Query         psy12714
Match_columns 117
No_of_seqs    136 out of 1014
Neff          8.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:50:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12714.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12714hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF00412 LIM:  LIM domain;  Int  99.6   2E-15 4.3E-20   84.7   4.4   57   35-91      1-58  (58)
  2 KOG1701|consensus               99.4 1.6E-14 3.5E-19  107.3  -1.6   84   28-112   330-430 (468)
  3 KOG1044|consensus               99.4 1.7E-13 3.7E-18  105.1   3.3   83   29-112   130-216 (670)
  4 KOG1701|consensus               99.3 3.7E-13 8.1E-18  100.2  -0.7   81   30-111   272-362 (468)
  5 KOG2272|consensus               99.2   5E-13 1.1E-17   93.9  -1.3   84   30-113    10-98  (332)
  6 KOG1703|consensus               99.2 2.4E-12 5.3E-17   99.1   1.8   82   29-111   360-452 (479)
  7 KOG4577|consensus               99.2 6.6E-13 1.4E-17   94.8  -2.8   64   31-95     32-95  (383)
  8 KOG2272|consensus               98.9 1.6E-10 3.6E-15   81.4  -0.5   80   29-109   192-280 (332)
  9 smart00132 LIM Zinc-binding do  98.7 7.8E-09 1.7E-13   52.8   2.5   37   34-70      1-38  (39)
 10 KOG1700|consensus               98.7 2.5E-09 5.5E-14   74.0   0.1   85   28-112   104-188 (200)
 11 KOG1703|consensus               98.6 2.4E-08 5.1E-13   77.2   3.8   81   30-110   301-390 (479)
 12 KOG1700|consensus               98.6 1.4E-08 3.1E-13   70.2   1.5   66   30-95      5-70  (200)
 13 KOG4577|consensus               98.4 5.1E-08 1.1E-12   70.1   0.4   68   28-95     88-158 (383)
 14 KOG1702|consensus               98.4 1.1E-08 2.3E-13   70.4  -3.2   58   33-90      5-62  (264)
 15 KOG1044|consensus               98.2 2.3E-06 4.9E-11   66.6   4.1   80   29-111    13-93  (670)
 16 KOG0490|consensus               95.1  0.0026 5.6E-08   44.3  -1.7   57   38-95      2-62  (235)
 17 PF09943 DUF2175:  Uncharacteri  90.3   0.089 1.9E-06   32.6   0.1   33   34-66      4-37  (101)
 18 COG4357 Zinc finger domain con  86.5   0.087 1.9E-06   32.3  -1.7   58   35-96     38-95  (105)
 19 PF08394 Arc_trans_TRASH:  Arch  81.6    0.58 1.3E-05   23.6   0.4   31   35-68      1-32  (37)
 20 PF10367 Vps39_2:  Vacuolar sor  80.8     1.2 2.6E-05   27.1   1.7   30   31-60     77-107 (109)
 21 PF14471 DUF4428:  Domain of un  80.0     1.7 3.6E-05   23.5   1.9   29   61-90      1-30  (51)
 22 PF11781 RRN7:  RNA polymerase   74.8     1.9 4.2E-05   21.5   1.1   23   61-87     10-32  (36)
 23 PF14446 Prok-RING_1:  Prokaryo  72.8     2.1 4.6E-05   23.5   1.1   29   32-60      5-36  (54)
 24 COG1645 Uncharacterized Zn-fin  72.3     1.6 3.5E-05   28.4   0.6   21   62-87     31-51  (131)
 25 COG4847 Uncharacterized protei  71.6     1.4 3.1E-05   26.9   0.2   37   32-68      6-43  (103)
 26 PF13240 zinc_ribbon_2:  zinc-r  71.1     2.3 4.9E-05   19.0   0.8    8   35-42      2-9   (23)
 27 PF12674 Zn_ribbon_2:  Putative  70.9     2.4 5.2E-05   25.2   1.1   28   61-88      2-34  (81)
 28 COG2191 Formylmethanofuran deh  67.0       2 4.4E-05   30.0   0.2   31   60-90    173-203 (206)
 29 PF01258 zf-dskA_traR:  Prokary  61.9     3.2   7E-05   20.4   0.4   27   62-88      6-32  (36)
 30 PF00645 zf-PARP:  Poly(ADP-rib  59.8     4.6 9.9E-05   23.6   0.8   17   30-46      5-21  (82)
 31 PF06677 Auto_anti-p27:  Sjogre  59.3     3.8 8.3E-05   21.1   0.4   21   62-86     20-40  (41)
 32 cd02336 ZZ_RSC8 Zinc finger, Z  57.9     8.5 0.00018   20.2   1.6   29   61-89      2-32  (45)
 33 PF02069 Metallothio_Pro:  Prok  56.4     7.3 0.00016   21.2   1.2   28   61-88      9-37  (52)
 34 KOG3579|consensus               53.8      13 0.00029   27.4   2.5   50   30-84    266-315 (352)
 35 PRK00420 hypothetical protein;  53.0     5.6 0.00012   25.2   0.4   10   33-42     24-33  (112)
 36 PF13248 zf-ribbon_3:  zinc-rib  48.4      10 0.00022   17.2   0.8    9   34-42      4-12  (26)
 37 smart00291 ZnF_ZZ Zinc-binding  45.6      19 0.00041   18.4   1.7   11   79-89     26-36  (44)
 38 PF00628 PHD:  PHD-finger;  Int  44.3      16 0.00035   18.9   1.3   46   35-87      2-49  (51)
 39 cd02249 ZZ Zinc finger, ZZ typ  44.0      19 0.00041   18.6   1.6   10   79-88     22-31  (46)
 40 PF00320 GATA:  GATA zinc finge  42.9      34 0.00074   16.7   2.3   26   62-87      1-27  (36)
 41 PF14835 zf-RING_6:  zf-RING of  42.6      17 0.00036   20.7   1.3   35   61-95      9-43  (65)
 42 smart00504 Ubox Modified RING   41.4      36 0.00078   18.2   2.6   31   60-91      2-32  (63)
 43 PRK00807 50S ribosomal protein  37.7      20 0.00043   19.3   1.0   24   33-56      2-28  (52)
 44 PF14569 zf-UDP:  Zinc-binding   35.7      44 0.00096   19.8   2.3   21   31-55      8-28  (80)
 45 PF13834 DUF4193:  Domain of un  34.3      12 0.00026   23.1  -0.2   28   59-86     70-98  (99)
 46 PF00569 ZZ:  Zinc finger, ZZ t  33.4      36 0.00078   17.6   1.6   11   79-89     27-37  (46)
 47 PF10235 Cript:  Microtubule-as  33.2      41 0.00088   20.4   2.0   39   28-72     40-82  (90)
 48 PF05502 Dynactin_p62:  Dynacti  32.7      25 0.00054   27.8   1.3   39   32-71     26-64  (483)
 49 PF13923 zf-C3HC4_2:  Zinc fing  32.1      52  0.0011   16.0   2.1   30   63-92      2-31  (39)
 50 PF10886 DUF2685:  Protein of u  32.1      35 0.00075   18.7   1.4   16   34-49      3-18  (54)
 51 PF08746 zf-RING-like:  RING-li  32.1     7.7 0.00017   20.0  -1.1   26   35-60      1-28  (43)
 52 PF07754 DUF1610:  Domain of un  31.5      31 0.00068   15.6   1.0    9   35-43      1-9   (24)
 53 KOG0955|consensus               31.5      40 0.00087   29.4   2.3   68   30-108   217-289 (1051)
 54 COG0266 Nei Formamidopyrimidin  30.7      25 0.00054   25.8   0.9   15   28-42    241-255 (273)
 55 PF10080 DUF2318:  Predicted me  29.2      26 0.00055   21.8   0.7   29   55-87     31-59  (102)
 56 PF07503 zf-HYPF:  HypF finger;  28.5      16 0.00034   18.1  -0.3   30   35-69      2-31  (35)
 57 PF12855 Ecl1:  Life-span regul  27.1      31 0.00068   17.9   0.7   22   62-87      9-31  (43)
 58 TIGR02098 MJ0042_CXXC MJ0042 f  27.0      24 0.00053   17.2   0.2    9   34-42      4-12  (38)
 59 KOG2893|consensus               26.8      27 0.00059   25.3   0.5   52   30-89      8-60  (341)
 60 PRK00398 rpoP DNA-directed RNA  26.3      31 0.00068   17.7   0.6   28   33-69      4-31  (46)
 61 cd02341 ZZ_ZZZ3 Zinc finger, Z  25.7      65  0.0014   17.0   1.8   10   80-89     26-35  (48)
 62 COG5152 Uncharacterized conser  25.2      40 0.00087   23.7   1.1   49   59-111   196-246 (259)
 63 cd00162 RING RING-finger (Real  25.0      35 0.00076   16.3   0.6    7   35-41      2-8   (45)
 64 COG1998 RPS31 Ribosomal protei  25.0      33 0.00072   18.5   0.5    9   78-86     35-43  (51)
 65 COG4416 Com Mu-like prophage p  24.8      17 0.00038   19.9  -0.6   12   32-43      4-15  (60)
 66 PF06750 DiS_P_DiS:  Bacterial   24.7      24 0.00053   21.3  -0.0   41   29-71     30-70  (92)
 67 PF05570 DUF765:  Circovirus pr  24.6      88  0.0019   14.4   2.0   23    2-24      2-24  (29)
 68 cd02340 ZZ_NBR1_like Zinc fing  24.3      72  0.0016   16.3   1.8    9   80-88     23-31  (43)
 69 KOG0978|consensus               24.1      33 0.00071   28.5   0.6   33   60-94    644-677 (698)
 70 PRK00085 recO DNA repair prote  23.4      32  0.0007   24.1   0.4   28   60-87    150-177 (247)
 71 TIGR00373 conserved hypothetic  23.1      22 0.00047   23.7  -0.5   32   31-70    108-139 (158)
 72 PF00130 C1_1:  Phorbol esters/  22.9      28  0.0006   18.2  -0.0   12   31-42     10-21  (53)
 73 PF04810 zf-Sec23_Sec24:  Sec23  22.7      68  0.0015   16.0   1.4   11   33-43      3-13  (40)
 74 PF06689 zf-C4_ClpX:  ClpX C4-t  22.6 1.2E+02  0.0026   15.2   2.6   28   61-88      3-32  (41)
 75 PRK01103 formamidopyrimidine/5  22.4      45 0.00098   24.1   1.0   15   28-42    241-255 (274)
 76 PRK14811 formamidopyrimidine-D  22.2      45 0.00097   24.2   1.0   15   28-42    231-245 (269)
 77 PF02591 DUF164:  Putative zinc  22.0      20 0.00044   19.3  -0.7   12   61-72     24-35  (56)
 78 PF11571 Med27:  Mediator compl  21.9      45 0.00097   19.9   0.8   14   29-42     51-64  (90)
 79 PF01927 Mut7-C:  Mut7-C RNAse   21.8      46   0.001   21.7   0.9   38   32-69     91-134 (147)
 80 KOG2186|consensus               21.6      21 0.00046   25.9  -0.8   44   33-77      4-47  (276)
 81 PF09723 Zn-ribbon_8:  Zinc rib  21.4      22 0.00049   18.0  -0.6   11   32-42      5-15  (42)
 82 PRK06266 transcription initiat  21.4      28 0.00061   23.7  -0.2   33   31-71    116-148 (178)
 83 smart00531 TFIIE Transcription  21.0      28 0.00061   22.7  -0.3   38   30-70     97-134 (147)
 84 PF14255 Cys_rich_CPXG:  Cystei  21.0      26 0.00057   19.0  -0.4   29   34-62      2-30  (52)
 85 TIGR00270 conserved hypothetic  20.9      72  0.0016   21.2   1.7    9   35-43      3-11  (154)
 86 cd02335 ZZ_ADA2 Zinc finger, Z  20.9      89  0.0019   16.3   1.7   10   80-89     24-33  (49)
 87 PRK14810 formamidopyrimidine-D  20.1      53  0.0011   23.8   0.9   15   28-42    240-254 (272)
 88 PRK13945 formamidopyrimidine-D  20.1      49  0.0011   24.1   0.8   15   28-42    250-264 (282)
 89 smart00249 PHD PHD zinc finger  20.0      82  0.0018   15.2   1.5   26   35-60      2-29  (47)

No 1  
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=99.58  E-value=2e-15  Score=84.75  Aligned_cols=57  Identities=30%  Similarity=0.799  Sum_probs=52.2

Q ss_pred             ccccccccccCccE-EeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhh
Q psy12714         35 CFACNKKVYPLEKI-ETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLF   91 (117)
Q Consensus        35 C~~C~~~i~~~~~~-~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~   91 (117)
                      |.+|+++|...+.+ .+.++.||..||+|..|+..|....++..++++||..||.++|
T Consensus         1 C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~f   58 (58)
T PF00412_consen    1 CARCGKPIYGTEIVIKAMGKFWHPECFKCSKCGKPLNDGDFYEKDGKPYCKDCYQKRF   58 (58)
T ss_dssp             BTTTSSBESSSSEEEEETTEEEETTTSBETTTTCBTTTSSEEEETTEEEEHHHHHHHT
T ss_pred             CCCCCCCccCcEEEEEeCCcEEEccccccCCCCCccCCCeeEeECCEEECHHHHhhhC
Confidence            78999999877765 6999999999999999999999888888999999999998876


No 2  
>KOG1701|consensus
Probab=99.40  E-value=1.6e-14  Score=107.31  Aligned_cols=84  Identities=23%  Similarity=0.514  Sum_probs=72.1

Q ss_pred             CCcccccccccccccccCccEEeCCCcccccCcccccCCccccCCCccc-cCCeeccHHHHHhhhCCCC-----------
Q psy12714         28 TGNPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTM-NNGHLYCLPHFKQLFISRG-----------   95 (117)
Q Consensus        28 ~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~-~~g~~~C~~~y~~~~~~kc-----------   95 (117)
                      +++...+|..|++.|. ..++.+.++.||..||+|..|.+.|....|.. .++.+||-.||.++|+|||           
T Consensus       330 yq~tlekC~~Cg~~I~-d~iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~  408 (468)
T KOG1701|consen  330 YQDTLEKCNKCGEPIM-DRILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRD  408 (468)
T ss_pred             HHHHHHHHhhhhhHHH-HHHHHhcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCCC
Confidence            5666789999999995 45578999999999999999999999888887 5899999999999999998           


Q ss_pred             -----ccccccCccccccCCcc
Q psy12714         96 -----NYDEGFGSDQHKRKWQP  112 (117)
Q Consensus        96 -----~~~~~~~~~~~~~~~~~  112 (117)
                           ..+.++++.||-+-||=
T Consensus       409 G~~etvRvvamdr~fHv~CY~C  430 (468)
T KOG1701|consen  409 GKDETVRVVAMDRDFHVNCYKC  430 (468)
T ss_pred             CCcceEEEEEccccccccceeh
Confidence                 34567778888777763


No 3  
>KOG1044|consensus
Probab=99.39  E-value=1.7e-13  Score=105.06  Aligned_cols=83  Identities=22%  Similarity=0.502  Sum_probs=68.7

Q ss_pred             CcccccccccccccccCccEEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCCCC----ccccccCcc
Q psy12714         29 GNPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRG----NYDEGFGSD  104 (117)
Q Consensus        29 ~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc----~~~~~~~~~  104 (117)
                      ..+...|++|++.|..++.+.++++.||..||+|..|+..| .+.|..++|.+||+.||.+.|+-||    .||.|..-.
T Consensus       130 ~~~ps~cagc~~~lk~gq~llald~qwhv~cfkc~~c~~vL-~gey~skdg~pyce~dy~~~fgvkc~~c~~fisgkvLq  208 (670)
T KOG1044|consen  130 SYGPSTCAGCGEELKNGQALLALDKQWHVSCFKCKSCSAVL-NGEYMSKDGVPYCEKDYQAKFGVKCEECEKFISGKVLQ  208 (670)
T ss_pred             ccCCccccchhhhhhccceeeeeccceeeeeeehhhhcccc-cceeeccCCCcchhhhhhhhcCeehHHhhhhhhhhhhh
Confidence            35667899999999888889999999999999999999999 4579999999999999999999998    455544443


Q ss_pred             ccccCCcc
Q psy12714        105 QHKRKWQP  112 (117)
Q Consensus       105 ~~~~~~~~  112 (117)
                      .-..||||
T Consensus       209 ag~kh~HP  216 (670)
T KOG1044|consen  209 AGDKHFHP  216 (670)
T ss_pred             ccCcccCc
Confidence            33355554


No 4  
>KOG1701|consensus
Probab=99.28  E-value=3.7e-13  Score=100.16  Aligned_cols=81  Identities=23%  Similarity=0.485  Sum_probs=68.6

Q ss_pred             cccccccccccccccCcc-EEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCCCC---------cccc
Q psy12714         30 NPSSLCFACNKKVYPLEK-IETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRG---------NYDE   99 (117)
Q Consensus        30 ~~~~~C~~C~~~i~~~~~-~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc---------~~~~   99 (117)
                      .....|.+|+|.|+..+. +.++++.||..||.|..|.+.|..+.||..++++||+.||++.+ .||         ..+.
T Consensus       272 ~~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tl-ekC~~Cg~~I~d~iLr  350 (468)
T KOG1701|consen  272 DYFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTL-EKCNKCGEPIMDRILR  350 (468)
T ss_pred             hhhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHH-HHHhhhhhHHHHHHHH
Confidence            334599999999976554 57999999999999999999999999999999999999998765 344         4567


Q ss_pred             ccCccccccCCc
Q psy12714        100 GFGSDQHKRKWQ  111 (117)
Q Consensus       100 ~~~~~~~~~~~~  111 (117)
                      ++|++||..-|.
T Consensus       351 A~GkayHp~CF~  362 (468)
T KOG1701|consen  351 ALGKAYHPGCFT  362 (468)
T ss_pred             hcccccCCCceE
Confidence            889999987664


No 5  
>KOG2272|consensus
Probab=99.25  E-value=5e-13  Score=93.89  Aligned_cols=84  Identities=26%  Similarity=0.579  Sum_probs=74.4

Q ss_pred             cccccccccccccccCcc-EEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCCCC----ccccccCcc
Q psy12714         30 NPSSLCFACNKKVYPLEK-IETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRG----NYDEGFGSD  104 (117)
Q Consensus        30 ~~~~~C~~C~~~i~~~~~-~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc----~~~~~~~~~  104 (117)
                      .....|.+|.......+. +...+..||..||.|..|-.++.++.|+..+|+.||+.+|..+|+|.|    .|+.|....
T Consensus        10 ~~~~~C~RC~~gF~~~e~~vns~ge~wH~~CFvCAQCf~pf~~g~~~efEgRkYCEhDF~~LfaPcC~kC~EFiiGrVik   89 (332)
T KOG2272|consen   10 LANMVCERCRDGFEPAEKIVNSNGELWHEQCFVCAQCFRPFPDGIFYEFEGRKYCEHDFHVLFAPCCGKCGEFIIGRVIK   89 (332)
T ss_pred             HHHHHHHHHhccCCchhhhhccCchhhHHHHHHHHHhcCcCCCceeEEecCcccccccchhhhchhhcccccchhhHHHH
Confidence            345689999998877665 468899999999999999999999999999999999999999999987    688888888


Q ss_pred             ccccCCccc
Q psy12714        105 QHKRKWQPV  113 (117)
Q Consensus       105 ~~~~~~~~~  113 (117)
                      ..++.|||.
T Consensus        90 amnnSwHp~   98 (332)
T KOG2272|consen   90 AMNNSWHPA   98 (332)
T ss_pred             hhccccCcc
Confidence            888899885


No 6  
>KOG1703|consensus
Probab=99.24  E-value=2.4e-12  Score=99.11  Aligned_cols=82  Identities=28%  Similarity=0.536  Sum_probs=71.7

Q ss_pred             CcccccccccccccccCccEEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCCCC-----------cc
Q psy12714         29 GNPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRG-----------NY   97 (117)
Q Consensus        29 ~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc-----------~~   97 (117)
                      ....+.|.+|+++|. .+.|.+.+..||+.||.|..|.+.|....|+..++.+||+.||..+++++|           ..
T Consensus       360 ~~~~p~C~~C~~~i~-~~~v~a~~~~wH~~cf~C~~C~~~~~~~~~~~~~~~pyce~~~~~~~~~~~~~~~~p~~~~~~~  438 (479)
T KOG1703|consen  360 APFRPNCKRCLLPIL-EEGVCALGRLWHPECFVCADCGKPLKNSSFFESDGEPYCEDHYKKLFTTKCDYCKKPVEFGSRQ  438 (479)
T ss_pred             HhhCccccccCCchH-HhHhhhccCeechhceeeecccCCCCCCcccccCCccchhhhHhhhccccchhccchhHhhhhH
Confidence            566789999999995 566778899999999999999999999999999999999999999998776           34


Q ss_pred             ccccCccccccCCc
Q psy12714         98 DEGFGSDQHKRKWQ  111 (117)
Q Consensus        98 ~~~~~~~~~~~~~~  111 (117)
                      +++.+..||...|.
T Consensus       439 ie~~~~~~h~~~F~  452 (479)
T KOG1703|consen  439 IEADGSPFHGDCFR  452 (479)
T ss_pred             hhccCcccccccee
Confidence            56778888888875


No 7  
>KOG4577|consensus
Probab=99.20  E-value=6.6e-13  Score=94.78  Aligned_cols=64  Identities=19%  Similarity=0.527  Sum_probs=58.8

Q ss_pred             ccccccccccccccCccEEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCCCC
Q psy12714         31 PSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRG   95 (117)
Q Consensus        31 ~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc   95 (117)
                      ..+.|++|.+.|.+..++.++++.||-.|++|+.|..+|.. ..+.+++.+||+.+|.++|++||
T Consensus        32 eip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~d-rCFsR~~s~yCkedFfKrfGTKC   95 (383)
T KOG4577|consen   32 EIPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLAD-RCFSREGSVYCKEDFFKRFGTKC   95 (383)
T ss_pred             ccccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHHH-HHhhcCCceeehHHHHHHhCCcc
Confidence            57899999999976666789999999999999999999965 58889999999999999999999


No 8  
>KOG2272|consensus
Probab=98.91  E-value=1.6e-10  Score=81.35  Aligned_cols=80  Identities=21%  Similarity=0.316  Sum_probs=65.1

Q ss_pred             CcccccccccccccccCccEEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCCCC---------cccc
Q psy12714         29 GNPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRG---------NYDE   99 (117)
Q Consensus        29 ~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc---------~~~~   99 (117)
                      ..+.+.|..|.++|. ...+.++++.||.+.|+|.+|-+++-+-..|.+.|..||+.+|.++|+--|         ..++
T Consensus       192 ~mgipiCgaC~rpIe-ervi~amgKhWHveHFvCa~CekPFlGHrHYEkkGlaYCe~h~~qLfG~~CF~C~~~i~G~vv~  270 (332)
T KOG2272|consen  192 KMGIPICGACRRPIE-ERVIFAMGKHWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFICNRVIGGDVVS  270 (332)
T ss_pred             ccCCcccccccCchH-HHHHHHhccccchhheeehhcCCcccchhhhhhcCchhHHHHHHHHhhhhheecCCccCccHHH
Confidence            456788999999994 344679999999999999999999877788999999999999999999876         3445


Q ss_pred             ccCccccccC
Q psy12714        100 GFGSDQHKRK  109 (117)
Q Consensus       100 ~~~~~~~~~~  109 (117)
                      +++.+|=.+.
T Consensus       271 al~KawCv~c  280 (332)
T KOG2272|consen  271 ALNKAWCVEC  280 (332)
T ss_pred             Hhhhhhcccc
Confidence            5555554443


No 9  
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=98.74  E-value=7.8e-09  Score=52.84  Aligned_cols=37  Identities=30%  Similarity=0.716  Sum_probs=32.4

Q ss_pred             cccccccccccC-ccEEeCCCcccccCcccccCCcccc
Q psy12714         34 LCFACNKKVYPL-EKIETDGKLFHRACFRCTQCCTVLR   70 (117)
Q Consensus        34 ~C~~C~~~i~~~-~~~~~~~~~~H~~Cf~C~~C~~~L~   70 (117)
                      +|.+|++.|... ..+...++.||..||.|..|+.+|.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   38 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGKPLG   38 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCCcCc
Confidence            589999999776 5567899999999999999999884


No 10 
>KOG1700|consensus
Probab=98.71  E-value=2.5e-09  Score=73.99  Aligned_cols=85  Identities=44%  Similarity=0.892  Sum_probs=73.7

Q ss_pred             CCcccccccccccccccCccEEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCCCCccccccCccccc
Q psy12714         28 TGNPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRGNYDEGFGSDQHK  107 (117)
Q Consensus        28 ~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc~~~~~~~~~~~~  107 (117)
                      .......|..|.+.+++.+.+...+..||+.||+|..|+..|....+...++.+||..++.+++-.+..|..+.+...+.
T Consensus       104 ~~g~~~~c~~c~k~vy~~Ek~~~~~~~~hk~cfrc~~~~~~ls~~~~~~~~g~l~~~~~~~~~~~~~~~~~~~~~~~~~~  183 (200)
T KOG1700|consen  104 FAGEKEKCARCQKTVYPLEKVTGNGLEFHKSCFRCTHCGKKLSPKNYAALEGVLYCKHHFAQLFKGKGNYNEGFGARENK  183 (200)
T ss_pred             hhccccccccccceeeehHHHhhhhhhhhhhheeecccccccCCcchhhcCCccccchhhheeecCCCcccccchhhhhh
Confidence            45556789999999999999999999999999999999999999999999999999998888888888888887776666


Q ss_pred             cCCcc
Q psy12714        108 RKWQP  112 (117)
Q Consensus       108 ~~~~~  112 (117)
                      +.|-.
T Consensus       184 ~~~~~  188 (200)
T KOG1700|consen  184 EAAAA  188 (200)
T ss_pred             hhhhh
Confidence            65543


No 11 
>KOG1703|consensus
Probab=98.65  E-value=2.4e-08  Score=77.21  Aligned_cols=81  Identities=23%  Similarity=0.418  Sum_probs=67.1

Q ss_pred             cccccccccccccccCccEEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCCCC---------ccccc
Q psy12714         30 NPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRG---------NYDEG  100 (117)
Q Consensus        30 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc---------~~~~~  100 (117)
                      ...+.|..|+..|.....+..+++.||+.+|.|..|...+....+...+|.+||..||.+.+.++|         ..+.+
T Consensus       301 ~~~p~c~~c~~~i~~~~~i~~~~~~~h~~~~~c~~~~~~~~~~~~~~~~g~~~c~~~~~~~~~p~C~~C~~~i~~~~v~a  380 (479)
T KOG1703|consen  301 VTRPLCLSCNQKIRSVKVIVALGKEWHPEHFSCEVCAIVILDGGPRELDGKILCHECFHAPFRPNCKRCLLPILEEGVCA  380 (479)
T ss_pred             cccccccccccCcccceeEeeccccccccceeeccccccccCCCccccCCCccHHHHHHHhhCccccccCCchHHhHhhh
Confidence            456899999999965466789999999999999999999998888888999999999999999998         34444


Q ss_pred             cCccccccCC
Q psy12714        101 FGSDQHKRKW  110 (117)
Q Consensus       101 ~~~~~~~~~~  110 (117)
                      ++..||.+.|
T Consensus       381 ~~~~wH~~cf  390 (479)
T KOG1703|consen  381 LGRLWHPECF  390 (479)
T ss_pred             ccCeechhce
Confidence            4555555544


No 12 
>KOG1700|consensus
Probab=98.61  E-value=1.4e-08  Score=70.23  Aligned_cols=66  Identities=35%  Similarity=0.778  Sum_probs=60.2

Q ss_pred             cccccccccccccccCccEEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCCCC
Q psy12714         30 NPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRG   95 (117)
Q Consensus        30 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc   95 (117)
                      .....|..|++.++..+++...+..||+.||+|..|...|....+...++.+||..+|...++|+.
T Consensus         5 ~~~~kc~~c~k~vy~~e~~~~~g~~~hk~c~~c~~~~k~l~~~~~~~~e~~~yc~~~~~~~~~~~~   70 (200)
T KOG1700|consen    5 GTTDKCNACGKTVYFVEKVQKDGVDFHKECFKCEKCKKTLTLSGYSEHEGVPYCKNCHVAQFGPKG   70 (200)
T ss_pred             cccchhhhccCcchHHHHHhccCcchhhhHHhccccccccccccccccccccccccchHhhhCccc
Confidence            345699999999998888888899999999999999999999899999999999998889999987


No 13 
>KOG4577|consensus
Probab=98.43  E-value=5.1e-08  Score=70.06  Aligned_cols=68  Identities=19%  Similarity=0.452  Sum_probs=55.9

Q ss_pred             CCcccccccccccccccCccE-EeCCCcccccCcccccCCccccCC-Ccc-ccCCeeccHHHHHhhhCCCC
Q psy12714         28 TGNPSSLCFACNKKVYPLEKI-ETDGKLFHRACFRCTQCCTVLRME-SYT-MNNGHLYCLPHFKQLFISRG   95 (117)
Q Consensus        28 ~~~~~~~C~~C~~~i~~~~~~-~~~~~~~H~~Cf~C~~C~~~L~~~-~~~-~~~g~~~C~~~y~~~~~~kc   95 (117)
                      +..+..+|..|...|.....+ .+.+..||..||.|..|..+|..+ .|| +.|+++.|+.+|+.--...|
T Consensus        88 fKrfGTKCsaC~~GIpPtqVVRkAqd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~k~~  158 (383)
T KOG4577|consen   88 FKRFGTKCSACQEGIPPTQVVRKAQDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQKHC  158 (383)
T ss_pred             HHHhCCcchhhcCCCChHHHHHHhhcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHhccc
Confidence            456677999999999777766 489999999999999999999855 344 47999999999987655555


No 14 
>KOG1702|consensus
Probab=98.41  E-value=1.1e-08  Score=70.39  Aligned_cols=58  Identities=33%  Similarity=0.780  Sum_probs=53.2

Q ss_pred             ccccccccccccCccEEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhh
Q psy12714         33 SLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQL   90 (117)
Q Consensus        33 ~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~   90 (117)
                      ..|..|++.++..+.+..+++.||..||.|..|+..|....|.+-+.++||..+|...
T Consensus         5 ~n~~~cgk~vYPvE~v~cldk~whk~cfkce~c~mtlnmKnyKgy~kkpycn~hYpkq   62 (264)
T KOG1702|consen    5 CNREDCGKTVYPVEEVKCLDKVWHKQCFKCEVCGMTLNMKNYKGYDKKPYCNPHYPKQ   62 (264)
T ss_pred             chhhhhccccccHHHHhhHHHHHHHHhheeeeccCChhhhhccccccCCCcCcccccc
Confidence            4678899999999999999999999999999999999999999999999999999543


No 15 
>KOG1044|consensus
Probab=98.16  E-value=2.3e-06  Score=66.63  Aligned_cols=80  Identities=24%  Similarity=0.510  Sum_probs=62.6

Q ss_pred             CcccccccccccccccCccEEeCCCcccccCcccccCCccccCCCcccc-CCeeccHHHHHhhhCCCCccccccCccccc
Q psy12714         29 GNPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMN-NGHLYCLPHFKQLFISRGNYDEGFGSDQHK  107 (117)
Q Consensus        29 ~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~-~g~~~C~~~y~~~~~~kc~~~~~~~~~~~~  107 (117)
                      ....-.|..|++.- .++.+.+.++.||..||.|..|+..|..+.|+.+ +.++|+.....+ | ..|..+.++|+.+|+
T Consensus        13 ~~~~i~c~~c~~kc-~gevlrv~d~~fhi~cf~c~~cg~~la~~gff~k~~~~~ygt~~c~~-~-~~gevvsa~gktyh~   89 (670)
T KOG1044|consen   13 GKQGIKCDKCRKKC-SGEVLRVNDNHFHINCFQCKKCGRNLAEGGFFTKPENRLYGTDDCRA-F-VEGEVVSTLGKTYHP   89 (670)
T ss_pred             cccceehhhhCCcc-ccceeEeeccccceeeeeccccCCCcccccceecccceeecccchhh-h-ccceeEecccceecc
Confidence            34456899999988 5788999999999999999999999999888886 467777633222 1 246678888888888


Q ss_pred             cCCc
Q psy12714        108 RKWQ  111 (117)
Q Consensus       108 ~~~~  111 (117)
                      +.+.
T Consensus        90 ~cf~   93 (670)
T KOG1044|consen   90 KCFS   93 (670)
T ss_pred             ccce
Confidence            7654


No 16 
>KOG0490|consensus
Probab=95.14  E-value=0.0026  Score=44.35  Aligned_cols=57  Identities=19%  Similarity=0.631  Sum_probs=44.1

Q ss_pred             cccccccCccEEeCCCcccccCcccccCCcccc--CCCccccCCeeccHHHHHh--hhCCCC
Q psy12714         38 CNKKVYPLEKIETDGKLFHRACFRCTQCCTVLR--MESYTMNNGHLYCLPHFKQ--LFISRG   95 (117)
Q Consensus        38 C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~--~~~~~~~~g~~~C~~~y~~--~~~~kc   95 (117)
                      |+..|.+...+...+..||..|..|..|...|.  ...+.. +|..||..+|..  .+..+|
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~g~~~~~~d~~~~~~~~~rr   62 (235)
T KOG0490|consen    2 CGRQILDRYLLRVLDRYWHASCLKCAECDNPLGVGDTCFSK-DGSIYCKRDYQREFKFSKRC   62 (235)
T ss_pred             CCccccchHHhhcccHHHHHHHHhhhhhcchhccCCCcccC-CCcccccccchhhhhccccc
Confidence            555665444455668999999999999999997  444555 999999999987  666666


No 17 
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=90.27  E-value=0.089  Score=32.59  Aligned_cols=33  Identities=24%  Similarity=0.508  Sum_probs=25.4

Q ss_pred             cccccccccccCccEEe-CCCcccccCcccccCC
Q psy12714         34 LCFACNKKVYPLEKIET-DGKLFHRACFRCTQCC   66 (117)
Q Consensus        34 ~C~~C~~~i~~~~~~~~-~~~~~H~~Cf~C~~C~   66 (117)
                      +|..|++.|+.++.+.+ .+...|..||.=..-.
T Consensus         4 kC~iCg~~I~~gqlFTF~~kG~VH~~C~~~~~~~   37 (101)
T PF09943_consen    4 KCYICGKPIYEGQLFTFTKKGPVHYECFREKASK   37 (101)
T ss_pred             EEEecCCeeeecceEEEecCCcEeHHHHHHHHhh
Confidence            69999999999998874 3456799998755443


No 18 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=86.45  E-value=0.087  Score=32.29  Aligned_cols=58  Identities=19%  Similarity=0.383  Sum_probs=36.9

Q ss_pred             ccccccccccCccEEeCCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCCCCc
Q psy12714         35 CFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRGN   96 (117)
Q Consensus        35 C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc~   96 (117)
                      |..|+..+..--.....-..++..+..|..|...|+-..|..-..-+||    +..|.|+|.
T Consensus        38 Cy~CHdel~~Hpf~p~~~~~~~~~~iiCGvC~~~LT~~EY~~~~~Cp~C----~spFNp~Ck   95 (105)
T COG4357          38 CYHCHDELEDHPFEPWGLQEFNPKAIICGVCRKLLTRAEYGMCGSCPYC----QSPFNPGCK   95 (105)
T ss_pred             HHHHHhHHhcCCCccCChhhcCCccEEhhhhhhhhhHHHHhhcCCCCCc----CCCCCcccc
Confidence            4455555532222233445678888999999999987777766665555    355677774


No 19 
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=81.61  E-value=0.58  Score=23.65  Aligned_cols=31  Identities=19%  Similarity=0.533  Sum_probs=19.7

Q ss_pred             ccccccccccCcc-EEeCCCcccccCcccccCCcc
Q psy12714         35 CFACNKKVYPLEK-IETDGKLFHRACFRCTQCCTV   68 (117)
Q Consensus        35 C~~C~~~i~~~~~-~~~~~~~~H~~Cf~C~~C~~~   68 (117)
                      |..||..|.+.-. +...++.|+   |.|..|...
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~---fCC~tC~~~   32 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYY---FCCPTCLSQ   32 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEE---EECHHHHHH
Confidence            6778998864332 467888887   444455443


No 20 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=80.79  E-value=1.2  Score=27.07  Aligned_cols=30  Identities=23%  Similarity=0.412  Sum_probs=18.9

Q ss_pred             ccccccccccccccCccE-EeCCCcccccCc
Q psy12714         31 PSSLCFACNKKVYPLEKI-ETDGKLFHRACF   60 (117)
Q Consensus        31 ~~~~C~~C~~~i~~~~~~-~~~~~~~H~~Cf   60 (117)
                      ....|..|++.|.....+ -..+..+|..|+
T Consensus        77 ~~~~C~vC~k~l~~~~f~~~p~~~v~H~~C~  107 (109)
T PF10367_consen   77 ESTKCSVCGKPLGNSVFVVFPCGHVVHYSCI  107 (109)
T ss_pred             CCCCccCcCCcCCCceEEEeCCCeEEecccc
Confidence            345788888888543322 244566787775


No 21 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=79.97  E-value=1.7  Score=23.51  Aligned_cols=29  Identities=21%  Similarity=0.647  Sum_probs=19.0

Q ss_pred             ccccCCccccCCC-ccccCCeeccHHHHHhh
Q psy12714         61 RCTQCCTVLRMES-YTMNNGHLYCLPHFKQL   90 (117)
Q Consensus        61 ~C~~C~~~L~~~~-~~~~~g~~~C~~~y~~~   90 (117)
                      .|..|+..++.-. +...|| ..|..|+.+.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHh
Confidence            3667777765433 445666 6888888765


No 22 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=74.80  E-value=1.9  Score=21.51  Aligned_cols=23  Identities=22%  Similarity=0.515  Sum_probs=15.5

Q ss_pred             ccccCCccccCCCccccCCeeccHHHH
Q psy12714         61 RCTQCCTVLRMESYTMNNGHLYCLPHF   87 (117)
Q Consensus        61 ~C~~C~~~L~~~~~~~~~g~~~C~~~y   87 (117)
                      .|..|+..    .+...+|..||..|-
T Consensus        10 ~C~~C~~~----~~~~~dG~~yC~~cG   32 (36)
T PF11781_consen   10 PCPVCGSR----WFYSDDGFYYCDRCG   32 (36)
T ss_pred             cCCCCCCe----EeEccCCEEEhhhCc
Confidence            46667653    366678888886653


No 23 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=72.78  E-value=2.1  Score=23.45  Aligned_cols=29  Identities=28%  Similarity=0.584  Sum_probs=19.1

Q ss_pred             ccccccccccccc-CccEE--eCCCcccccCc
Q psy12714         32 SSLCFACNKKVYP-LEKIE--TDGKLFHRACF   60 (117)
Q Consensus        32 ~~~C~~C~~~i~~-~~~~~--~~~~~~H~~Cf   60 (117)
                      ..+|..|++.+.. ++++.  .=+..||++|.
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~CgapyHR~C~   36 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGAPYHRDCW   36 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCCcccHHHH
Confidence            4588999998864 33333  34566787776


No 24 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=72.35  E-value=1.6  Score=28.35  Aligned_cols=21  Identities=29%  Similarity=0.793  Sum_probs=14.9

Q ss_pred             cccCCccccCCCccccCCeeccHHHH
Q psy12714         62 CTQCCTVLRMESYTMNNGHLYCLPHF   87 (117)
Q Consensus        62 C~~C~~~L~~~~~~~~~g~~~C~~~y   87 (117)
                      |..|+.+|    |- ++|.+||..|-
T Consensus        31 Cp~Cg~PL----F~-KdG~v~CPvC~   51 (131)
T COG1645          31 CPKCGTPL----FR-KDGEVFCPVCG   51 (131)
T ss_pred             CcccCCcc----ee-eCCeEECCCCC
Confidence            66777776    33 78888887774


No 25 
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=71.64  E-value=1.4  Score=26.95  Aligned_cols=37  Identities=14%  Similarity=0.269  Sum_probs=27.2

Q ss_pred             cccccccccccccCccEEeC-CCcccccCcccccCCcc
Q psy12714         32 SSLCFACNKKVYPLEKIETD-GKLFHRACFRCTQCCTV   68 (117)
Q Consensus        32 ~~~C~~C~~~i~~~~~~~~~-~~~~H~~Cf~C~~C~~~   68 (117)
                      .-+|..|+..|..++++..- ....|..||.-+.-+++
T Consensus         6 ewkC~VCg~~iieGqkFTF~~kGsVH~eCl~~s~~~k~   43 (103)
T COG4847           6 EWKCYVCGGTIIEGQKFTFTKKGSVHYECLAESKRKKP   43 (103)
T ss_pred             eeeEeeeCCEeeeccEEEEeeCCcchHHHHHHHHhcCc
Confidence            45799999999888887643 34578888876665543


No 26 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=71.07  E-value=2.3  Score=19.01  Aligned_cols=8  Identities=25%  Similarity=0.966  Sum_probs=4.4

Q ss_pred             cccccccc
Q psy12714         35 CFACNKKV   42 (117)
Q Consensus        35 C~~C~~~i   42 (117)
                      |..|+..|
T Consensus         2 Cp~CG~~~    9 (23)
T PF13240_consen    2 CPNCGAEI    9 (23)
T ss_pred             CcccCCCC
Confidence            55555555


No 27 
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=70.86  E-value=2.4  Score=25.17  Aligned_cols=28  Identities=18%  Similarity=0.357  Sum_probs=20.3

Q ss_pred             ccccCCccccCCCcccc-----CCeeccHHHHH
Q psy12714         61 RCTQCCTVLRMESYTMN-----NGHLYCLPHFK   88 (117)
Q Consensus        61 ~C~~C~~~L~~~~~~~~-----~g~~~C~~~y~   88 (117)
                      .|..|+.+|.....+..     ...-||..||.
T Consensus         2 ~CQSCGMPl~~~~~~Gte~dGs~s~~YC~yCy~   34 (81)
T PF12674_consen    2 FCQSCGMPLSKDEDFGTEADGSKSEDYCSYCYQ   34 (81)
T ss_pred             cCCcCcCccCCccccccccCCCCchhHHHHHhc
Confidence            48889999986654432     35779999994


No 28 
>COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion]
Probab=66.99  E-value=2  Score=29.95  Aligned_cols=31  Identities=23%  Similarity=0.497  Sum_probs=22.2

Q ss_pred             cccccCCccccCCCccccCCeeccHHHHHhh
Q psy12714         60 FRCTQCCTVLRMESYTMNNGHLYCLPHFKQL   90 (117)
Q Consensus        60 f~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~   90 (117)
                      -+|..|+-..-...-...+|++.|..||...
T Consensus       173 v~C~kCGE~~~e~~~~~~ng~~vC~~C~~~~  203 (206)
T COG2191         173 VRCSKCGELFMEPRAVVLNGKPVCKPCAEKK  203 (206)
T ss_pred             eeccccCcccccchhhhcCCceecccccccc
Confidence            4678888766555555578899999998643


No 29 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=61.90  E-value=3.2  Score=20.41  Aligned_cols=27  Identities=19%  Similarity=0.421  Sum_probs=12.3

Q ss_pred             cccCCccccCCCccccCCeeccHHHHH
Q psy12714         62 CTQCCTVLRMESYTMNNGHLYCLPHFK   88 (117)
Q Consensus        62 C~~C~~~L~~~~~~~~~g~~~C~~~y~   88 (117)
                      |..|+..+.........+..+|..|..
T Consensus         6 C~~CGe~I~~~Rl~~~p~~~~C~~C~~   32 (36)
T PF01258_consen    6 CEDCGEPIPEERLVAVPGATLCVECQE   32 (36)
T ss_dssp             -TTTSSBEEHHHHHHCTTECS-HHHHH
T ss_pred             ccccCChHHHHHHHhCCCcEECHHHhC
Confidence            455555544333333455666666654


No 30 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=59.76  E-value=4.6  Score=23.55  Aligned_cols=17  Identities=29%  Similarity=0.491  Sum_probs=12.0

Q ss_pred             cccccccccccccccCc
Q psy12714         30 NPSSLCFACNKKVYPLE   46 (117)
Q Consensus        30 ~~~~~C~~C~~~i~~~~   46 (117)
                      +....|..|++.|..++
T Consensus         5 s~Ra~Ck~C~~~I~kg~   21 (82)
T PF00645_consen    5 SGRAKCKGCKKKIAKGE   21 (82)
T ss_dssp             SSTEBETTTSCBE-TTS
T ss_pred             CCCccCcccCCcCCCCC
Confidence            34568999999996544


No 31 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=59.34  E-value=3.8  Score=21.10  Aligned_cols=21  Identities=33%  Similarity=0.873  Sum_probs=10.8

Q ss_pred             cccCCccccCCCccccCCeeccHHH
Q psy12714         62 CTQCCTVLRMESYTMNNGHLYCLPH   86 (117)
Q Consensus        62 C~~C~~~L~~~~~~~~~g~~~C~~~   86 (117)
                      |..|+.+|-    -.++++.||..|
T Consensus        20 Cp~C~~PL~----~~k~g~~~Cv~C   40 (41)
T PF06677_consen   20 CPDCGTPLM----RDKDGKIYCVSC   40 (41)
T ss_pred             cCCCCCeeE----EecCCCEECCCC
Confidence            445555552    234566666543


No 32 
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=57.88  E-value=8.5  Score=20.18  Aligned_cols=29  Identities=14%  Similarity=0.276  Sum_probs=18.0

Q ss_pred             ccccCCccccCCCcccc--CCeeccHHHHHh
Q psy12714         61 RCTQCCTVLRMESYTMN--NGHLYCLPHFKQ   89 (117)
Q Consensus        61 ~C~~C~~~L~~~~~~~~--~g~~~C~~~y~~   89 (117)
                      .|..|+..++...|...  .+..+|..||.+
T Consensus         2 ~C~~Cg~D~t~vryh~~~~~~~dLC~~CF~~   32 (45)
T cd02336           2 HCFTCGNDCTRVRYHNLKAKKYDLCPSCYQE   32 (45)
T ss_pred             cccCCCCccCceEEEecCCCccccChHHHhC
Confidence            46667776654333332  357889999953


No 33 
>PF02069 Metallothio_Pro:  Prokaryotic metallothionein;  InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ]. An empirical classification into three classes was proposed by Kojima [], with class III MTs including atypical polypeptides composed of gamma-glutamylcysteinyl units. Class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. The MT superfamily is subdivided into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects [], e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range.  Family 14 consists of prokaryota MTs. Its members are recognised by the sequence pattern K-C-A-C-x(2)-C-L-C.The taxonomic range of the members extends to cyanobacteria. Known characteristics are: 53 to 56 AAs; 9 conserved Cys; one conserved tyrosine residue; one conserved histidine residue; contain other unusual residues. ; GO: 0046872 metal ion binding; PDB: 1JJD_A.
Probab=56.38  E-value=7.3  Score=21.20  Aligned_cols=28  Identities=25%  Similarity=0.590  Sum_probs=14.8

Q ss_pred             ccccCCccccCCCccccCCeecc-HHHHH
Q psy12714         61 RCTQCCTVLRMESYTMNNGHLYC-LPHFK   88 (117)
Q Consensus        61 ~C~~C~~~L~~~~~~~~~g~~~C-~~~y~   88 (117)
                      .|..|...+....-+.++|+.|| +.|-.
T Consensus         9 aC~~C~C~V~~~~Ai~~dGk~YCS~aCA~   37 (52)
T PF02069_consen    9 ACPSCSCVVSEEEAIQKDGKYYCSEACAN   37 (52)
T ss_dssp             SSTT----B-TTTSEESSS-EESSHHHHH
T ss_pred             cCCCCEeEECchHhHHhCCEeeecHHHhc
Confidence            46677777765566678899998 55543


No 34 
>KOG3579|consensus
Probab=53.83  E-value=13  Score=27.44  Aligned_cols=50  Identities=18%  Similarity=0.493  Sum_probs=33.1

Q ss_pred             cccccccccccccccCccEEeCCCcccccCcccccCCccccCCCccccCCeeccH
Q psy12714         30 NPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCL   84 (117)
Q Consensus        30 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~   84 (117)
                      ...-.|..|++.+.+...+..-.-.-|+-||-|+.=.  |   +--...|.+||.
T Consensus       266 ~apLcCTLC~ERLEDTHFVQCPSVp~HKFCFPCSRes--I---K~Qg~sgevYCP  315 (352)
T KOG3579|consen  266 SAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRES--I---KQQGASGEVYCP  315 (352)
T ss_pred             CCceeehhhhhhhccCceeecCCCcccceecccCHHH--H---HhhcCCCceeCC
Confidence            3346799999999777666666666799899776421  1   112234688884


No 35 
>PRK00420 hypothetical protein; Validated
Probab=52.98  E-value=5.6  Score=25.16  Aligned_cols=10  Identities=20%  Similarity=0.567  Sum_probs=5.3

Q ss_pred             cccccccccc
Q psy12714         33 SLCFACNKKV   42 (117)
Q Consensus        33 ~~C~~C~~~i   42 (117)
                      ..|..|+.++
T Consensus        24 ~~CP~Cg~pL   33 (112)
T PRK00420         24 KHCPVCGLPL   33 (112)
T ss_pred             CCCCCCCCcc
Confidence            4555555544


No 36 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=48.38  E-value=10  Score=17.20  Aligned_cols=9  Identities=22%  Similarity=0.933  Sum_probs=5.1

Q ss_pred             ccccccccc
Q psy12714         34 LCFACNKKV   42 (117)
Q Consensus        34 ~C~~C~~~i   42 (117)
                      .|..|+..|
T Consensus         4 ~Cp~Cg~~~   12 (26)
T PF13248_consen    4 FCPNCGAEI   12 (26)
T ss_pred             CCcccCCcC
Confidence            466666544


No 37 
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=45.56  E-value=19  Score=18.43  Aligned_cols=11  Identities=18%  Similarity=0.335  Sum_probs=7.4

Q ss_pred             CeeccHHHHHh
Q psy12714         79 GHLYCLPHFKQ   89 (117)
Q Consensus        79 g~~~C~~~y~~   89 (117)
                      +--+|..||.+
T Consensus        26 d~dlC~~Cf~~   36 (44)
T smart00291       26 DYDLCQSCFAK   36 (44)
T ss_pred             CccchHHHHhC
Confidence            45578888854


No 38 
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=44.32  E-value=16  Score=18.94  Aligned_cols=46  Identities=17%  Similarity=0.395  Sum_probs=22.2

Q ss_pred             ccccccccccCccEEe--CCCcccccCcccccCCccccCCCccccCCeeccHHHH
Q psy12714         35 CFACNKKVYPLEKIET--DGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHF   87 (117)
Q Consensus        35 C~~C~~~i~~~~~~~~--~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y   87 (117)
                      |..|+..-...+.|.-  =+..||..|..-.       ........+..+|..|-
T Consensus         2 C~vC~~~~~~~~~i~C~~C~~~~H~~C~~~~-------~~~~~~~~~~w~C~~C~   49 (51)
T PF00628_consen    2 CPVCGQSDDDGDMIQCDSCNRWYHQECVGPP-------EKAEEIPSGDWYCPNCR   49 (51)
T ss_dssp             BTTTTSSCTTSSEEEBSTTSCEEETTTSTSS-------HSHHSHHSSSBSSHHHH
T ss_pred             CcCCCCcCCCCCeEEcCCCChhhCcccCCCC-------hhhccCCCCcEECcCCc
Confidence            6667763333333332  2356787774211       11112223477777764


No 39 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=43.97  E-value=19  Score=18.58  Aligned_cols=10  Identities=10%  Similarity=0.308  Sum_probs=6.7

Q ss_pred             CeeccHHHHH
Q psy12714         79 GHLYCLPHFK   88 (117)
Q Consensus        79 g~~~C~~~y~   88 (117)
                      +--+|..||.
T Consensus        22 d~dLC~~Cf~   31 (46)
T cd02249          22 DFDLCSSCYA   31 (46)
T ss_pred             CCcCHHHHHC
Confidence            3556888875


No 40 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=42.93  E-value=34  Score=16.73  Aligned_cols=26  Identities=23%  Similarity=0.309  Sum_probs=13.4

Q ss_pred             cccCCccccCCCccccCCee-ccHHHH
Q psy12714         62 CTQCCTVLRMESYTMNNGHL-YCLPHF   87 (117)
Q Consensus        62 C~~C~~~L~~~~~~~~~g~~-~C~~~y   87 (117)
                      |..|+..-+.......+|.. +|..|+
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg   27 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACG   27 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHH
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHH
Confidence            44555544444444446666 899887


No 41 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=42.56  E-value=17  Score=20.71  Aligned_cols=35  Identities=20%  Similarity=0.457  Sum_probs=10.1

Q ss_pred             ccccCCccccCCCccccCCeeccHHHHHhhhCCCC
Q psy12714         61 RCTQCCTVLRMESYTMNNGHLYCLPHFKQLFISRG   95 (117)
Q Consensus        61 ~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~kc   95 (117)
                      +|+.|...|........=..+||..|-...++..|
T Consensus         9 rCs~C~~~l~~pv~l~~CeH~fCs~Ci~~~~~~~C   43 (65)
T PF14835_consen    9 RCSICFDILKEPVCLGGCEHIFCSSCIRDCIGSEC   43 (65)
T ss_dssp             S-SSS-S--SS-B---SSS--B-TTTGGGGTTTB-
T ss_pred             CCcHHHHHhcCCceeccCccHHHHHHhHHhcCCCC
Confidence            44445444432211122234555555544444444


No 42 
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=41.42  E-value=36  Score=18.22  Aligned_cols=31  Identities=16%  Similarity=0.354  Sum_probs=20.2

Q ss_pred             cccccCCccccCCCccccCCeeccHHHHHhhh
Q psy12714         60 FRCTQCCTVLRMESYTMNNGHLYCLPHFKQLF   91 (117)
Q Consensus        60 f~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~   91 (117)
                      |.|..|...+.. ......|..||..+..+.+
T Consensus         2 ~~Cpi~~~~~~~-Pv~~~~G~v~~~~~i~~~~   32 (63)
T smart00504        2 FLCPISLEVMKD-PVILPSGQTYERRAIEKWL   32 (63)
T ss_pred             cCCcCCCCcCCC-CEECCCCCEEeHHHHHHHH
Confidence            456777777654 3444567888888876544


No 43 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=37.68  E-value=20  Score=19.35  Aligned_cols=24  Identities=25%  Similarity=0.584  Sum_probs=15.7

Q ss_pred             ccccccccccccCcc---EEeCCCccc
Q psy12714         33 SLCFACNKKVYPLEK---IETDGKLFH   56 (117)
Q Consensus        33 ~~C~~C~~~i~~~~~---~~~~~~~~H   56 (117)
                      ..|..|+..|+++..   +...++.|.
T Consensus         2 ~~C~fcG~~I~pg~G~~~vr~Dgkv~~   28 (52)
T PRK00807          2 RTCSFCGKEIEPGTGKMYVKKDGTILY   28 (52)
T ss_pred             cccCCCCCeEcCCCCeEEEEeCCcEEE
Confidence            368888888875443   345667665


No 44 
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=35.69  E-value=44  Score=19.76  Aligned_cols=21  Identities=24%  Similarity=0.703  Sum_probs=8.0

Q ss_pred             ccccccccccccccCccEEeCCCcc
Q psy12714         31 PSSLCFACNKKVYPLEKIETDGKLF   55 (117)
Q Consensus        31 ~~~~C~~C~~~i~~~~~~~~~~~~~   55 (117)
                      ....|..|+..|-    +...+..|
T Consensus         8 ~~qiCqiCGD~VG----l~~~Ge~F   28 (80)
T PF14569_consen    8 NGQICQICGDDVG----LTENGEVF   28 (80)
T ss_dssp             SS-B-SSS--B------B-SSSSB-
T ss_pred             CCcccccccCccc----cCCCCCEE
Confidence            3457888888773    34455544


No 45 
>PF13834 DUF4193:  Domain of unknown function (DUF4193)
Probab=34.26  E-value=12  Score=23.11  Aligned_cols=28  Identities=21%  Similarity=0.488  Sum_probs=16.8

Q ss_pred             CcccccCCccccCCCcc-ccCCeeccHHH
Q psy12714         59 CFRCTQCCTVLRMESYT-MNNGHLYCLPH   86 (117)
Q Consensus        59 Cf~C~~C~~~L~~~~~~-~~~g~~~C~~~   86 (117)
                      =|.|..|-..-..+... ..+|.++|..|
T Consensus        70 EFTCssCFLV~HRSqLa~~~~g~~iC~DC   98 (99)
T PF13834_consen   70 EFTCSSCFLVHHRSQLAREKDGQPICRDC   98 (99)
T ss_pred             ceeeeeeeeEechhhhccccCCCEecccc
Confidence            37777775533222222 35789999876


No 46 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=33.38  E-value=36  Score=17.58  Aligned_cols=11  Identities=18%  Similarity=0.280  Sum_probs=7.5

Q ss_pred             CeeccHHHHHh
Q psy12714         79 GHLYCLPHFKQ   89 (117)
Q Consensus        79 g~~~C~~~y~~   89 (117)
                      +--+|..||.+
T Consensus        27 d~dLC~~C~~~   37 (46)
T PF00569_consen   27 DYDLCEDCFSK   37 (46)
T ss_dssp             S-EEEHHHHHH
T ss_pred             CCchhhHHHhC
Confidence            45679999865


No 47 
>PF10235 Cript:  Microtubule-associated protein CRIPT;  InterPro: IPR019367  The CRIPT protein is a cytoskeletal protein involved in microtubule production. This C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners []. 
Probab=33.17  E-value=41  Score=20.44  Aligned_cols=39  Identities=26%  Similarity=0.420  Sum_probs=20.9

Q ss_pred             CCcccccccccccccccCccEEeCCCcccccC----cccccCCccccCC
Q psy12714         28 TGNPSSLCFACNKKVYPLEKIETDGKLFHRAC----FRCTQCCTVLRME   72 (117)
Q Consensus        28 ~~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~C----f~C~~C~~~L~~~   72 (117)
                      +......|..|...|+..      +..|-..|    -.|..|++.|.+.
T Consensus        40 y~~~~~~C~~CK~~v~q~------g~~YCq~CAYkkGiCamCGKki~dt   82 (90)
T PF10235_consen   40 YAPYSSKCKICKTKVHQP------GAKYCQTCAYKKGICAMCGKKILDT   82 (90)
T ss_pred             ccccCccccccccccccC------CCccChhhhcccCcccccCCeeccc
Confidence            444455777777666431      12233333    2577777776443


No 48 
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=32.72  E-value=25  Score=27.83  Aligned_cols=39  Identities=28%  Similarity=0.554  Sum_probs=26.0

Q ss_pred             cccccccccccccCccEEeCCCcccccCcccccCCccccC
Q psy12714         32 SSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRM   71 (117)
Q Consensus        32 ~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~   71 (117)
                      ...|..|-..+...+ +...+....+.||.|-.|...|..
T Consensus        26 ~~yCp~CL~~~p~~e-~~~~~nrC~r~Cf~CP~C~~~L~~   64 (483)
T PF05502_consen   26 SYYCPNCLFEVPSSE-ARSEKNRCSRNCFDCPICFSPLSV   64 (483)
T ss_pred             eeECccccccCChhh-heeccceeccccccCCCCCCccee
Confidence            456777776664333 334444556699999999988853


No 49 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=32.11  E-value=52  Score=15.98  Aligned_cols=30  Identities=20%  Similarity=0.360  Sum_probs=16.0

Q ss_pred             ccCCccccCCCccccCCeeccHHHHHhhhC
Q psy12714         63 TQCCTVLRMESYTMNNGHLYCLPHFKQLFI   92 (117)
Q Consensus        63 ~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~   92 (117)
                      ..|...+........=|..||..|..+.+.
T Consensus         2 ~iC~~~~~~~~~~~~CGH~fC~~C~~~~~~   31 (39)
T PF13923_consen    2 PICLDELRDPVVVTPCGHSFCKECIEKYLE   31 (39)
T ss_dssp             TTTTSB-SSEEEECTTSEEEEHHHHHHHHH
T ss_pred             CCCCCcccCcCEECCCCCchhHHHHHHHHH
Confidence            345444433212334478888888765543


No 50 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=32.10  E-value=35  Score=18.69  Aligned_cols=16  Identities=19%  Similarity=0.590  Sum_probs=8.6

Q ss_pred             cccccccccccCccEE
Q psy12714         34 LCFACNKKVYPLEKIE   49 (117)
Q Consensus        34 ~C~~C~~~i~~~~~~~   49 (117)
                      +|..|+.+|.....+.
T Consensus         3 ~CvVCKqpi~~a~~v~   18 (54)
T PF10886_consen    3 ICVVCKQPIDDALVVE   18 (54)
T ss_pred             eeeeeCCccCcceEEE
Confidence            5666666664443333


No 51 
>PF08746 zf-RING-like:  RING-like domain;  InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO). ; PDB: 3NW0_A 2CT0_A.
Probab=32.10  E-value=7.7  Score=20.00  Aligned_cols=26  Identities=27%  Similarity=0.526  Sum_probs=9.1

Q ss_pred             ccccccccccCccEE--eCCCcccccCc
Q psy12714         35 CFACNKKVYPLEKIE--TDGKLFHRACF   60 (117)
Q Consensus        35 C~~C~~~i~~~~~~~--~~~~~~H~~Cf   60 (117)
                      |..|++.+..+.+-.  .=+..||..|+
T Consensus         1 C~~C~~iv~~G~~C~~~~C~~r~H~~C~   28 (43)
T PF08746_consen    1 CEACKEIVTQGQRCSNRDCNVRLHDDCF   28 (43)
T ss_dssp             -TTT-SB-SSSEE-SS--S--EE-HHHH
T ss_pred             CcccchhHeeeccCCCCccCchHHHHHH
Confidence            556777665443321  11223565554


No 52 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=31.53  E-value=31  Score=15.57  Aligned_cols=9  Identities=22%  Similarity=0.936  Sum_probs=4.8

Q ss_pred             ccccccccc
Q psy12714         35 CFACNKKVY   43 (117)
Q Consensus        35 C~~C~~~i~   43 (117)
                      |..|+..|.
T Consensus         1 C~sC~~~i~    9 (24)
T PF07754_consen    1 CTSCGRPIA    9 (24)
T ss_pred             CccCCCccc
Confidence            445655554


No 53 
>KOG0955|consensus
Probab=31.48  E-value=40  Score=29.39  Aligned_cols=68  Identities=12%  Similarity=0.165  Sum_probs=41.5

Q ss_pred             ccccccccccccccc--CccEEe--CCCcccccCcccccCCccccCCCccccCCeeccHHHHHhhhCC-CCccccccCcc
Q psy12714         30 NPSSLCFACNKKVYP--LEKIET--DGKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLFIS-RGNYDEGFGSD  104 (117)
Q Consensus        30 ~~~~~C~~C~~~i~~--~~~~~~--~~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~~~-kc~~~~~~~~~  104 (117)
                      ....+|..|.+.-..  ..++-.  -+..+|..|..           .-++.+|+++|..|.....++ +|.+....+++
T Consensus       217 ~~D~~C~iC~~~~~~n~n~ivfCD~Cnl~VHq~Cyg-----------i~~ipeg~WlCr~Cl~s~~~~v~c~~cp~~~gA  285 (1051)
T KOG0955|consen  217 EEDAVCCICLDGECQNSNVIVFCDGCNLAVHQECYG-----------IPFIPEGQWLCRRCLQSPQRPVRCLLCPSKGGA  285 (1051)
T ss_pred             CCCccceeecccccCCCceEEEcCCCcchhhhhccC-----------CCCCCCCcEeehhhccCcCcccceEeccCCCCc
Confidence            445688888775432  112221  23445666642           234578999999999766566 77666666666


Q ss_pred             cccc
Q psy12714        105 QHKR  108 (117)
Q Consensus       105 ~~~~  108 (117)
                      |.++
T Consensus       286 Fkqt  289 (1051)
T KOG0955|consen  286 FKQT  289 (1051)
T ss_pred             ceec
Confidence            5543


No 54 
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=30.73  E-value=25  Score=25.78  Aligned_cols=15  Identities=20%  Similarity=0.574  Sum_probs=10.7

Q ss_pred             CCccccccccccccc
Q psy12714         28 TGNPSSLCFACNKKV   42 (117)
Q Consensus        28 ~~~~~~~C~~C~~~i   42 (117)
                      ++.....|..|+..|
T Consensus       241 YgR~GepC~~CGt~I  255 (273)
T COG0266         241 YGRAGEPCRRCGTPI  255 (273)
T ss_pred             ecCCCCCCCccCCEe
Confidence            555566788888777


No 55 
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=29.18  E-value=26  Score=21.76  Aligned_cols=29  Identities=21%  Similarity=0.367  Sum_probs=19.7

Q ss_pred             ccccCcccccCCccccCCCccccCCeeccHHHH
Q psy12714         55 FHRACFRCTQCCTVLRMESYTMNNGHLYCLPHF   87 (117)
Q Consensus        55 ~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y   87 (117)
                      +...-=.|..|    ....|+.+++.+.|..|-
T Consensus        31 ~~va~daCeiC----~~~GY~q~g~~lvC~~C~   59 (102)
T PF10080_consen   31 YRVAFDACEIC----GPKGYYQEGDQLVCKNCG   59 (102)
T ss_pred             EEEEEEecccc----CCCceEEECCEEEEecCC
Confidence            33333356777    456788888888888885


No 56 
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=28.53  E-value=16  Score=18.10  Aligned_cols=30  Identities=27%  Similarity=0.679  Sum_probs=17.0

Q ss_pred             ccccccccccCccEEeCCCcccccCcccccCCccc
Q psy12714         35 CFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVL   69 (117)
Q Consensus        35 C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L   69 (117)
                      |..|.+.+.     ...++.||-.-..|..|+-.+
T Consensus         2 C~~C~~Ey~-----~p~~RR~~~~~isC~~CGPr~   31 (35)
T PF07503_consen    2 CDDCLKEYF-----DPSNRRFHYQFISCTNCGPRY   31 (35)
T ss_dssp             -HHHHHHHC-----STTSTTTT-TT--BTTCC-SC
T ss_pred             CHHHHHHHc-----CCCCCcccCcCccCCCCCCCE
Confidence            556665543     245678898888899998765


No 57 
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=27.13  E-value=31  Score=17.88  Aligned_cols=22  Identities=27%  Similarity=0.611  Sum_probs=11.7

Q ss_pred             cccCCccccCCCccccCCeecc-HHHH
Q psy12714         62 CTQCCTVLRMESYTMNNGHLYC-LPHF   87 (117)
Q Consensus        62 C~~C~~~L~~~~~~~~~g~~~C-~~~y   87 (117)
                      |..|.+.+..    ..++.+|| +.|-
T Consensus         9 C~~Cdk~~~~----~~~~~lYCSe~Cr   31 (43)
T PF12855_consen    9 CIVCDKQIDP----PDDGSLYCSEECR   31 (43)
T ss_pred             HHHhhccccC----CCCCccccCHHHH
Confidence            4455554422    34667888 4553


No 58 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=26.96  E-value=24  Score=17.16  Aligned_cols=9  Identities=22%  Similarity=0.682  Sum_probs=5.9

Q ss_pred             ccccccccc
Q psy12714         34 LCFACNKKV   42 (117)
Q Consensus        34 ~C~~C~~~i   42 (117)
                      .|..|+..+
T Consensus         4 ~CP~C~~~~   12 (38)
T TIGR02098         4 QCPNCKTSF   12 (38)
T ss_pred             ECCCCCCEE
Confidence            577777654


No 59 
>KOG2893|consensus
Probab=26.82  E-value=27  Score=25.26  Aligned_cols=52  Identities=27%  Similarity=0.483  Sum_probs=29.7

Q ss_pred             cccccccccccccccCccEEeC-CCcccccCcccccCCccccCCCccccCCeeccHHHHHh
Q psy12714         30 NPSSLCFACNKKVYPLEKIETD-GKLFHRACFRCTQCCTVLRMESYTMNNGHLYCLPHFKQ   89 (117)
Q Consensus        30 ~~~~~C~~C~~~i~~~~~~~~~-~~~~H~~Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~   89 (117)
                      ...+-|-.|+... +.|+|.+. .+.=|   |+|..|.+.|-    ..-.-.+.|..-+.+
T Consensus         8 ~~kpwcwycnref-ddekiliqhqkakh---fkchichkkl~----sgpglsihcmqvhke   60 (341)
T KOG2893|consen    8 VDKPWCWYCNREF-DDEKILIQHQKAKH---FKCHICHKKLF----SGPGLSIHCMQVHKE   60 (341)
T ss_pred             cCCceeeeccccc-chhhhhhhhhhhcc---ceeeeehhhhc----cCCCceeehhhhhhh
Confidence            3455688898877 45555433 33334   77888887763    233344556444433


No 60 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=26.27  E-value=31  Score=17.70  Aligned_cols=28  Identities=29%  Similarity=0.526  Sum_probs=15.6

Q ss_pred             ccccccccccccCccEEeCCCcccccCcccccCCccc
Q psy12714         33 SLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVL   69 (117)
Q Consensus        33 ~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L   69 (117)
                      -+|..||..+...+.    ..     -+.|..|+..+
T Consensus         4 y~C~~CG~~~~~~~~----~~-----~~~Cp~CG~~~   31 (46)
T PRK00398          4 YKCARCGREVELDEY----GT-----GVRCPYCGYRI   31 (46)
T ss_pred             EECCCCCCEEEECCC----CC-----ceECCCCCCeE
Confidence            468888776632221    11     25677777655


No 61 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=25.67  E-value=65  Score=16.99  Aligned_cols=10  Identities=10%  Similarity=0.125  Sum_probs=6.7

Q ss_pred             eeccHHHHHh
Q psy12714         80 HLYCLPHFKQ   89 (117)
Q Consensus        80 ~~~C~~~y~~   89 (117)
                      --+|..||..
T Consensus        26 ~DlC~~C~~~   35 (48)
T cd02341          26 FDLCQDCVVK   35 (48)
T ss_pred             CccCHHHHhC
Confidence            4468888754


No 62 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=25.16  E-value=40  Score=23.73  Aligned_cols=49  Identities=18%  Similarity=0.281  Sum_probs=29.8

Q ss_pred             CcccccCCccccCCCccccCCeeccHHHHHhhh--CCCCccccccCccccccCCc
Q psy12714         59 CFRCTQCCTVLRMESYTMNNGHLYCLPHFKQLF--ISRGNYDEGFGSDQHKRKWQ  111 (117)
Q Consensus        59 Cf~C~~C~~~L~~~~~~~~~g~~~C~~~y~~~~--~~kc~~~~~~~~~~~~~~~~  111 (117)
                      =|.|..|.+.... .....=|.-+|..|+.+.|  ++.|   .-.|.+.+..-|+
T Consensus       196 PF~C~iCKkdy~s-pvvt~CGH~FC~~Cai~~y~kg~~C---~~Cgk~t~G~f~V  246 (259)
T COG5152         196 PFLCGICKKDYES-PVVTECGHSFCSLCAIRKYQKGDEC---GVCGKATYGRFWV  246 (259)
T ss_pred             ceeehhchhhccc-hhhhhcchhHHHHHHHHHhccCCcc---eecchhhccceeH
Confidence            4678888776533 2333457889999997665  4556   4445555544443


No 63 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=25.03  E-value=35  Score=16.28  Aligned_cols=7  Identities=29%  Similarity=0.847  Sum_probs=2.8

Q ss_pred             ccccccc
Q psy12714         35 CFACNKK   41 (117)
Q Consensus        35 C~~C~~~   41 (117)
                      |..|.+.
T Consensus         2 C~iC~~~    8 (45)
T cd00162           2 CPICLEE    8 (45)
T ss_pred             CCcCchh
Confidence            3344433


No 64 
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=24.96  E-value=33  Score=18.46  Aligned_cols=9  Identities=11%  Similarity=0.143  Sum_probs=4.0

Q ss_pred             CCeeccHHH
Q psy12714         78 NGHLYCLPH   86 (117)
Q Consensus        78 ~g~~~C~~~   86 (117)
                      .++++|..|
T Consensus        35 ~dR~~CGkC   43 (51)
T COG1998          35 KDRWACGKC   43 (51)
T ss_pred             CceeEeccc
Confidence            344455443


No 65 
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=24.76  E-value=17  Score=19.90  Aligned_cols=12  Identities=33%  Similarity=0.620  Sum_probs=8.7

Q ss_pred             cccccccccccc
Q psy12714         32 SSLCFACNKKVY   43 (117)
Q Consensus        32 ~~~C~~C~~~i~   43 (117)
                      +-+|..|++.+.
T Consensus         4 tiRC~~CnKlLa   15 (60)
T COG4416           4 TIRCAKCNKLLA   15 (60)
T ss_pred             eeehHHHhHHHH
Confidence            347888888774


No 66 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=24.73  E-value=24  Score=21.28  Aligned_cols=41  Identities=20%  Similarity=0.225  Sum_probs=26.4

Q ss_pred             CcccccccccccccccCccEEeCCCcccccCcccccCCccccC
Q psy12714         29 GNPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRM   71 (117)
Q Consensus        29 ~~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~   71 (117)
                      ......|..|++.+...+.+-+.+  |-..--+|..|+.++..
T Consensus        30 ~~~rS~C~~C~~~L~~~~lIPi~S--~l~lrGrCr~C~~~I~~   70 (92)
T PF06750_consen   30 IFPRSHCPHCGHPLSWWDLIPILS--YLLLRGRCRYCGAPIPP   70 (92)
T ss_pred             cCCCCcCcCCCCcCcccccchHHH--HHHhCCCCcccCCCCCh
Confidence            344679999999986555443332  33333578888888743


No 67 
>PF05570 DUF765:  Circovirus protein of unknown function (DUF765);  InterPro: IPR008484 This family consists of several short (27-30aa) porcine and bovine circovirus ORF6 proteins of unknown function.
Probab=24.58  E-value=88  Score=14.35  Aligned_cols=23  Identities=17%  Similarity=0.169  Sum_probs=12.3

Q ss_pred             ccccCCCCCchhhhhccCCCCCC
Q psy12714          2 SFFVPATSSKIAVKIILNQPEAP   24 (117)
Q Consensus         2 ~~~~p~~~~~~~~~~~~~~~~~~   24 (117)
                      --+.|.++.++.+-...++...+
T Consensus         2 asstpaspapsdils~~pqs~rp   24 (29)
T PF05570_consen    2 ASSTPASPAPSDILSSKPQSKRP   24 (29)
T ss_pred             CcCCCCCCCcHHHHhcCccccCC
Confidence            34556666665555555554444


No 68 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=24.29  E-value=72  Score=16.27  Aligned_cols=9  Identities=11%  Similarity=-0.097  Sum_probs=5.1

Q ss_pred             eeccHHHHH
Q psy12714         80 HLYCLPHFK   88 (117)
Q Consensus        80 ~~~C~~~y~   88 (117)
                      --+|..||.
T Consensus        23 ~dLC~~C~~   31 (43)
T cd02340          23 YDLCESCEA   31 (43)
T ss_pred             ccchHHhhC
Confidence            345666664


No 69 
>KOG0978|consensus
Probab=24.15  E-value=33  Score=28.49  Aligned_cols=33  Identities=21%  Similarity=0.618  Sum_probs=19.9

Q ss_pred             cccccCCccccCCCccc-cCCeeccHHHHHhhhCCC
Q psy12714         60 FRCTQCCTVLRMESYTM-NNGHLYCLPHFKQLFISR   94 (117)
Q Consensus        60 f~C~~C~~~L~~~~~~~-~~g~~~C~~~y~~~~~~k   94 (117)
                      ++|..|....  ....+ .=+.+||..|-..+|..|
T Consensus       644 LkCs~Cn~R~--Kd~vI~kC~H~FC~~Cvq~r~etR  677 (698)
T KOG0978|consen  644 LKCSVCNTRW--KDAVITKCGHVFCEECVQTRYETR  677 (698)
T ss_pred             eeCCCccCch--hhHHHHhcchHHHHHHHHHHHHHh
Confidence            4677776432  22333 346778888887777654


No 70 
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=23.37  E-value=32  Score=24.09  Aligned_cols=28  Identities=14%  Similarity=0.224  Sum_probs=15.2

Q ss_pred             cccccCCccccCCCccccCCeeccHHHH
Q psy12714         60 FRCTQCCTVLRMESYTMNNGHLYCLPHF   87 (117)
Q Consensus        60 f~C~~C~~~L~~~~~~~~~g~~~C~~~y   87 (117)
                      ..|..|+..+....+...+|.++|..|.
T Consensus       150 ~~C~~Cg~~~~~~~f~~~~gg~~c~~c~  177 (247)
T PRK00085        150 DHCAVCGAPGDHRYFSPKEGGAVCSECG  177 (247)
T ss_pred             hhHhcCCCCCCceEEecccCCccccccc
Confidence            3566666665422222356666676664


No 71 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=23.14  E-value=22  Score=23.67  Aligned_cols=32  Identities=22%  Similarity=0.350  Sum_probs=21.7

Q ss_pred             ccccccccccccccCccEEeCCCcccccCcccccCCcccc
Q psy12714         31 PSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLR   70 (117)
Q Consensus        31 ~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   70 (117)
                      .--.|..|+......+.+.        .-|.|..|+..|.
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~--------~~F~Cp~Cg~~L~  139 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAME--------LNFTCPRCGAMLD  139 (158)
T ss_pred             CeEECCCCCcEeeHHHHHH--------cCCcCCCCCCEee
Confidence            3457888987665444332        2489999999885


No 72 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=22.91  E-value=28  Score=18.18  Aligned_cols=12  Identities=25%  Similarity=0.647  Sum_probs=8.3

Q ss_pred             cccccccccccc
Q psy12714         31 PSSLCFACNKKV   42 (117)
Q Consensus        31 ~~~~C~~C~~~i   42 (117)
                      ....|..|++.|
T Consensus        10 ~~~~C~~C~~~i   21 (53)
T PF00130_consen   10 KPTYCDVCGKFI   21 (53)
T ss_dssp             STEB-TTSSSBE
T ss_pred             CCCCCcccCccc
Confidence            345888888888


No 73 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=22.67  E-value=68  Score=16.01  Aligned_cols=11  Identities=18%  Similarity=0.431  Sum_probs=4.0

Q ss_pred             ccccccccccc
Q psy12714         33 SLCFACNKKVY   43 (117)
Q Consensus        33 ~~C~~C~~~i~   43 (117)
                      .+|..|+-.|-
T Consensus         3 ~rC~~C~aylN   13 (40)
T PF04810_consen    3 VRCRRCRAYLN   13 (40)
T ss_dssp             -B-TTT--BS-
T ss_pred             cccCCCCCEEC
Confidence            46777766653


No 74 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=22.56  E-value=1.2e+02  Score=15.22  Aligned_cols=28  Identities=21%  Similarity=0.364  Sum_probs=12.5

Q ss_pred             ccccCCccccCCCccc--cCCeeccHHHHH
Q psy12714         61 RCTQCCTVLRMESYTM--NNGHLYCLPHFK   88 (117)
Q Consensus        61 ~C~~C~~~L~~~~~~~--~~g~~~C~~~y~   88 (117)
                      .|+.|++........+  .++...|..|-.
T Consensus         3 ~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~   32 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLISGPNGAYICDECVE   32 (41)
T ss_dssp             B-TTT--BTTTSSSEEEES-SEEEEHHHHH
T ss_pred             CccCCCCCHHHHhceecCCCCcEECHHHHH
Confidence            4566666554333222  235667776653


No 75 
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=22.41  E-value=45  Score=24.13  Aligned_cols=15  Identities=20%  Similarity=0.556  Sum_probs=9.5

Q ss_pred             CCccccccccccccc
Q psy12714         28 TGNPSSLCFACNKKV   42 (117)
Q Consensus        28 ~~~~~~~C~~C~~~i   42 (117)
                      +......|..|+..|
T Consensus       241 y~R~g~pC~~Cg~~I  255 (274)
T PRK01103        241 YGREGEPCRRCGTPI  255 (274)
T ss_pred             cCCCCCCCCCCCCee
Confidence            444445677777776


No 76 
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=22.19  E-value=45  Score=24.15  Aligned_cols=15  Identities=20%  Similarity=0.543  Sum_probs=9.6

Q ss_pred             CCccccccccccccc
Q psy12714         28 TGNPSSLCFACNKKV   42 (117)
Q Consensus        28 ~~~~~~~C~~C~~~i   42 (117)
                      +......|..|+..|
T Consensus       231 y~R~g~pC~~Cg~~I  245 (269)
T PRK14811        231 YGREGQPCPRCGTPI  245 (269)
T ss_pred             cCCCcCCCCcCCCee
Confidence            444455677777777


No 77 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=21.97  E-value=20  Score=19.27  Aligned_cols=12  Identities=25%  Similarity=0.609  Sum_probs=5.6

Q ss_pred             ccccCCccccCC
Q psy12714         61 RCTQCCTVLRME   72 (117)
Q Consensus        61 ~C~~C~~~L~~~   72 (117)
                      .|..|...|..+
T Consensus        24 ~C~gC~~~l~~~   35 (56)
T PF02591_consen   24 TCSGCHMELPPQ   35 (56)
T ss_pred             ccCCCCEEcCHH
Confidence            444555554433


No 78 
>PF11571 Med27:  Mediator complex subunit 27;  InterPro: IPR021627  Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function []. Mediator exists in two major forms in human cells: a smaller form that interacts strongly with pol II and activates transcription, and a large form that does not interact strongly with pol II and does not directly activate transcription. The ubiquitous expression of Med27 mRNA suggests a universal requirement for Med27 in transcriptional initiation. Loss of Crsp34/Med27 decreases amacrine cell number, but increases the number of rod photoreceptor cells []. 
Probab=21.88  E-value=45  Score=19.94  Aligned_cols=14  Identities=29%  Similarity=0.420  Sum_probs=11.1

Q ss_pred             Cccccccccccccc
Q psy12714         29 GNPSSLCFACNKKV   42 (117)
Q Consensus        29 ~~~~~~C~~C~~~i   42 (117)
                      ..+...|..|++.+
T Consensus        51 ~lfs~pC~~C~klL   64 (90)
T PF11571_consen   51 NLFSTPCKKCGKLL   64 (90)
T ss_pred             hhccchhhHHHhHh
Confidence            55567899999988


No 79 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=21.81  E-value=46  Score=21.68  Aligned_cols=38  Identities=26%  Similarity=0.486  Sum_probs=21.1

Q ss_pred             cccccccccccccCccEEe----CCCc--ccccCcccccCCccc
Q psy12714         32 SSLCFACNKKVYPLEKIET----DGKL--FHRACFRCTQCCTVL   69 (117)
Q Consensus        32 ~~~C~~C~~~i~~~~~~~~----~~~~--~H~~Cf~C~~C~~~L   69 (117)
                      ..+|..|+..+.....-.+    ....  .+...+.|..|++..
T Consensus        91 ~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiy  134 (147)
T PF01927_consen   91 FSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIY  134 (147)
T ss_pred             CCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEe
Confidence            5689999987744222111    1111  234456788887743


No 80 
>KOG2186|consensus
Probab=21.59  E-value=21  Score=25.89  Aligned_cols=44  Identities=23%  Similarity=0.448  Sum_probs=27.5

Q ss_pred             ccccccccccccCccEEeCCCcccccCcccccCCccccCCCcccc
Q psy12714         33 SLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRMESYTMN   77 (117)
Q Consensus        33 ~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~~~~~~~   77 (117)
                      ..|..||+.|-- ..+.----..|-.+|.|-.|++.+....|..+
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn~~fSCIDC~k~F~~~sYknH   47 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRNAYFSCIDCGKTFERVSYKNH   47 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccCCeeEEeecccccccchhhhh
Confidence            468889987732 11211111235578999999998877666554


No 81 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=21.41  E-value=22  Score=18.03  Aligned_cols=11  Identities=18%  Similarity=0.531  Sum_probs=6.8

Q ss_pred             ccccccccccc
Q psy12714         32 SSLCFACNKKV   42 (117)
Q Consensus        32 ~~~C~~C~~~i   42 (117)
                      .-+|..|+...
T Consensus         5 ey~C~~Cg~~f   15 (42)
T PF09723_consen    5 EYRCEECGHEF   15 (42)
T ss_pred             EEEeCCCCCEE
Confidence            34677777554


No 82 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=21.38  E-value=28  Score=23.68  Aligned_cols=33  Identities=27%  Similarity=0.457  Sum_probs=22.2

Q ss_pred             ccccccccccccccCccEEeCCCcccccCcccccCCccccC
Q psy12714         31 PSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLRM   71 (117)
Q Consensus        31 ~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~~   71 (117)
                      ..-.|..|+......+.+   .     .-|.|..|+..|..
T Consensus       116 ~~Y~Cp~C~~rytf~eA~---~-----~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAM---E-----YGFRCPQCGEMLEE  148 (178)
T ss_pred             CEEECCCCCcEEeHHHHh---h-----cCCcCCCCCCCCee
Confidence            345788888776544432   2     24899999998853


No 83 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=21.02  E-value=28  Score=22.72  Aligned_cols=38  Identities=26%  Similarity=0.398  Sum_probs=22.7

Q ss_pred             cccccccccccccccCccEEeCCCcccccCcccccCCcccc
Q psy12714         30 NPSSLCFACNKKVYPLEKIETDGKLFHRACFRCTQCCTVLR   70 (117)
Q Consensus        30 ~~~~~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C~~C~~~L~   70 (117)
                      ...-.|..|+......+.+...+.   ..=|.|..|+..|.
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~~d~---~~~f~Cp~Cg~~l~  134 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQLLDM---DGTFTCPRCGEELE  134 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHhcCC---CCcEECCCCCCEEE
Confidence            335578889877754443322221   12288888888774


No 84 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=20.96  E-value=26  Score=18.95  Aligned_cols=29  Identities=17%  Similarity=0.398  Sum_probs=15.4

Q ss_pred             cccccccccccCccEEeCCCcccccCccc
Q psy12714         34 LCFACNKKVYPLEKIETDGKLFHRACFRC   62 (117)
Q Consensus        34 ~C~~C~~~i~~~~~~~~~~~~~H~~Cf~C   62 (117)
                      .|..||+.+...-=.+..++.|-..|-.|
T Consensus         2 ~CPyCge~~~~~iD~s~~~Q~yiEDC~vC   30 (52)
T PF14255_consen    2 QCPYCGEPIEILIDPSAGDQEYIEDCQVC   30 (52)
T ss_pred             CCCCCCCeeEEEEecCCCCeeEEeehhhc
Confidence            47788887742111123455666665544


No 85 
>TIGR00270 conserved hypothetical protein TIGR00270.
Probab=20.91  E-value=72  Score=21.18  Aligned_cols=9  Identities=33%  Similarity=0.947  Sum_probs=4.5

Q ss_pred             ccccccccc
Q psy12714         35 CFACNKKVY   43 (117)
Q Consensus        35 C~~C~~~i~   43 (117)
                      |..||..|.
T Consensus         3 CEiCG~~i~   11 (154)
T TIGR00270         3 CEICGRKIK   11 (154)
T ss_pred             cccCCCccC
Confidence            455555543


No 86 
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=20.85  E-value=89  Score=16.28  Aligned_cols=10  Identities=30%  Similarity=0.550  Sum_probs=6.3

Q ss_pred             eeccHHHHHh
Q psy12714         80 HLYCLPHFKQ   89 (117)
Q Consensus        80 ~~~C~~~y~~   89 (117)
                      --+|..||..
T Consensus        24 ~dLC~~Cf~~   33 (49)
T cd02335          24 FDLCLECFSA   33 (49)
T ss_pred             cchhHHhhhC
Confidence            4467777753


No 87 
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=20.08  E-value=53  Score=23.81  Aligned_cols=15  Identities=13%  Similarity=0.532  Sum_probs=9.5

Q ss_pred             CCccccccccccccc
Q psy12714         28 TGNPSSLCFACNKKV   42 (117)
Q Consensus        28 ~~~~~~~C~~C~~~i   42 (117)
                      +......|..|+..|
T Consensus       240 y~R~g~pCprCG~~I  254 (272)
T PRK14810        240 YQRTGEPCLNCKTPI  254 (272)
T ss_pred             cCCCCCcCCCCCCee
Confidence            344455677777766


No 88 
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=20.05  E-value=49  Score=24.08  Aligned_cols=15  Identities=13%  Similarity=0.403  Sum_probs=9.3

Q ss_pred             CCccccccccccccc
Q psy12714         28 TGNPSSLCFACNKKV   42 (117)
Q Consensus        28 ~~~~~~~C~~C~~~i   42 (117)
                      +......|..|+..|
T Consensus       250 y~R~g~pC~~Cg~~I  264 (282)
T PRK13945        250 YRRTGKPCRKCGTPI  264 (282)
T ss_pred             eCCCcCCCCcCCCee
Confidence            334445677777776


No 89 
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the