Query         psy12694
Match_columns 112
No_of_seqs    43 out of 45
Neff          3.1 
Searched_HMMs 46136
Date          Fri Aug 16 17:15:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12694.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12694hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4218|consensus               99.6   2E-16 4.2E-21  135.3   5.6   34    1-36     93-126 (475)
  2 TIGR01602 PY-rept-46 Plasmodiu  54.0     3.6 7.8E-05   26.4  -0.3   16    4-19      3-18  (46)
  3 PF09689 PY_rept_46:  Plasmodiu  42.3     7.8 0.00017   24.9  -0.1   15    4-18      3-17  (46)
  4 COG3474 Cytochrome c2 [Energy   40.9      14 0.00029   28.3   0.9   10    2-11     49-58  (135)
  5 PRK06341 single-stranded DNA-b  34.8      36 0.00079   26.1   2.5   16   95-110   151-166 (166)
  6 PF10562 CaM_bdg_C0:  Calmoduli  20.5 1.2E+02  0.0026   17.8   2.3   14   11-24      2-15  (29)
  7 PF10405 BHD_3:  Rad4 beta-hair  19.2      41 0.00089   22.8   0.2    8    5-12      3-10  (76)
  8 PF09452 Mvb12:  ESCRT-I subuni  15.2      54  0.0012   23.6   0.0   18    5-22      8-25  (91)
  9 PF02234 CDI:  Cyclin-dependent  12.9      81  0.0018   19.7   0.4    7    5-11      1-7   (51)
 10 PF15086 UPF0542:  Uncharacteri  12.8 1.9E+02  0.0041   20.2   2.2   18   13-30     50-67  (74)

No 1  
>KOG4218|consensus
Probab=99.64  E-value=2e-16  Score=135.29  Aligned_cols=34  Identities=62%  Similarity=0.916  Sum_probs=30.7

Q ss_pred             CCCCCCCCCcchhhHHHHHHHHHHHhhhhhhhhhcc
Q psy12694          1 MRGGRNKFGPMYKRDRARKLQMMRQRQIAVQTLQRA   36 (112)
Q Consensus         1 MRGGRNKFGPmYKRDRA~k~Q~~~qr~ia~~~l~~s   36 (112)
                      |||||||||||||||||+|||+.  .+|..++++.|
T Consensus        93 MRGGRNKFGpmYKrDRAlkqQkk--AqirAng~KlE  126 (475)
T KOG4218|consen   93 MRGGRNKFGPMYKRDRALKQQKK--AQIRANGIKLE  126 (475)
T ss_pred             hcccccccCchhhhhHHHHHHHH--HHhhhcceeee
Confidence            89999999999999999999984  56777888888


No 2  
>TIGR01602 PY-rept-46 Plasmodium yoelii repeat of length 46. This repeat is found in only 2 genes in Plasmodium yoelii, in each of these genes it is repeated 9 times. It is found in no other organism.
Probab=53.98  E-value=3.6  Score=26.38  Aligned_cols=16  Identities=38%  Similarity=0.789  Sum_probs=13.6

Q ss_pred             CCCCCCcchhhHHHHH
Q psy12694          4 GRNKFGPMYKRDRARK   19 (112)
Q Consensus         4 GRNKFGPmYKRDRA~k   19 (112)
                      -|.||-.|||||.--|
T Consensus         3 KkSkF~sMFKrDK~dk   18 (46)
T TIGR01602         3 KRSRFPTMFKKDKKDK   18 (46)
T ss_pred             ccchhhHHHhcccccc
Confidence            4789999999998754


No 3  
>PF09689 PY_rept_46:  Plasmodium yoelii repeat (PY_rept_46);  InterPro: IPR006489  This repeat is found in the products of only 2 genes in Plasmodium yoelii, in each of these proteins it is repeated 9 times. It is found in no other organism. 
Probab=42.32  E-value=7.8  Score=24.94  Aligned_cols=15  Identities=33%  Similarity=0.778  Sum_probs=12.6

Q ss_pred             CCCCCCcchhhHHHH
Q psy12694          4 GRNKFGPMYKRDRAR   18 (112)
Q Consensus         4 GRNKFGPmYKRDRA~   18 (112)
                      -|.+|-.|+|||.--
T Consensus         3 KkSrFpsMFKrdKkD   17 (46)
T PF09689_consen    3 KKSRFPSMFKRDKKD   17 (46)
T ss_pred             ccccchHhhhccccc
Confidence            378999999999854


No 4  
>COG3474 Cytochrome c2 [Energy production and conversion]
Probab=40.88  E-value=14  Score=28.33  Aligned_cols=10  Identities=60%  Similarity=1.165  Sum_probs=8.6

Q ss_pred             CCCCCCCCcc
Q psy12694          2 RGGRNKFGPM   11 (112)
Q Consensus         2 RGGRNKFGPm   11 (112)
                      +||+||+||-
T Consensus        49 ~~g~nkvGP~   58 (135)
T COG3474          49 KGGPNKVGPH   58 (135)
T ss_pred             cCCCCCCCCc
Confidence            5899999994


No 5  
>PRK06341 single-stranded DNA-binding protein; Provisional
Probab=34.80  E-value=36  Score=26.13  Aligned_cols=16  Identities=31%  Similarity=0.706  Sum_probs=12.9

Q ss_pred             CCccccCCCCCCCCCC
Q psy12694         95 YSSSYIPSDMEDDVPY  110 (112)
Q Consensus        95 ~~~~~~~~~~~~~~~~  110 (112)
                      ..++-.-+||.||+||
T Consensus       151 ~~~~~~~~~~~~~~~~  166 (166)
T PRK06341        151 GGGGNFSRDMDDDIPF  166 (166)
T ss_pred             CCCCCccccccccCCC
Confidence            4456678999999997


No 6  
>PF10562 CaM_bdg_C0:  Calmodulin-binding domain C0 of NMDA receptor NR1 subunit;  InterPro: IPR018882  This is a very short highly conserved domain that is C-terminal to the cytosolic transmembrane region IV of the NMDA-receptor 1. It has been shown to bind Calmodulin-Calcium with high affinity. The ionotropic N-methyl-D-aspartate receptor (NMDAR) is a major source of calcium flux into neurons in the brain and plays a critical role in learning, memory, neural development, and synaptic plasticity. Calmodulin (CaM) regulates NMDARs by binding tightly to the C0 and C1 regions of their NR1 subunit. The conserved tryptophan is considered to be the anchor residue []. 
Probab=20.53  E-value=1.2e+02  Score=17.83  Aligned_cols=14  Identities=29%  Similarity=0.574  Sum_probs=9.7

Q ss_pred             chhhHHHHHHHHHH
Q psy12694         11 MYKRDRARKLQMMR   24 (112)
Q Consensus        11 mYKRDRA~k~Q~~~   24 (112)
                      +|||-|-+|+.++.
T Consensus         2 aYKkH~~~kqk~~e   15 (29)
T PF10562_consen    2 AYKKHQIRKQKQLE   15 (29)
T ss_pred             cchHHHHHHHHHHH
Confidence            69998877655444


No 7  
>PF10405 BHD_3:  Rad4 beta-hairpin domain 3;  InterPro: IPR018328 Mutations in the nucleotide excision repair (NER) pathway can cause the xeroderma pigmentosum skin cancer predisposition syndrome. NER lesions are limited to one DNA strand, but otherwise they are chemically and structurally diverse, being caused by a wide variety of genotoxic chemicals and ultraviolet radiation. The xeroderma pigmentosum C (XPC) protein has a central role in initiating global-genome NER by recognising the lesion and recruiting downstream factors. In NER in eukaryotes, DNA is incised on both sides of the lesion, resulting in the removal of a fragment ~25-30 nucleotides long. This is followed by repair synthesis and ligation. This reaction, in yeast, requires the damage binding factors Rad14, RPA, and the Rad4-Rad23 complex, the transcription factor TFIIH which contains the two DNA helicases Rad3 and Rad25, essential for creating a bubble structure, and the two endonucleases, the Rad1-Rad10 complex and Rad2, which incise the damaged DNA strand on the 5'- and 3'-side of the lesion, respectively []. The crystal structure of the yeast XPC orthologue Rad4 bound to DNA containing a cyclobutane pyrimidine dimer lesion has been determined. The structure shows that Rad4 inserts a beta-hairpin through the DNA duplex, causing the two damaged base pairs to flip out of the double helix. The expelled nucleotides of the undamaged strand are recognised by Rad4, whereas the two cyclobutane pyrimidine dimer-linked nucleotides become disordered. This indicates that the lesions recognised by Rad4/XPC thermodynamically destabilise the double helix in a manner that facilitates the flipping-out of two base pairs []. Homologues of all the above mentioned yeast genes, except for RAD7, RAD16, and MMS19, have been identified in humans, and mutations in these human genes affect NER in a similar fashion as they do in yeast, with the exception of XPC, the human counterpart of yeast RAD4. Deletion of RAD4 causes the same high level of UV sensitivity as do mutations in the other class 1 genes, and rad4 mutants are completely defective in incision. By contrast, XPC is required for the repair of nontranscribed regions of the genome but not for the repair of the transcribed DNA strand. This entry represents the DNA-binding domain of Rad4, which has a beta-hairpin structure []. Rad4 inserts a beta-hairpin through the DNA duplex, causing the two damaged base pairs to flip out of the double helix. ; GO: 0003684 damaged DNA binding, 0006289 nucleotide-excision repair, 0005634 nucleus; PDB: 2QSG_A 2QSF_A 2QSH_A.
Probab=19.21  E-value=41  Score=22.76  Aligned_cols=8  Identities=25%  Similarity=0.762  Sum_probs=3.5

Q ss_pred             CCCCCcch
Q psy12694          5 RNKFGPMY   12 (112)
Q Consensus         5 RNKFGPmY   12 (112)
                      ||+||+.+
T Consensus         3 kN~~GNie   10 (76)
T PF10405_consen    3 KNEYGNIE   10 (76)
T ss_dssp             --TTS-EE
T ss_pred             CCCCCCEE
Confidence            67777754


No 8  
>PF09452 Mvb12:  ESCRT-I subunit Mvb12;  InterPro: IPR019014  The endosomal sorting complex required for transport (ESCRT) complexes play a critical role in receptor down-regulation and retroviral budding. A new component of the ESCRT-I complex was identified [], multivesicular body sorting factor of 12 kDa (Mvb12), which binds to the coiled-coil domain of the ESCRT-I subunit vacuolar protein sorting 23 (Vps23) []. ; PDB: 2P22_D.
Probab=15.20  E-value=54  Score=23.64  Aligned_cols=18  Identities=39%  Similarity=0.696  Sum_probs=7.4

Q ss_pred             CCCCCcchhhHHHHHHHH
Q psy12694          5 RNKFGPMYKRDRARKLQM   22 (112)
Q Consensus         5 RNKFGPmYKRDRA~k~Q~   22 (112)
                      +||||..|-|-|-.|+++
T Consensus         8 YN~~g~~fP~~~l~kl~~   25 (91)
T PF09452_consen    8 YNKYGSDFPRERLPKLTV   25 (91)
T ss_dssp             EESSSTTS----------
T ss_pred             ccccccccchhhcccccC
Confidence            599999999877555553


No 9  
>PF02234 CDI:  Cyclin-dependent kinase inhibitor;  InterPro: IPR003175 Cell cycle progression is negatively controlled by cyclin-dependent kinases inhibitors (CDIs). CDIs are involved in cell cycle arrest at the G1 phase.; GO: 0004861 cyclin-dependent protein kinase inhibitor activity, 0007050 cell cycle arrest, 0005634 nucleus; PDB: 1H27_E 1JSU_C.
Probab=12.90  E-value=81  Score=19.73  Aligned_cols=7  Identities=71%  Similarity=1.388  Sum_probs=1.9

Q ss_pred             CCCCCcc
Q psy12694          5 RNKFGPM   11 (112)
Q Consensus         5 RNKFGPm   11 (112)
                      ||-|||.
T Consensus         1 R~LFgp~    7 (51)
T PF02234_consen    1 RNLFGPV    7 (51)
T ss_dssp             --SS---
T ss_pred             CCCCCCC
Confidence            7999987


No 10 
>PF15086 UPF0542:  Uncharacterised protein family UPF0542
Probab=12.85  E-value=1.9e+02  Score=20.24  Aligned_cols=18  Identities=39%  Similarity=0.490  Sum_probs=10.7

Q ss_pred             hhHHHHHHHHHHHhhhhh
Q psy12694         13 KRDRARKLQMMRQRQIAV   30 (112)
Q Consensus        13 KRDRA~k~Q~~~qr~ia~   30 (112)
                      +++|..|+|..++.+|+-
T Consensus        50 ~~ere~K~k~Kr~~~i~k   67 (74)
T PF15086_consen   50 KEEREKKKKAKRQANIAK   67 (74)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            455666666666666654


Done!