLGGAQISL  108 (124)
T ss_pred             cCEEEEEEEeCC-CCCceeEEEEEEEEh
Confidence            457777888775 223456889988875


No 46 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=23.36  E-value=1.2e+02  Score=17.61  Aligned_cols=16  Identities=13%  Similarity=0.198  Sum_probs=13.1

Q ss_pred             CCCCcEEEEEEEeecC
Q psy12689         37 PAIGVLINIECKAWAH   52 (72)
Q Consensus        37 ~~~n~~i~IeCk~~a~   52 (72)
                      ...+..+.++|++.+.
T Consensus        12 v~~G~~~~l~C~~~G~   27 (92)
T cd04977          12 ISVGESKFFLCQVIGE   27 (92)
T ss_pred             ECCCCeEEEEEEeEee
Confidence            4678999999999763


No 47 
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks). There are 3 classes of PI3Ks based on structure, regulation, and specificity.  All classes contain a N-terminal C2 domain, a PIK domain, and a kinase catalytic domain. Unlike class I and class III, class II PI3Ks have additionally a PX domain and a C-terminal C2 domain containing a nuclear localization signal both of which bind phospholipids though in a slightly different fashion.  PI3Ks (AKA phosphatidylinositol (PtdIns) 3-kinases) regulate cell processes such as cell growth, differentiation, proliferation, and motility. PI3Ks work on phosphorylation of phosphatidylinositol, phosphatidylinositide (4)P (PtdIns (4)P),2 or PtdIns(4,5)P2. Specifically they phosphorylate the D3 hydroxyl group of phosphoinositol lipids on the inositol ring. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permut
Probab=23.20  E-value=1.6e+02  Score=18.18  Aligned_cols=25  Identities=24%  Similarity=0.438  Sum_probs=16.8

Q ss_pred             EEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         44 NIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        44 ~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      .++..+|.++-. .+++++|.+.|.|
T Consensus        82 ~L~~~V~d~d~~-~~~~~lG~~~i~l  106 (122)
T cd08381          82 VLQVSVWSHDSL-VENEFLGGVCIPL  106 (122)
T ss_pred             EEEEEEEeCCCC-cCCcEEEEEEEec
Confidence            556677776532 3456899998876


No 48 
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I. Rab GTPases recruit various effector proteins to organelles and vesicles.  Rab11-family interacting proteins (FIPs) are involved in mediating the role of Rab11. FIPs can be divided into three classes: class I FIPs (Rip11a, Rip11b, RCP, and FIP2) which contain a C2 domain after N-terminus of the protein, class II FIPs (FIP3 and FIP4) which contain two EF-hands and a proline rich region, and class III FIPs (FIP1) which exhibits no homology to known protein domains. All FIP proteins contain a highly conserved, 20-amino acid motif at the C-terminus of the protein, known as Rab11/25 binding domain (RBD).  Class I FIPs are thought to bind to endocytic membranes via their C2 domain, which interacts directly with phospholipids. Class II FIPs do not have any membrane binding domains leaving much to speculate about the mechanism involving FIP3 and FIP4 interactions with endocytic membranes. The member
Probab=23.13  E-value=1.3e+02  Score=18.31  Aligned_cols=12  Identities=25%  Similarity=0.238  Sum_probs=8.8

Q ss_pred             CCCceeeEEEEE
Q psy12689         58 RHERRGSVHFEL   69 (72)
Q Consensus        58 ~~~~~G~v~F~l   69 (72)
                      .+++.|++.|.|
T Consensus        79 ~d~~iG~~~i~l   90 (126)
T cd08682          79 LDKFLGQVSIPL   90 (126)
T ss_pred             CCceeEEEEEEH
Confidence            346889988865


No 49 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=23.06  E-value=66  Score=17.74  Aligned_cols=13  Identities=23%  Similarity=0.463  Sum_probs=10.2

Q ss_pred             CcEEEEEEEeecC
Q psy12689         40 GVLINIECKAWAH   52 (72)
Q Consensus        40 n~~i~IeCk~~a~   52 (72)
                      +..+.++|++.|.
T Consensus         2 G~~v~l~C~~~g~   14 (74)
T cd05745           2 GQTVDFLCEAQGY   14 (74)
T ss_pred             CCeEEEEeECCEe
Confidence            5678999998654


No 50 
>TIGR03357 VI_zyme type VI secretion system lysozyme-related protein. The description for PFAM family pfam04965 cites acidic lysozyme activity for some phage-encoded members. This family represents a different subgroup of the proteins from pfam04965, where all members are associated with bacterial type VI secretion system genomic contexts.
Probab=22.88  E-value=2.1e+02  Score=18.07  Aligned_cols=27  Identities=11%  Similarity=0.041  Sum_probs=17.1

Q ss_pred             EEEEeeC---CCCCcEEEEEEEeecCCCcC
Q psy12689         30 IAVHFES---PAIGVLINIECKAWAHNIHH   56 (72)
Q Consensus        30 VAVqf~n---~~~n~~i~IeCk~~a~NI~~   56 (72)
                      +.|++..   .+....+.|+|++++.|-..
T Consensus        88 ~~V~~~~~~~~~~~l~f~I~~~l~~~~~~~  117 (133)
T TIGR03357        88 VRVTALEDEEDPLALRFRIEAELDVDGGPE  117 (133)
T ss_pred             eEEEEecCCCCccEEEEEEEEEEEeCCCCc
Confidence            5566642   22235579999999988543


No 51 
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=22.76  E-value=76  Score=17.25  Aligned_cols=13  Identities=31%  Similarity=0.570  Sum_probs=9.5

Q ss_pred             CcEEEEEEEeecC
Q psy12689         40 GVLINIECKAWAH   52 (72)
Q Consensus        40 n~~i~IeCk~~a~   52 (72)
                      +..+.++|++.+.
T Consensus         1 G~~~~l~C~~~g~   13 (74)
T cd05764           1 GQRATLRCKARGD   13 (74)
T ss_pred             CCeEEEEEEccCc
Confidence            4578899997653


No 52 
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=22.57  E-value=61  Score=18.74  Aligned_cols=14  Identities=21%  Similarity=0.330  Sum_probs=11.7

Q ss_pred             CCcEEEEEEEeecC
Q psy12689         39 IGVLINIECKAWAH   52 (72)
Q Consensus        39 ~n~~i~IeCk~~a~   52 (72)
                      .+..+.++|++.|.
T Consensus        13 ~g~~v~l~C~v~g~   26 (95)
T cd05722          13 RGGPVVLNCSAEGE   26 (95)
T ss_pred             CCCCEEEeeecccC
Confidence            57889999999775


No 53 
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=22.45  E-value=78  Score=18.34  Aligned_cols=15  Identities=27%  Similarity=0.454  Sum_probs=12.3

Q ss_pred             CCCcEEEEEEEeecC
Q psy12689         38 AIGVLINIECKAWAH   52 (72)
Q Consensus        38 ~~n~~i~IeCk~~a~   52 (72)
                      ..+..+.++|++.+.
T Consensus        14 ~~G~~v~l~C~~~G~   28 (88)
T cd05851          14 LKGQNVTLECFALGN   28 (88)
T ss_pred             eCCCcEEEEEEeccc
Confidence            467899999999765


No 54 
>cd06152 YjgF_YER057c_UK114_like_4 YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=22.42  E-value=1.4e+02  Score=18.65  Aligned_cols=22  Identities=23%  Similarity=0.225  Sum_probs=15.1

Q ss_pred             eEEEEeeCCC-CCcEEEEEEEee
Q psy12689         29 VIAVHFESPA-IGVLINIECKAW   50 (72)
Q Consensus        29 lVAVqf~n~~-~n~~i~IeCk~~   50 (72)
                      --.|.+..+. .+..|.|||.+|
T Consensus        92 ~t~v~V~~L~~p~~lVEIe~~A~  114 (114)
T cd06152          92 WTCVGVTALGLPGMRVEIEVDAI  114 (114)
T ss_pred             eEEEEeccCCCCCcEEEEEEEEC
Confidence            3345555665 469999999886


No 55 
>cd00448 YjgF_YER057c_UK114_family YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=22.40  E-value=1.6e+02  Score=17.01  Aligned_cols=23  Identities=30%  Similarity=0.322  Sum_probs=17.2

Q ss_pred             CCeEEEEeeCCCCCcEEEEEEEe
Q psy12689         27 APVIAVHFESPAIGVLINIECKA   49 (72)
Q Consensus        27 ~PlVAVqf~n~~~n~~i~IeCk~   49 (72)
                      .+...|....++++..|.|||.+
T Consensus        85 Pa~t~v~v~~l~~~~~VEie~~a  107 (107)
T cd00448          85 PARTAVGVAALPPGALVEIEAIA  107 (107)
T ss_pred             CceEEEEeccCCCCCEEEEEEEC
Confidence            45667777777888888888854


No 56 
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs). RasGAPs suppress Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras.  In this way it can control cellular proliferation and differentiation.  The proteins here all contain two tandem C2 domains,  a Ras-GAP domain, and a pleckstrin homology (PH)-like domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin
Probab=22.17  E-value=1.6e+02  Score=18.62  Aligned_cols=25  Identities=16%  Similarity=0.409  Sum_probs=15.4

Q ss_pred             EEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         44 NIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        44 ~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      .+++.+|..+-. ..+++.|++.+.|
T Consensus        79 ~l~i~V~d~~~~-~~~~~IG~~~i~l  103 (137)
T cd08675          79 ELRVELWHASMV-SGDDFLGEVRIPL  103 (137)
T ss_pred             EEEEEEEcCCcC-cCCcEEEEEEEeh
Confidence            455555655432 3456899998875


No 57 
>PF12997 DUF3881:  Domain of unknown function, E. rectale Gene description (DUF3881);  InterPro: IPR024541 This entry represents proteins of unknown function found primarily in Firmicutes. The Eubacterium rectale gene appears to be upregulated in the presence of Bacteroides thetaiotaomicron compared to growth in pure culture [].
Probab=22.04  E-value=1e+02  Score=23.17  Aligned_cols=25  Identities=20%  Similarity=0.296  Sum_probs=18.4

Q ss_pred             CCceeccCCCCCcCCeEEEEeeCCCCCcEEEEEEEee
Q psy12689         14 GYFFPFQNTEGYLAPVIAVHFESPAIGVLINIECKAW   50 (72)
Q Consensus        14 ~~YfPy~~~~~Y~~PlVAVqf~n~~~n~~i~IeCk~~   50 (72)
                      -+||||.-.            +..+...++.||+++-
T Consensus        68 eyYfPY~~g------------~~~s~~e~~svErh~d   92 (283)
T PF12997_consen   68 EYYFPYFRG------------SGISSYEDVSVERHAD   92 (283)
T ss_pred             EEEeeEEec------------CceeeeeeEEEEEEec
Confidence            579999632            2456778999999883


No 58 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=21.92  E-value=93  Score=17.35  Aligned_cols=14  Identities=21%  Similarity=0.349  Sum_probs=10.2

Q ss_pred             CcEEEEEEEeecCC
Q psy12689         40 GVLINIECKAWAHN   53 (72)
Q Consensus        40 n~~i~IeCk~~a~N   53 (72)
                      +..+.++|++.+.-
T Consensus         1 G~~v~l~C~~~g~P   14 (78)
T cd05743           1 GETVEFTCVATGVP   14 (78)
T ss_pred             CCEEEEEEEEEEec
Confidence            35788999996643


No 59 
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=21.79  E-value=76  Score=17.88  Aligned_cols=15  Identities=20%  Similarity=0.370  Sum_probs=12.4

Q ss_pred             CCCcEEEEEEEeecC
Q psy12689         38 AIGVLINIECKAWAH   52 (72)
Q Consensus        38 ~~n~~i~IeCk~~a~   52 (72)
                      ..+..++++|++.+.
T Consensus        14 ~~G~~v~L~C~~~~~   28 (85)
T cd05754          14 RPGADVSFICRAKSK   28 (85)
T ss_pred             cCCCCEEEEEEcCCC
Confidence            468899999999754


No 60 
>KOG0937|consensus
Probab=21.53  E-value=1.6e+02  Score=23.42  Aligned_cols=46  Identities=20%  Similarity=0.172  Sum_probs=33.2

Q ss_pred             ceeEecCCC-CCCCceeccCCCCCcCCeEEEEeeC-CCCCcEEEEEEEeec
Q psy12689          3 TLSYYPWKG-FPGYFFPFQNTEGYLAPVIAVHFES-PAIGVLINIECKAWA   51 (72)
Q Consensus         3 ~i~Y~P~~g-f~~~YfPy~~~~~Y~~PlVAVqf~n-~~~n~~i~IeCk~~a   51 (72)
                      .|.+-|..| |++|.|--..+..   |++.+.=.. --..-.+.|-||+-+
T Consensus       251 ~i~FiPPdGeF~Lm~Y~ls~~vk---Pli~~~~~~~~~~~~ri~i~~K~~~  298 (424)
T KOG0937|consen  251 TISFIPPDGEFELMRYRLSTHVK---PLIWFYQLIEEHSRSRIEVMVKLRE  298 (424)
T ss_pred             eEEecCCCCceEEEEEEecCCCC---CeEEeeeeeeeccceeEEEEEechh
Confidence            478889998 9999998887776   999886322 223345777777744


No 61 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=21.34  E-value=75  Score=17.93  Aligned_cols=13  Identities=46%  Similarity=0.567  Sum_probs=9.6

Q ss_pred             CcEEEEEEEeecC
Q psy12689         40 GVLINIECKAWAH   52 (72)
Q Consensus        40 n~~i~IeCk~~a~   52 (72)
                      +..+.++|++.+.
T Consensus         1 G~~~~l~C~~~g~   13 (73)
T cd05852           1 GGRVIIECKPKAA   13 (73)
T ss_pred             CCeEEEEEeccee
Confidence            3568899998664


No 62 
>PF14485 DUF4431:  Domain of unknown function (DUF4431)
Probab=21.14  E-value=1.5e+02  Score=16.24  Aligned_cols=20  Identities=15%  Similarity=0.346  Sum_probs=16.6

Q ss_pred             CCcEEEEEEEeecCCCcCCC
Q psy12689         39 IGVLINIECKAWAHNIHHDR   58 (72)
Q Consensus        39 ~n~~i~IeCk~~a~NI~~d~   58 (72)
                      .++.|.|.+++|..+-.++.
T Consensus        18 ~Gk~V~V~G~l~~a~t~hH~   37 (48)
T PF14485_consen   18 LGKRVSVTGKLFHAHTGHHH   37 (48)
T ss_pred             cCCeEEEEEEEeeccCcccC
Confidence            57999999999999776643


No 63 
>PF05560 Bt_P21:  Bacillus thuringiensis P21 molecular chaperone protein;  InterPro: IPR008423 This family contains several Bacillus thuringiensis P21 proteins. These proteins are thought to be molecular chaperones and have mosquitocidal properties [,].
Probab=21.06  E-value=1.3e+02  Score=20.80  Aligned_cols=29  Identities=17%  Similarity=0.494  Sum_probs=23.0

Q ss_pred             cEEEEEEEeecCCCcCCC-CC-ceeeEEEEE
Q psy12689         41 VLINIECKAWAHNIHHDR-HE-RRGSVHFEL   69 (72)
Q Consensus        41 ~~i~IeCk~~a~NI~~d~-~~-~~G~v~F~l   69 (72)
                      ..|+++-.+..||++.+. ++ +.|..||..
T Consensus       145 ~pv~l~ltl~~knvk~~s~~n~fsgd~hfnm  175 (182)
T PF05560_consen  145 IPVNLQLTLIPKNVKQNSFKNIFSGDMHFNM  175 (182)
T ss_pred             EeeeEEEEEecchhccccccceeccceeeeE
Confidence            556778889999999853 55 999999965


No 64 
>PLN03200 cellulose synthase-interactive protein; Provisional
Probab=21.01  E-value=1.2e+02  Score=28.67  Aligned_cols=31  Identities=29%  Similarity=0.582  Sum_probs=19.8

Q ss_pred             eCCCCCcEEEEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         35 ESPAIGVLINIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        35 ~n~~~n~~i~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      ..++.+..++|||.=  ++..  .+|.+|+++|.|
T Consensus      2035 ~~p~~~~~l~iev~d--~d~f--~kd~~G~~~i~l 2065 (2102)
T PLN03200       2035 DSPPKGQKLHISCKS--KNTF--GKSSLGKVTIQI 2065 (2102)
T ss_pred             cCCCCCCceEEEEEe--cCcc--CCCCCceEEEEH
Confidence            355556667777743  5433  345889998876


No 65 
>PF09458 H_lectin:  H-type lectin domain;  InterPro: IPR019019  The H-type lectin domain is a unit of six beta chains, combined into a homo-hexamer. It is involved in self/non-self recognition of cells, through binding with carbohydrates []. It is sometimes found in association with the C-terminal domain of coagulation factor F5/8 (IPR000421 from INTERPRO). ; GO: 0005529 sugar binding, 0007155 cell adhesion; PDB: 2CGY_A 2CGZ_A 2CCV_A 2CE6_A 2VME_B 2VMC_A 2VMD_A 2VM9_A 2W94_A 2WN3_C ....
Probab=20.81  E-value=1.7e+02  Score=16.25  Aligned_cols=28  Identities=14%  Similarity=0.245  Sum_probs=16.0

Q ss_pred             CCeEEEEeeCCC--CCcEEEEEEEeecCCCcC
Q psy12689         27 APVIAVHFESPA--IGVLINIECKAWAHNIHH   56 (72)
Q Consensus        27 ~PlVAVqf~n~~--~n~~i~IeCk~~a~NI~~   56 (72)
                      -|.|++-+..+.  .+....+++.+  .||..
T Consensus        16 ~P~V~~~i~~~d~~~~~~~~~~~~v--~~Vt~   45 (72)
T PF09458_consen   16 PPQVIVSINGLDFDSSQNIRFQVQV--SNVTT   45 (72)
T ss_dssp             --EEEEEEEEEEE-BTTEEEEEEEE--ESEES
T ss_pred             CCEEEEEEEEEEcCCCCceeEEEEE--EEECc
Confidence            477777766555  44555666555  77755


No 66 
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 7, a member of class 2 synaptotagmins, is located in presynaptic plasma membranes in neurons, dense-core vesicles in endocrine cells, and lysosomes in fibroblasts.  It has been shown to play a role in regulation of Ca2+-dependent lysosomal exocytosis in fibroblasts and may also function as a vesicular Ca2+-sensor.  It is distinguished from the other synaptotagmins by having over 12 splice forms. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic ves
Probab=20.80  E-value=2e+02  Score=17.28  Aligned_cols=25  Identities=16%  Similarity=0.212  Sum_probs=14.8

Q ss_pred             EEEEeecCCCcCCCCCceeeEEEEEE
Q psy12689         45 IECKAWAHNIHHDRHERRGSVHFELM   70 (72)
Q Consensus        45 IeCk~~a~NI~~d~~~~~G~v~F~l~   70 (72)
                      ++..+|...- ...+++.|++.+.|.
T Consensus        85 l~~~v~d~d~-~~~~~~iG~~~i~l~  109 (125)
T cd08386          85 LYLQVLDYDR-FSRNDPIGEVSLPLN  109 (125)
T ss_pred             EEEEEEeCCC-CcCCcEeeEEEEecc
Confidence            4555555431 123468999988763


No 67 
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=20.60  E-value=1.6e+02  Score=17.82  Aligned_cols=13  Identities=23%  Similarity=0.294  Sum_probs=11.4

Q ss_pred             CCcEEEEEEEeec
Q psy12689         39 IGVLINIECKAWA   51 (72)
Q Consensus        39 ~n~~i~IeCk~~a   51 (72)
                      .+..+.++|++.|
T Consensus        17 ~G~~v~L~c~v~g   29 (101)
T cd04975          17 LGENLNLVVEVEA   29 (101)
T ss_pred             CCCCEEEEEEEEe
Confidence            5678999999998


No 68 
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins. RIMs are believed to organize specialized sites of the plasma membrane called active zones.  They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning.  RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B).  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as 
Probab=20.52  E-value=2e+02  Score=17.18  Aligned_cols=26  Identities=19%  Similarity=0.427  Sum_probs=16.2

Q ss_pred             EEEEEeecCCCcCCCCCceeeEEEEEE
Q psy12689         44 NIECKAWAHNIHHDRHERRGSVHFELM   70 (72)
Q Consensus        44 ~IeCk~~a~NI~~d~~~~~G~v~F~l~   70 (72)
                      .++..+|...-. ..++..|.+.+.|.
T Consensus        86 ~l~~~V~d~~~~-~~~~~iG~~~i~l~  111 (125)
T cd04031          86 TLEVTVWDYDRD-GENDFLGEVVIDLA  111 (125)
T ss_pred             EEEEEEEeCCCC-CCCcEeeEEEEecc
Confidence            456666665321 23468999998763


No 69 
>PRK11401 putative endoribonuclease L-PSP; Provisional
Probab=20.19  E-value=1.6e+02  Score=18.51  Aligned_cols=20  Identities=25%  Similarity=0.199  Sum_probs=14.7

Q ss_pred             EEEeeCCCCCcEEEEEEEee
Q psy12689         31 AVHFESPAIGVLINIECKAW   50 (72)
Q Consensus        31 AVqf~n~~~n~~i~IeCk~~   50 (72)
                      +|+...++.+-.|.|||.+.
T Consensus       107 ~v~v~~L~~~~~VEIe~~A~  126 (129)
T PRK11401        107 CVQVARLPKDVKLEIEAIAV  126 (129)
T ss_pred             EEEcccCCCCCeEEEEEEEE
Confidence            45555667788889998875


No 70 
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmins 4 and 11, class 4 synaptotagmins, are located in the brain.  Their functions are unknown. They are distinguished from the other synaptotagmins by having and Asp to Ser substitution in their C2A domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence 
Probab=20.18  E-value=2e+02  Score=17.89  Aligned_cols=25  Identities=16%  Similarity=0.211  Sum_probs=15.9

Q ss_pred             EEEEEeecCCCcCCCCCceeeEEEEE
Q psy12689         44 NIECKAWAHNIHHDRHERRGSVHFEL   69 (72)
Q Consensus        44 ~IeCk~~a~NI~~d~~~~~G~v~F~l   69 (72)
                      .++.++|..+- ..+++..|++.+.|
T Consensus        85 ~L~~~V~d~d~-~~~d~~lG~~~i~L  109 (128)
T cd08388          85 SLHFAVLSFDR-YSRDDVIGEVVCPL  109 (128)
T ss_pred             EEEEEEEEcCC-CCCCceeEEEEEec
Confidence            35666666532 23456889998876


No 71 
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=20.15  E-value=1.5e+02  Score=18.29  Aligned_cols=15  Identities=27%  Similarity=0.463  Sum_probs=11.8

Q ss_pred             CCCcEEEEEEEeecC
Q psy12689         38 AIGVLINIECKAWAH   52 (72)
Q Consensus        38 ~~n~~i~IeCk~~a~   52 (72)
                      ..++.++++|.....
T Consensus        10 ~~G~~vtL~C~~~~~   24 (117)
T cd04981          10 KPGQSLKLSCKASGF   24 (117)
T ss_pred             cCCCCEEEEEEEeCC
Confidence            378999999987543


No 72 
>cd06156 eu_AANH_C_2 A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains. This CD contains the second of these domains. The YjgF-YER057c-UK114 protein family is a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
Probab=20.09  E-value=1.6e+02  Score=18.46  Aligned_cols=24  Identities=21%  Similarity=0.261  Sum_probs=19.7

Q ss_pred             cCCeEEEEeeCCCCCcEEEEEEEe
Q psy12689         26 LAPVIAVHFESPAIGVLINIECKA   49 (72)
Q Consensus        26 ~~PlVAVqf~n~~~n~~i~IeCk~   49 (72)
                      ..+..+|....++++-.|.|||.+
T Consensus        95 ~P~~t~v~V~~L~~~~~VEie~i~  118 (118)
T cd06156          95 NPPLVIVVVPELPRGALVEWQGIA  118 (118)
T ss_pred             CCcEEEEEcccCCCCCeEEEEEeC
Confidence            466778888899999999999963


Done!