Query         psy12760
Match_columns 199
No_of_seqs    151 out of 1237
Neff          5.5 
Searched_HMMs 46136
Date          Fri Aug 16 18:57:06 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12760.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12760hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG1196 Smc Chromosome segrega 100.0 3.7E-28 8.1E-33  246.2  15.6  136   59-194   946-1089(1163)
  2 KOG0996|consensus               99.9 2.7E-22   6E-27  199.2  14.2  122   73-194  1090-1218(1293)
  3 KOG0018|consensus               99.9   2E-22 4.3E-27  199.0  12.3  124   70-194   945-1074(1141)
  4 TIGR02169 SMC_prok_A chromosom  99.9 9.4E-21   2E-25  188.3  16.1  135   58-193   954-1096(1164)
  5 KOG0964|consensus               99.8   9E-19   2E-23  172.1  11.5  125   70-194   965-1120(1200)
  6 KOG0933|consensus               99.7 7.7E-18 1.7E-22  166.0   9.3  113   81-194   993-1105(1174)
  7 TIGR02168 SMC_prok_B chromosom  99.7 1.7E-16 3.7E-21  157.2  15.5  125   69-193   980-1111(1179)
  8 KOG0979|consensus               99.7 1.7E-15 3.6E-20  149.8  14.5  165   14-193   792-983 (1072)
  9 KOG0250|consensus               98.5 5.4E-07 1.2E-11   91.0  11.1   78  111-192   927-1010(1074)
 10 TIGR03185 DNA_S_dndD DNA sulfu  98.1 7.6E-05 1.6E-09   72.6  14.0   69  118-192   502-572 (650)
 11 PRK03918 chromosome segregatio  98.1  0.0001 2.2E-09   73.1  15.0   70  117-191   739-808 (880)
 12 PRK02224 chromosome segregatio  98.0 0.00011 2.4E-09   73.1  14.3   66  119-191   735-801 (880)
 13 COG0419 SbcC ATPase involved i  97.8 0.00016 3.5E-09   72.8  11.1   77  112-191   758-835 (908)
 14 PRK10869 recombination and rep  97.8 0.00048   1E-08   66.2  13.4   72  119-190   371-449 (553)
 15 TIGR00634 recN DNA repair prot  97.6  0.0015 3.3E-08   62.6  13.7   37  154-190   421-459 (563)
 16 PF02463 SMC_N:  RecF/RecN/SMC   97.1 0.00031 6.6E-09   58.4   2.1   24  171-194   136-159 (220)
 17 PHA02562 46 endonuclease subun  97.0  0.0061 1.3E-07   57.5  10.8   63  117-188   423-485 (562)
 18 PF13166 AAA_13:  AAA domain     96.2   0.092   2E-06   51.2  13.1   35  153-190   485-519 (712)
 19 PRK01156 chromosome segregatio  96.1   0.025 5.5E-07   56.7   8.9   29  163-191   793-821 (895)
 20 PF13514 AAA_27:  AAA domain     96.0   0.093   2E-06   54.3  12.6   70  119-192   977-1046(1111)
 21 PF13558 SbcCD_C:  Putative exo  95.0   0.035 7.5E-07   40.9   4.0   26  166-191    27-53  (90)
 22 COG0497 RecN ATPase involved i  95.0    0.66 1.4E-05   45.2  13.5   38  154-191   412-451 (557)
 23 PRK04778 septation ring format  94.7   0.068 1.5E-06   51.6   6.0   94   35-131   430-527 (569)
 24 PRK00064 recF recombination pr  93.8     2.3 4.9E-05   38.8  13.8   70  117-190   192-292 (361)
 25 COG4694 Uncharacterized protei  93.5    0.99 2.2E-05   44.3  11.2   24  170-193   528-551 (758)
 26 TIGR00618 sbcc exonuclease Sbc  92.0    0.94   2E-05   46.7   9.5   27  163-189   942-968 (1042)
 27 TIGR00611 recf recF protein. A  92.0     5.1 0.00011   36.7  13.4   70  118-191   199-295 (365)
 28 PRK14079 recF recombination pr  91.9     4.4 9.6E-05   36.8  12.7   67  117-187   189-279 (349)
 29 PRK10246 exonuclease subunit S  91.7     1.8 3.9E-05   44.9  11.2   35  154-188   930-966 (1047)
 30 COG1122 CbiO ABC-type cobalt t  91.4   0.058 1.3E-06   46.7   0.0   23  167-189   134-156 (235)
 31 COG1136 SalX ABC-type antimicr  89.8    0.17 3.7E-06   43.9   1.5   21  167-187   138-158 (226)
 32 COG1120 FepC ABC-type cobalami  89.6    0.22 4.9E-06   44.0   2.2   21  167-187   134-154 (258)
 33 TIGR00606 rad50 rad50. This fa  89.6       2 4.2E-05   45.6   9.4   70  120-190  1139-1218(1311)
 34 TIGR02168 SMC_prok_B chromosom  89.2     1.8 3.8E-05   43.8   8.4   53   80-132   998-1050(1179)
 35 cd03275 ABC_SMC1_euk Eukaryoti  87.3    0.29 6.3E-06   41.8   1.3   32  159-190   143-174 (247)
 36 cd03239 ABC_SMC_head The struc  85.7     1.4 3.1E-05   36.0   4.6   30  157-189    83-112 (178)
 37 COG4717 Uncharacterized conser  85.7      16 0.00034   37.8  12.5   62  125-192   861-922 (984)
 38 COG3840 ThiQ ABC-type thiamine  84.9    0.46   1E-05   41.0   1.3   18  168-185   126-143 (231)
 39 COG2884 FtsE Predicted ATPase   84.7     0.5 1.1E-05   40.8   1.4   18  167-184   133-150 (223)
 40 COG4604 CeuD ABC-type enteroch  84.3    0.24 5.2E-06   43.2  -0.6   21  167-187   131-151 (252)
 41 COG1126 GlnQ ABC-type polar am  83.9    0.43 9.4E-06   41.7   0.7   23  167-189   132-154 (240)
 42 PF00005 ABC_tran:  ABC transpo  83.8    0.88 1.9E-05   34.4   2.3   20  168-187   105-124 (137)
 43 COG1135 AbcC ABC-type metal io  83.2    0.73 1.6E-05   42.2   1.9   26  163-188   133-158 (339)
 44 COG1124 DppF ABC-type dipeptid  83.2    0.65 1.4E-05   41.0   1.5   20  168-187   138-157 (252)
 45 COG0488 Uup ATPase components   82.9    0.57 1.2E-05   45.3   1.2   21  167-187   435-455 (530)
 46 COG1121 ZnuC ABC-type Mn/Zn tr  82.1     0.9   2E-05   40.1   2.0   21  167-187   135-155 (254)
 47 cd03235 ABC_Metallic_Cations A  82.1       1 2.2E-05   37.1   2.2   21  168-188   129-149 (213)
 48 COG1101 PhnK ABC-type uncharac  81.5    0.82 1.8E-05   40.3   1.5   21  167-189   144-164 (263)
 49 TIGR00960 3a0501s02 Type II (G  81.3    0.99 2.1E-05   37.3   1.9   20  169-188   136-155 (216)
 50 COG1116 TauB ABC-type nitrate/  81.0    0.83 1.8E-05   40.3   1.4   19  169-187   128-146 (248)
 51 cd03261 ABC_Org_Solvent_Resist  80.9    0.99 2.1E-05   37.8   1.8   21  168-188   133-153 (235)
 52 TIGR02211 LolD_lipo_ex lipopro  80.4     1.1 2.4E-05   37.0   1.9   20  169-188   139-158 (221)
 53 cd03225 ABC_cobalt_CbiO_domain  80.4     1.2 2.7E-05   36.5   2.2   20  169-188   132-151 (211)
 54 PRK04863 mukB cell division pr  80.2     3.1 6.7E-05   45.0   5.5   24  168-191  1362-1385(1486)
 55 cd03259 ABC_Carb_Solutes_like   80.1     1.1 2.4E-05   36.9   1.8   20  169-188   128-147 (213)
 56 COG4619 ABC-type uncharacteriz  80.0    0.96 2.1E-05   38.7   1.4   17  167-183   129-145 (223)
 57 KOG0062|consensus               80.0    0.89 1.9E-05   44.2   1.4   20  166-185   477-496 (582)
 58 cd03293 ABC_NrtD_SsuB_transpor  79.7     1.3 2.8E-05   36.7   2.1   19  170-188   130-148 (220)
 59 cd03255 ABC_MJ0796_Lo1CDE_FtsE  79.5     1.1 2.3E-05   37.0   1.6   20  169-188   138-157 (218)
 60 cd03237 ABC_RNaseL_inhibitor_d  79.5     1.2 2.6E-05   38.3   1.9   21  168-188   112-132 (246)
 61 cd03278 ABC_SMC_barmotin Barmo  79.4     1.4   3E-05   36.6   2.2   24  166-189   108-131 (197)
 62 COG1123 ATPase components of v  79.4     1.2 2.5E-05   43.4   2.0   22  167-188   425-446 (539)
 63 cd03242 ABC_RecF RecF is a rec  79.3     7.1 0.00015   33.8   6.7   31  154-188   170-200 (270)
 64 cd03256 ABC_PhnC_transporter A  79.2     1.4   3E-05   36.9   2.1   21  168-188   141-161 (241)
 65 TIGR02673 FtsE cell division A  79.0     1.3 2.8E-05   36.4   1.9   20  169-188   135-154 (214)
 66 cd03268 ABC_BcrA_bacitracin_re  78.8     1.2 2.5E-05   36.6   1.5   21  168-188   123-143 (208)
 67 COG3839 MalK ABC-type sugar tr  78.3     1.2 2.5E-05   40.9   1.6   16  169-184   131-146 (338)
 68 cd03269 ABC_putative_ATPase Th  78.1     1.3 2.9E-05   36.3   1.7   21  168-188   125-145 (210)
 69 cd03276 ABC_SMC6_euk Eukaryoti  78.1     1.9 4.2E-05   35.8   2.7   26  165-190   103-128 (198)
 70 TIGR01184 ntrCD nitrate transp  78.0     1.4 3.1E-05   37.0   1.9   20  169-188   112-131 (230)
 71 cd03226 ABC_cobalt_CbiO_domain  77.9     1.6 3.4E-05   35.8   2.1   21  168-188   123-143 (205)
 72 PRK13643 cbiO cobalt transport  77.6     1.6 3.5E-05   38.1   2.2   21  168-188   141-161 (288)
 73 cd03219 ABC_Mj1267_LivG_branch  77.6     1.5 3.2E-05   36.7   1.8   21  168-188   140-160 (236)
 74 cd03265 ABC_DrrA DrrA is the A  77.5     1.5 3.2E-05   36.3   1.9   20  169-188   129-148 (220)
 75 PRK10982 galactose/methyl gala  77.3     1.6 3.5E-05   40.9   2.2   23  166-188   386-408 (491)
 76 PRK13409 putative ATPase RIL;   77.3     1.5 3.3E-05   42.6   2.1   22  167-188   449-470 (590)
 77 KOG0058|consensus               77.1     1.4 2.9E-05   44.2   1.7   14  170-183   603-616 (716)
 78 TIGR01166 cbiO cobalt transpor  77.0     1.7 3.6E-05   35.2   2.0   20  169-188   125-144 (190)
 79 TIGR02315 ABC_phnC phosphonate  76.9     1.7 3.7E-05   36.4   2.1   21  168-188   142-162 (243)
 80 cd03245 ABCC_bacteriocin_expor  76.9     1.8   4E-05   35.7   2.2   21  168-188   137-157 (220)
 81 TIGR00972 3a0107s01c2 phosphat  76.7     1.8 3.9E-05   36.6   2.1   21  168-188   141-161 (247)
 82 cd03292 ABC_FtsE_transporter F  76.5     1.7 3.7E-05   35.6   1.9   20  169-188   134-153 (214)
 83 TIGR02770 nickel_nikD nickel i  76.5     1.8 3.8E-05   36.3   2.0   21  168-188   122-142 (230)
 84 cd03260 ABC_PstB_phosphate_tra  76.5     1.8 3.8E-05   36.0   2.0   20  169-188   139-158 (227)
 85 COG1118 CysA ABC-type sulfate/  76.4     1.4 3.1E-05   40.4   1.6   21  169-189   135-155 (345)
 86 PRK13649 cbiO cobalt transport  76.3     1.8   4E-05   37.4   2.1   21  168-188   142-162 (280)
 87 PRK11629 lolD lipoprotein tran  76.3     1.7 3.7E-05   36.4   1.9   20  169-188   143-162 (233)
 88 cd03252 ABCC_Hemolysin The ABC  76.3     1.9 4.1E-05   36.1   2.2   21  168-188   135-155 (237)
 89 PRK11247 ssuB aliphatic sulfon  76.2     1.7 3.8E-05   37.5   2.0   21  168-188   130-150 (257)
 90 PRK13548 hmuV hemin importer A  76.1     1.9 4.1E-05   37.0   2.1   21  168-188   131-151 (258)
 91 COG3842 PotA ABC-type spermidi  76.1     1.1 2.4E-05   41.3   0.8   20  168-187   133-152 (352)
 92 PRK10938 putative molybdenum t  76.0     1.8 3.9E-05   40.4   2.2   22  167-188   131-152 (490)
 93 cd03218 ABC_YhbG The ABC trans  75.9     1.8 3.9E-05   36.0   1.9   21  168-188   130-150 (232)
 94 PRK14247 phosphate ABC transpo  75.9     1.9 4.1E-05   36.5   2.1   21  168-188   143-163 (250)
 95 PRK11831 putative ABC transpor  75.8     1.8 3.9E-05   37.3   2.0   21  168-188   140-160 (269)
 96 TIGR02323 CP_lyasePhnK phospho  75.7     1.9   4E-05   36.6   2.0   21  168-188   145-165 (253)
 97 TIGR03269 met_CoM_red_A2 methy  75.7     1.9   4E-05   40.7   2.2   21  168-188   165-185 (520)
 98 PRK13638 cbiO cobalt transport  75.5       2 4.3E-05   37.0   2.1   21  168-188   133-153 (271)
 99 PRK13538 cytochrome c biogenes  75.4     1.8 3.9E-05   35.6   1.8   21  168-188   126-146 (204)
100 cd03264 ABC_drug_resistance_li  75.3     1.9 4.1E-05   35.4   1.9   21  168-188   127-147 (211)
101 PRK14250 phosphate ABC transpo  75.3     2.1 4.6E-05   36.2   2.2   21  168-188   128-148 (241)
102 COG4608 AppF ABC-type oligopep  75.3     1.8   4E-05   38.5   1.9   23  167-189   105-127 (268)
103 cd03301 ABC_MalK_N The N-termi  75.2       2 4.4E-05   35.2   2.0   20  169-188   128-147 (213)
104 cd03263 ABC_subfamily_A The AB  75.2     1.8 3.9E-05   35.7   1.8   20  169-188   131-150 (220)
105 cd03298 ABC_ThiQ_thiamine_tran  75.1     2.1 4.5E-05   35.2   2.1   19  170-188   127-145 (211)
106 cd03277 ABC_SMC5_euk Eukaryoti  75.1     2.3 4.9E-05   35.9   2.3   23  168-190   123-145 (213)
107 PRK11264 putative amino-acid A  75.1       2 4.4E-05   36.2   2.1   21  168-188   141-161 (250)
108 cd03266 ABC_NatA_sodium_export  75.1     1.7 3.8E-05   35.8   1.6   21  168-188   133-153 (218)
109 TIGR02633 xylG D-xylose ABC tr  75.0     1.9 4.2E-05   40.4   2.1   22  167-188   399-420 (500)
110 PRK10584 putative ABC transpor  74.9       2 4.3E-05   35.7   1.9   20  169-188   144-163 (228)
111 PRK11000 maltose/maltodextrin   74.9     1.9 4.1E-05   39.4   2.0   21  168-188   130-150 (369)
112 PRK09700 D-allose transporter   74.7       2 4.3E-05   40.5   2.1   23  166-188   404-426 (510)
113 COG0410 LivF ABC-type branched  74.7     1.7 3.7E-05   38.1   1.5   20  167-186   132-151 (237)
114 cd03220 ABC_KpsT_Wzt ABC_KpsT_  74.7       2 4.3E-05   36.0   1.9   21  168-188   139-159 (224)
115 TIGR03864 PQQ_ABC_ATP ABC tran  74.7       2 4.3E-05   36.1   1.9   21  168-188   129-149 (236)
116 cd03257 ABC_NikE_OppD_transpor  74.6     2.1 4.6E-05   35.4   2.0   21  168-188   142-162 (228)
117 PRK13651 cobalt transporter AT  74.6     2.1 4.6E-05   38.0   2.1   22  168-189   162-183 (305)
118 PRK15134 microcin C ABC transp  74.5       2 4.3E-05   40.7   2.1   22  167-188   152-173 (529)
119 PRK14242 phosphate transporter  74.4     2.3 4.9E-05   36.0   2.2   21  168-188   146-166 (253)
120 PRK10636 putative ABC transpor  74.3     1.8   4E-05   42.3   1.8   21  168-188   427-447 (638)
121 TIGR01187 potA spermidine/putr  74.3       2 4.4E-05   38.4   2.0   20  169-188    98-117 (325)
122 PRK13549 xylose transporter AT  74.3       2 4.4E-05   40.4   2.0   22  167-188   401-422 (506)
123 TIGR03258 PhnT 2-aminoethylpho  74.0     2.1 4.5E-05   39.2   2.0   21  168-188   134-154 (362)
124 PRK15079 oligopeptide ABC tran  74.0     2.1 4.5E-05   38.6   2.0   20  169-188   159-178 (331)
125 cd03297 ABC_ModC_molybdenum_tr  74.0     2.3   5E-05   35.1   2.1   21  168-188   128-148 (214)
126 COG4181 Predicted ABC-type tra  73.8       2 4.4E-05   36.9   1.7   20  168-187   143-162 (228)
127 cd03214 ABC_Iron-Siderophores_  73.7     2.5 5.4E-05   34.1   2.2   21  168-188    94-114 (180)
128 cd03254 ABCC_Glucan_exporter_l  73.6     2.4 5.2E-05   35.2   2.1   21  168-188   136-156 (229)
129 TIGR01288 nodI ATP-binding ABC  73.6     2.1 4.6E-05   37.7   1.8   21  168-188   132-152 (303)
130 PRK14272 phosphate ABC transpo  73.6     2.4 5.1E-05   35.8   2.1   21  168-188   145-165 (252)
131 PRK15134 microcin C ABC transp  73.6     2.2 4.9E-05   40.3   2.2   22  167-188   421-442 (529)
132 PRK10908 cell division protein  73.5     2.4 5.1E-05   35.2   2.0   20  169-188   135-154 (222)
133 COG4559 ABC-type hemin transpo  73.5     2.3 5.1E-05   37.4   2.1   21  167-187   131-151 (259)
134 cd03224 ABC_TM1139_LivF_branch  73.5     2.2 4.7E-05   35.2   1.8   21  168-188   129-149 (222)
135 PRK11614 livF leucine/isoleuci  73.4     2.2 4.8E-05   35.7   1.9   21  168-188   134-154 (237)
136 cd03262 ABC_HisP_GlnQ_permease  73.4     2.4 5.1E-05   34.7   2.0   20  169-188   133-152 (213)
137 PRK13631 cbiO cobalt transport  73.3     2.4 5.2E-05   37.9   2.2   21  168-188   173-193 (320)
138 TIGR03410 urea_trans_UrtE urea  73.3     2.3 4.9E-05   35.4   1.9   21  168-188   128-148 (230)
139 PRK15439 autoinducer 2 ABC tra  73.3     2.4 5.2E-05   40.1   2.3   23  166-188   398-420 (510)
140 PRK13641 cbiO cobalt transport  73.2     2.5 5.5E-05   36.9   2.2   21  168-188   142-162 (287)
141 TIGR01189 ccmA heme ABC export  73.2     2.2 4.9E-05   34.8   1.8   21  168-188   124-144 (198)
142 PRK13543 cytochrome c biogenes  73.1     2.3   5E-05   35.2   1.9   21  168-188   134-154 (214)
143 cd03296 ABC_CysA_sulfate_impor  73.0     2.3   5E-05   35.7   1.9   20  169-188   134-153 (239)
144 cd03240 ABC_Rad50 The catalyti  73.0     3.3 7.2E-05   34.4   2.8   23  168-190   112-134 (204)
145 PRK11701 phnK phosphonate C-P   73.0     2.6 5.7E-05   35.9   2.2   21  168-188   148-168 (258)
146 PRK11124 artP arginine transpo  72.9     2.4 5.1E-05   35.7   1.9   20  169-188   139-158 (242)
147 PRK11288 araG L-arabinose tran  72.9     2.2 4.8E-05   40.1   1.9   23  166-188   391-413 (501)
148 cd03294 ABC_Pro_Gly_Bertaine T  72.9     2.5 5.5E-05   36.5   2.2   20  169-188   158-177 (269)
149 cd03231 ABC_CcmA_heme_exporter  72.9     2.3 5.1E-05   34.9   1.9   21  168-188   122-142 (201)
150 TIGR02314 ABC_MetN D-methionin  72.9     2.2 4.8E-05   38.8   1.9   21  168-188   137-157 (343)
151 PRK14273 phosphate ABC transpo  72.8     2.6 5.7E-05   35.7   2.2   21  168-188   147-167 (254)
152 TIGR01277 thiQ thiamine ABC tr  72.7     2.6 5.6E-05   34.8   2.1   19  170-188   127-145 (213)
153 PRK11022 dppD dipeptide transp  72.6     2.5 5.4E-05   37.9   2.1   21  168-188   150-170 (326)
154 PRK14249 phosphate ABC transpo  72.6     2.6 5.7E-05   35.7   2.2   22  167-188   143-164 (251)
155 PRK11308 dppF dipeptide transp  72.6     2.6 5.7E-05   37.8   2.2   20  169-188   152-171 (327)
156 cd03248 ABCC_TAP TAP, the Tran  72.6     2.6 5.7E-05   34.9   2.1   20  169-188   148-167 (226)
157 PRK11650 ugpC glycerol-3-phosp  72.6     2.2 4.8E-05   38.8   1.8   20  169-188   132-151 (356)
158 cd03258 ABC_MetN_methionine_tr  72.5     2.4 5.3E-05   35.3   1.9   21  168-188   137-157 (233)
159 PRK14245 phosphate ABC transpo  72.5     2.6 5.7E-05   35.7   2.1   21  168-188   143-163 (250)
160 cd03249 ABC_MTABC3_MDL1_MDL2 M  72.4     2.6 5.6E-05   35.3   2.1   21  168-188   136-156 (238)
161 PRK10771 thiQ thiamine transpo  72.4     2.7 5.8E-05   35.2   2.1   19  170-188   128-146 (232)
162 TIGR01188 drrA daunorubicin re  72.4     2.4 5.2E-05   37.3   1.9   21  168-188   121-141 (302)
163 PRK13637 cbiO cobalt transport  72.4     2.6 5.7E-05   36.8   2.2   21  168-188   141-161 (287)
164 PRK11248 tauB taurine transpor  72.4     2.4 5.2E-05   36.4   1.9   20  169-188   126-145 (255)
165 PRK15112 antimicrobial peptide  72.2     2.5 5.5E-05   36.3   2.0   20  169-188   147-166 (267)
166 PRK11432 fbpC ferric transport  72.2     2.5 5.4E-05   38.5   2.0   20  169-188   134-153 (351)
167 PRK13646 cbiO cobalt transport  72.2     2.7 5.8E-05   36.7   2.2   22  168-189   142-163 (286)
168 PRK11153 metN DL-methionine tr  72.2     2.4 5.3E-05   38.2   1.9   21  168-188   137-157 (343)
169 PRK11144 modC molybdate transp  72.0     2.6 5.7E-05   38.1   2.1   20  169-188   126-145 (352)
170 PRK14258 phosphate ABC transpo  72.0     2.8   6E-05   35.9   2.2   21  168-188   147-167 (261)
171 PRK14268 phosphate ABC transpo  72.0     2.6 5.7E-05   36.0   2.0   21  168-188   151-171 (258)
172 TIGR03608 L_ocin_972_ABC putat  72.0     2.7 5.8E-05   34.2   2.0   20  169-188   132-151 (206)
173 PRK14254 phosphate ABC transpo  72.0     2.7 5.9E-05   36.7   2.2   21  168-188   177-197 (285)
174 PRK14241 phosphate transporter  71.9     2.7 5.9E-05   35.8   2.1   22  167-188   144-165 (258)
175 PRK13645 cbiO cobalt transport  71.8     2.7 5.8E-05   36.6   2.1   21  168-188   147-167 (289)
176 PRK14239 phosphate transporter  71.7     2.9 6.3E-05   35.3   2.2   21  168-188   145-165 (252)
177 COG4148 ModC ABC-type molybdat  71.7       2 4.4E-05   39.3   1.3   14  170-183   127-140 (352)
178 PRK14274 phosphate ABC transpo  71.6     2.8 6.1E-05   35.7   2.2   21  168-188   152-172 (259)
179 TIGR02142 modC_ABC molybdenum   71.6     2.6 5.7E-05   38.1   2.0   20  169-188   129-148 (354)
180 PRK13634 cbiO cobalt transport  71.6     2.8 6.1E-05   36.7   2.2   21  168-188   142-162 (290)
181 cd03295 ABC_OpuCA_Osmoprotecti  71.5     2.5 5.4E-05   35.6   1.8   21  168-188   132-152 (242)
182 PRK10762 D-ribose transporter   71.5     2.5 5.4E-05   39.8   1.9   22  167-188   391-412 (501)
183 PRK14255 phosphate ABC transpo  71.4     2.9 6.4E-05   35.3   2.2   21  168-188   145-165 (252)
184 PRK11300 livG leucine/isoleuci  71.4     2.7 5.9E-05   35.5   2.0   21  168-188   150-170 (255)
185 PRK14270 phosphate ABC transpo  71.3       3 6.4E-05   35.3   2.2   21  168-188   144-164 (251)
186 PRK09452 potA putrescine/sperm  71.3     2.5 5.4E-05   38.9   1.9   20  169-188   142-161 (375)
187 PRK14267 phosphate ABC transpo  71.2     2.7 5.8E-05   35.6   1.9   21  168-188   146-166 (253)
188 PRK10261 glutathione transport  71.2     2.7 5.8E-05   40.9   2.1   22  167-188   459-480 (623)
189 cd03234 ABCG_White The White s  71.1     3.1 6.7E-05   34.7   2.2   21  168-188   140-160 (226)
190 TIGR03265 PhnT2 putative 2-ami  71.0     2.6 5.7E-05   38.3   1.9   21  168-188   131-151 (353)
191 COG3638 ABC-type phosphate/pho  70.9     2.1 4.6E-05   37.9   1.2   25  163-187   139-163 (258)
192 PRK14262 phosphate ABC transpo  70.9     2.8 6.1E-05   35.4   2.0   21  168-188   143-163 (250)
193 TIGR03411 urea_trans_UrtD urea  70.8     2.8   6E-05   35.2   1.9   21  168-188   140-160 (242)
194 PRK14235 phosphate transporter  70.8     3.1 6.7E-05   35.8   2.2   21  168-188   160-180 (267)
195 PRK10744 pstB phosphate transp  70.7     3.2 6.9E-05   35.5   2.3   21  168-188   153-173 (260)
196 PRK09700 D-allose transporter   70.6     2.6 5.7E-05   39.6   1.9   21  168-188   142-162 (510)
197 PRK11147 ABC transporter ATPas  70.5     2.5 5.5E-05   41.2   1.8   21  168-188   437-457 (635)
198 PRK10895 lipopolysaccharide AB  70.5     2.9 6.2E-05   35.1   1.9   21  168-188   134-154 (241)
199 TIGR02324 CP_lyasePhnL phospho  70.5     3.1 6.8E-05   34.4   2.1   21  168-188   146-166 (224)
200 PRK11607 potG putrescine trans  70.5     2.8   6E-05   38.6   1.9   21  168-188   146-166 (377)
201 TIGR03269 met_CoM_red_A2 methy  70.3     2.7 5.8E-05   39.7   1.9   22  167-188   423-444 (520)
202 TIGR02203 MsbA_lipidA lipid A   70.3     3.6 7.7E-05   39.0   2.7   27  154-186   458-484 (571)
203 cd03272 ABC_SMC3_euk Eukaryoti  70.3     2.9 6.4E-05   35.0   1.9   23  167-189   154-176 (243)
204 PRK09473 oppD oligopeptide tra  70.2     2.9 6.3E-05   37.6   2.0   21  168-188   158-178 (330)
205 PRK15064 ABC transporter ATP-b  70.1     2.9 6.3E-05   39.6   2.0   21  168-188   435-455 (530)
206 PRK10982 galactose/methyl gala  70.1     2.8   6E-05   39.3   1.9   21  168-188   131-151 (491)
207 PRK13547 hmuV hemin importer A  70.1     3.1 6.8E-05   36.2   2.1   21  168-188   142-162 (272)
208 PRK09493 glnQ glutamine ABC tr  70.0       3 6.5E-05   35.0   2.0   20  169-188   134-153 (240)
209 PRK13549 xylose transporter AT  69.9     2.7 5.9E-05   39.6   1.8   21  168-188   140-160 (506)
210 PRK15093 antimicrobial peptide  69.8     3.1 6.7E-05   37.3   2.1   21  168-188   155-175 (330)
211 COG0444 DppD ABC-type dipeptid  69.8     2.9 6.3E-05   38.1   1.9   21  168-188   150-170 (316)
212 PRK14240 phosphate transporter  69.8     3.4 7.3E-05   34.9   2.2   21  168-188   143-163 (250)
213 PRK11819 putative ABC transpor  69.7     2.8 6.1E-05   40.1   1.9   21  168-188   160-180 (556)
214 cd03253 ABCC_ATM1_transporter   69.7     3.3 7.1E-05   34.5   2.1   20  169-188   135-154 (236)
215 PRK09544 znuC high-affinity zi  69.7       3 6.5E-05   35.8   1.9   21  168-188   117-137 (251)
216 TIGR02769 nickel_nikE nickel i  69.7     3.1 6.8E-05   35.7   2.0   21  168-188   147-167 (265)
217 PRK15439 autoinducer 2 ABC tra  69.6     2.9 6.3E-05   39.5   1.9   21  168-188   137-157 (510)
218 PRK11174 cysteine/glutathione   69.6     2.5 5.3E-05   40.4   1.4   15  170-184   484-498 (588)
219 PRK13541 cytochrome c biogenes  69.6     3.1 6.7E-05   33.9   1.9   21  168-188   120-140 (195)
220 PRK14244 phosphate ABC transpo  69.4     3.1 6.8E-05   35.2   1.9   21  168-188   146-166 (251)
221 PRK03695 vitamin B12-transport  69.4     3.4 7.4E-05   35.2   2.1   21  168-188   123-143 (248)
222 TIGR03005 ectoine_ehuA ectoine  69.4     3.2 6.9E-05   35.2   2.0   20  169-188   144-163 (252)
223 PRK14269 phosphate ABC transpo  69.4     3.5 7.5E-05   34.9   2.2   21  168-188   139-159 (246)
224 TIGR03719 ABC_ABC_ChvD ATP-bin  69.3     2.9 6.3E-05   39.9   1.9   21  168-188   158-178 (552)
225 PRK10419 nikE nickel transport  69.3     3.6 7.9E-05   35.5   2.3   21  168-188   148-168 (268)
226 PRK15056 manganese/iron transp  69.3     3.4 7.4E-05   35.6   2.2   21  168-188   139-159 (272)
227 PRK10575 iron-hydroxamate tran  69.2     3.5 7.5E-05   35.4   2.2   20  169-188   145-164 (265)
228 cd00267 ABC_ATPase ABC (ATP-bi  69.2     3.4 7.3E-05   32.4   2.0   18  172-189    81-98  (157)
229 cd03244 ABCC_MRP_domain2 Domai  69.2     3.5 7.7E-05   34.0   2.2   21  168-188   136-156 (221)
230 COG0488 Uup ATPase components   69.1     2.9 6.2E-05   40.5   1.8   21  166-186   148-168 (530)
231 cd03251 ABCC_MsbA MsbA is an e  69.1     3.5 7.7E-05   34.3   2.2   20  169-188   136-155 (234)
232 TIGR03719 ABC_ABC_ChvD ATP-bin  68.9       3 6.6E-05   39.8   1.9   21  168-188   440-460 (552)
233 PRK14253 phosphate ABC transpo  68.9     3.6 7.9E-05   34.7   2.2   21  168-188   142-162 (249)
234 cd03233 ABC_PDR_domain1 The pl  68.7     3.5 7.6E-05   34.0   2.0   21  168-188   115-135 (202)
235 PRK14248 phosphate ABC transpo  68.7     3.6 7.8E-05   35.3   2.2   21  168-188   161-181 (268)
236 cd03270 ABC_UvrA_I The excisio  68.7     3.7 8.1E-05   34.6   2.2   22  168-189   134-155 (226)
237 TIGR01186 proV glycine betaine  68.6     3.1 6.8E-05   38.2   1.9   21  168-188   126-146 (363)
238 PRK10619 histidine/lysine/argi  68.4     3.6 7.9E-05   35.0   2.1   21  168-188   149-169 (257)
239 cd03267 ABC_NatA_like Similar   68.4     3.2   7E-05   35.0   1.8   20  169-188   151-170 (236)
240 TIGR02633 xylG D-xylose ABC tr  68.3     3.1 6.8E-05   39.0   1.8   21  168-188   138-158 (500)
241 PRK11231 fecE iron-dicitrate t  68.2     3.8 8.2E-05   34.8   2.2   21  168-188   135-155 (255)
242 PRK11147 ABC transporter ATPas  68.1     3.2   7E-05   40.5   2.0   22  167-188   152-173 (635)
243 TIGR01978 sufC FeS assembly AT  68.1     3.5 7.6E-05   34.4   2.0   18  171-188   144-161 (243)
244 PRK10762 D-ribose transporter   67.9     3.1 6.8E-05   39.1   1.8   21  168-188   138-158 (501)
245 PRK13540 cytochrome c biogenes  67.9     3.7 7.9E-05   33.6   2.0   20  169-188   125-144 (200)
246 PRK10938 putative molybdenum t  67.8     3.2   7E-05   38.8   1.8   22  167-188   397-418 (490)
247 PRK15177 Vi polysaccharide exp  67.8     3.1 6.8E-05   34.7   1.6   21  168-188   101-121 (213)
248 TIGR03740 galliderm_ABC gallid  67.8     3.1 6.8E-05   34.5   1.6   21  168-188   121-141 (223)
249 PRK09984 phosphonate/organopho  67.8     3.9 8.4E-05   34.9   2.2   21  168-188   149-169 (262)
250 cd03229 ABC_Class3 This class   67.6     3.7   8E-05   33.0   1.9   17  172-188   101-117 (178)
251 COG1123 ATPase components of v  67.6     3.9 8.3E-05   39.9   2.3   21  168-188   151-171 (539)
252 PLN03073 ABC transporter F fam  67.4     3.5 7.7E-05   41.2   2.1   21  168-188   624-644 (718)
253 PRK14251 phosphate ABC transpo  67.4     3.7 7.9E-05   34.7   1.9   21  168-188   144-164 (251)
254 PRK14265 phosphate ABC transpo  67.4       4 8.6E-05   35.4   2.2   21  168-188   158-178 (274)
255 PRK14259 phosphate ABC transpo  67.3     3.9 8.4E-05   35.3   2.1   21  168-188   151-171 (269)
256 PRK13633 cobalt transporter AT  67.3       4 8.6E-05   35.4   2.2   20  169-188   142-161 (280)
257 TIGR02868 CydC thiol reductant  67.3     2.9 6.3E-05   39.3   1.4   15  170-184   469-483 (529)
258 cd03299 ABC_ModC_like Archeal   67.2       4 8.8E-05   34.3   2.2   19  170-188   128-146 (235)
259 cd03247 ABCC_cytochrome_bd The  67.1     4.1 8.9E-05   32.7   2.1   20  169-188    96-115 (178)
260 PRK10253 iron-enterobactin tra  67.1     4.1   9E-05   34.9   2.2   21  168-188   140-160 (265)
261 PRK14238 phosphate transporter  66.9     4.1 8.8E-05   35.2   2.2   21  168-188   164-184 (271)
262 cd03223 ABCD_peroxisomal_ALDP   66.9     4.3 9.2E-05   32.5   2.1   20  168-187    88-107 (166)
263 TIGR03873 F420-0_ABC_ATP propo  66.9     4.2   9E-05   34.6   2.2   21  168-188   134-154 (256)
264 PRK10070 glycine betaine trans  66.9     3.8 8.3E-05   38.1   2.1   21  168-188   161-181 (400)
265 PRK11288 araG L-arabinose tran  66.9     3.5 7.7E-05   38.7   1.9   21  168-188   137-157 (501)
266 PRK10261 glutathione transport  66.9     3.8 8.2E-05   39.9   2.1   22  167-188   164-185 (623)
267 cd03230 ABC_DR_subfamily_A Thi  66.8     3.9 8.5E-05   32.7   1.9   17  172-188    96-112 (173)
268 KOG0056|consensus               66.7     2.8   6E-05   41.2   1.2   14  171-184   674-687 (790)
269 PRK14256 phosphate ABC transpo  66.7     4.2 9.2E-05   34.4   2.2   21  168-188   145-165 (252)
270 PRK10636 putative ABC transpor  66.6     3.2   7E-05   40.6   1.6   22  167-188   145-166 (638)
271 PRK14243 phosphate transporter  66.6     4.1 8.9E-05   35.0   2.1   21  168-188   148-168 (264)
272 PRK10851 sulfate/thiosulfate t  66.5     3.8 8.2E-05   37.3   2.0   21  168-188   133-153 (353)
273 PRK15064 ABC transporter ATP-b  66.4     3.7 8.1E-05   38.9   2.0   21  168-188   152-172 (530)
274 PRK14266 phosphate ABC transpo  66.3     4.4 9.5E-05   34.2   2.2   21  168-188   143-163 (250)
275 PRK10418 nikD nickel transport  66.2     4.2 9.1E-05   34.6   2.1   21  168-188   137-157 (254)
276 PRK13650 cbiO cobalt transport  66.2     4.2 9.1E-05   35.3   2.1   20  169-188   138-157 (279)
277 PRK13539 cytochrome c biogenes  66.2     3.9 8.5E-05   33.7   1.8   20  169-188   125-144 (207)
278 PRK13647 cbiO cobalt transport  66.2     4.1 8.8E-05   35.3   2.0   21  168-188   135-155 (274)
279 PRK13409 putative ATPase RIL;   66.1     3.7   8E-05   40.0   1.9   22  167-188   208-229 (590)
280 PRK14275 phosphate ABC transpo  66.1       4 8.7E-05   35.7   2.0   21  168-188   179-199 (286)
281 cd03274 ABC_SMC4_euk Eukaryoti  65.9     5.9 0.00013   33.2   2.9   31  160-190   116-146 (212)
282 TIGR03771 anch_rpt_ABC anchore  65.9     4.2   9E-05   34.0   2.0   21  168-188   110-130 (223)
283 cd03273 ABC_SMC2_euk Eukaryoti  65.9     4.6 9.9E-05   34.4   2.3   22  168-189   163-184 (251)
284 cd03238 ABC_UvrA The excision   65.8     4.7  0.0001   33.2   2.2   21  168-188    84-104 (176)
285 PRK11819 putative ABC transpor  65.7     3.9 8.4E-05   39.2   2.0   20  168-187   442-461 (556)
286 PRK13652 cbiO cobalt transport  65.7     4.6 9.9E-05   35.0   2.3   20  169-188   135-154 (277)
287 PRK13639 cbiO cobalt transport  65.6     4.2   9E-05   35.2   2.0   21  168-188   134-154 (275)
288 PRK09580 sufC cysteine desulfu  65.6     4.4 9.5E-05   34.0   2.1   18  171-188   145-162 (248)
289 cd03271 ABC_UvrA_II The excisi  65.5     4.4 9.5E-05   35.6   2.1   22  167-188   165-186 (261)
290 PRK13632 cbiO cobalt transport  65.4     4.6  0.0001   34.8   2.2   20  169-188   140-159 (271)
291 cd03232 ABC_PDR_domain2 The pl  65.3     4.2 9.1E-05   33.2   1.8   18  171-188   108-125 (192)
292 PRK13642 cbiO cobalt transport  65.2     4.7  0.0001   35.0   2.2   21  168-188   137-157 (277)
293 cd03369 ABCC_NFT1 Domain 2 of   65.2     4.9 0.00011   32.9   2.2   21  168-188   122-142 (207)
294 KOG0055|consensus               65.1     3.5 7.5E-05   43.8   1.6   14  170-183  1125-1138(1228)
295 PRK14261 phosphate ABC transpo  65.0     4.3 9.4E-05   34.4   1.9   21  168-188   146-166 (253)
296 PRK09536 btuD corrinoid ABC tr  65.0     4.2 9.2E-05   37.9   2.0   20  168-187   136-155 (402)
297 PRK13644 cbiO cobalt transport  64.9     4.6  0.0001   35.0   2.1   20  169-188   134-153 (274)
298 cd03279 ABC_sbcCD SbcCD and ot  64.9     5.4 0.00012   33.1   2.4   23  167-189   119-141 (213)
299 cd03246 ABCC_Protease_Secretio  64.8     4.4 9.6E-05   32.4   1.9   17  172-188    97-113 (173)
300 COG1132 MdlB ABC-type multidru  64.8     3.4 7.3E-05   39.4   1.3   16  170-185   464-479 (567)
301 cd03250 ABCC_MRP_domain1 Domai  64.4     5.3 0.00011   32.6   2.3   20  169-188   125-144 (204)
302 PRK10247 putative ABC transpor  64.2     4.9 0.00011   33.5   2.1   21  168-188   134-154 (225)
303 cd03217 ABC_FeS_Assembly ABC-t  64.1     4.8  0.0001   33.0   2.0   19  170-188   103-121 (200)
304 cd03290 ABCC_SUR1_N The SUR do  64.1       5 0.00011   33.1   2.1   21  168-188   137-157 (218)
305 PRK14236 phosphate transporter  64.1       5 0.00011   34.6   2.2   21  168-188   165-185 (272)
306 PRK14271 phosphate ABC transpo  63.6       5 0.00011   34.8   2.1   21  168-188   160-180 (276)
307 PRK13546 teichoic acids export  63.4     5.1 0.00011   34.8   2.1   21  168-188   140-160 (264)
308 cd03213 ABCG_EPDR ABCG transpo  63.3     5.1 0.00011   32.8   2.0   18  171-188   111-128 (194)
309 TIGR02982 heterocyst_DevA ABC   62.9     4.7  0.0001   33.4   1.7   19  170-188   140-158 (220)
310 PRK14264 phosphate ABC transpo  62.8     5.3 0.00012   35.3   2.1   21  168-188   197-217 (305)
311 PRK14260 phosphate ABC transpo  62.7     5.3 0.00011   34.1   2.1   21  168-188   147-167 (259)
312 PRK11176 lipid transporter ATP  62.6       5 0.00011   38.2   2.1   15  170-184   479-493 (582)
313 cd03222 ABC_RNaseL_inhibitor T  62.5     5.2 0.00011   32.9   1.9   17  172-188    72-88  (177)
314 CHL00131 ycf16 sulfate ABC tra  62.2     5.5 0.00012   33.6   2.0   18  171-188   151-168 (252)
315 KOG0057|consensus               61.8     4.3 9.3E-05   39.8   1.4   14  170-183   486-499 (591)
316 cd03228 ABCC_MRP_Like The MRP   61.6     5.3 0.00012   31.9   1.8   17  172-188    97-113 (171)
317 PRK14237 phosphate transporter  61.4     6.1 0.00013   34.0   2.2   21  168-188   160-180 (267)
318 cd03215 ABC_Carb_Monos_II This  61.3     5.1 0.00011   32.3   1.6   17  172-188   105-121 (182)
319 cd03216 ABC_Carb_Monos_I This   61.3     5.8 0.00012   31.6   1.9   18  171-188    82-99  (163)
320 COG5293 Predicted ATPase [Gene  61.0      85  0.0019   30.6   9.8   86   77-163   374-483 (591)
321 COG5265 ATM1 ABC-type transpor  60.9     4.4 9.6E-05   38.8   1.3   14  171-184   399-412 (497)
322 TIGR02204 MsbA_rel ABC transpo  60.8     5.5 0.00012   37.8   2.0   16  170-185   475-490 (576)
323 PRK13640 cbiO cobalt transport  60.6     6.2 0.00013   34.3   2.1   20  169-188   141-160 (282)
324 PRK13635 cbiO cobalt transport  60.6     6.2 0.00013   34.3   2.1   21  168-188   137-157 (279)
325 PF02183 HALZ:  Homeobox associ  60.5      30 0.00065   22.6   4.9   28   83-110    13-40  (45)
326 PRK14257 phosphate ABC transpo  60.3     6.2 0.00013   35.5   2.1   20  168-187   222-241 (329)
327 PRK13545 tagH teichoic acids e  60.2       6 0.00013   38.6   2.2   21  168-188   140-160 (549)
328 PRK13636 cbiO cobalt transport  60.1     6.4 0.00014   34.3   2.1   22  167-188   137-158 (283)
329 TIGR00968 3a0106s01 sulfate AB  60.0     6.2 0.00013   33.2   2.0   20  169-188   128-147 (237)
330 TIGR03796 NHPM_micro_ABC1 NHPM  59.2     5.1 0.00011   39.3   1.5   17  170-186   614-630 (710)
331 TIGR01194 cyc_pep_trnsptr cycl  58.9     5.6 0.00012   38.0   1.7   17  170-186   469-485 (555)
332 COG4136 ABC-type uncharacteriz  58.8       5 0.00011   33.9   1.2   17  167-183   130-146 (213)
333 cd03236 ABC_RNaseL_inhibitor_d  58.8     6.4 0.00014   34.0   1.9   21  168-188   136-156 (255)
334 cd03300 ABC_PotA_N PotA is an   58.6     6.8 0.00015   32.8   2.0   19  170-188   129-147 (232)
335 PRK13648 cbiO cobalt transport  58.6     7.2 0.00016   33.5   2.2   20  169-188   140-159 (269)
336 TIGR00958 3a01208 Conjugate Tr  58.3     5.2 0.00011   39.5   1.4   16  170-185   616-631 (711)
337 TIGR03415 ABC_choXWV_ATP choli  58.3     6.3 0.00014   36.5   1.9   21  168-188   161-181 (382)
338 PRK13536 nodulation factor exp  57.6     6.7 0.00014   35.5   1.9   21  168-188   169-189 (340)
339 cd03291 ABCC_CFTR1 The CFTR su  57.4     7.7 0.00017   34.1   2.2   20  169-188   157-176 (282)
340 PRK13537 nodulation ABC transp  57.3     6.7 0.00015   34.7   1.8   21  168-188   135-155 (306)
341 TIGR03797 NHPM_micro_ABC2 NHPM  57.0     5.7 0.00012   38.8   1.4   16  170-185   587-602 (686)
342 KOG0055|consensus               56.7     5.8 0.00013   42.1   1.5   14  171-184   489-502 (1228)
343 cd03241 ABC_RecN RecN ATPase i  56.6      10 0.00022   32.9   2.8   22  168-189   167-188 (276)
344 PRK14252 phosphate ABC transpo  56.4     8.3 0.00018   33.0   2.2   21  168-188   158-178 (265)
345 PF04949 Transcrip_act:  Transc  55.8      19 0.00041   29.7   4.0   69   58-126    87-156 (159)
346 COG2274 SunT ABC-type bacterio  55.7     6.3 0.00014   39.5   1.5   17  170-186   608-624 (709)
347 KOG0054|consensus               55.5     6.1 0.00013   42.5   1.4   13  171-183   643-655 (1381)
348 TIGR02857 CydD thiol reductant  55.4     6.5 0.00014   37.0   1.5   16  170-185   457-472 (529)
349 PRK14263 phosphate ABC transpo  54.9     8.9 0.00019   32.9   2.2   20  168-187   146-165 (261)
350 TIGR03522 GldA_ABC_ATP gliding  54.5     8.1 0.00018   34.0   1.9   20  168-187   130-149 (301)
351 PRK13657 cyclic beta-1,2-gluca  54.2     6.8 0.00015   37.5   1.4   15  170-184   470-484 (588)
352 COG4172 ABC-type uncharacteriz  53.9     7.9 0.00017   37.2   1.8   20  168-187   154-173 (534)
353 PTZ00265 multidrug resistance   53.8     7.2 0.00016   42.1   1.7   15  170-184  1357-1371(1466)
354 PF05377 FlaC_arch:  Flagella a  53.7      50  0.0011   22.7   5.2   40   88-128    13-52  (55)
355 COG4598 HisP ABC-type histidin  53.2     7.7 0.00017   33.7   1.4   22  168-189   149-170 (256)
356 PF12532 DUF3732:  Protein of u  52.7 1.2E+02  0.0025   25.5   8.5   72  113-191    16-91  (193)
357 PRK10790 putative multidrug tr  52.4     7.6 0.00016   37.2   1.4   15  170-184   475-489 (592)
358 KOG4253|consensus               52.4 1.4E+02   0.003   25.0   8.5   40   73-112    35-86  (175)
359 COG1245 Predicted ATPase, RNas  52.3     9.2  0.0002   37.2   1.9   20  168-187   452-471 (591)
360 COG1137 YhbG ABC-type (unclass  51.6      11 0.00024   33.0   2.2   20  169-188   137-156 (243)
361 PHA00728 hypothetical protein   51.4      38 0.00083   27.2   5.0   21  168-188    62-82  (151)
362 COG1125 OpuBA ABC-type proline  51.3     9.5  0.0002   34.5   1.7   21  168-188   132-152 (309)
363 cd07591 BAR_Rvs161p The Bin/Am  51.2      94   0.002   26.6   7.8   62   73-135     2-63  (224)
364 TIGR03375 type_I_sec_LssB type  51.1     8.2 0.00018   37.8   1.4   17  170-186   600-616 (694)
365 TIGR01193 bacteriocin_ABC ABC-  50.7     8.5 0.00018   37.8   1.5   16  170-185   610-625 (708)
366 PRK11160 cysteine/glutathione   50.6     8.5 0.00018   37.0   1.4   17  170-186   474-490 (574)
367 PLN03073 ABC transporter F fam  50.1     9.9 0.00021   38.1   1.9   22  167-188   340-361 (718)
368 PLN03232 ABC transporter C fam  50.0     8.1 0.00017   41.7   1.3   13  171-183   740-752 (1495)
369 cd03221 ABCF_EF-3 ABCF_EF-3  E  49.9      12 0.00025   29.3   1.9   17  172-188    71-87  (144)
370 TIGR01192 chvA glucan exporter  49.9      12 0.00025   36.2   2.3   18  170-187   470-487 (585)
371 TIGR01842 type_I_sec_PrtD type  49.7     9.1  0.0002   36.3   1.5   17  170-186   453-469 (544)
372 cd03288 ABCC_SUR2 The SUR doma  49.4      12 0.00027   31.8   2.1   20  169-188   154-173 (257)
373 COG4618 ArpD ABC-type protease  48.8     9.6 0.00021   37.3   1.5   14  170-183   471-484 (580)
374 PLN03130 ABC transporter C fam  48.5     9.1  0.0002   41.8   1.4   14  170-183   739-752 (1622)
375 COG1131 CcmA ABC-type multidru  48.4      12 0.00025   33.2   1.9   21  167-187   132-152 (293)
376 PF13175 AAA_15:  AAA ATPase do  47.8 1.9E+02  0.0041   25.5   9.6   26  165-190   335-360 (415)
377 TIGR00954 3a01203 Peroxysomal   47.8      12 0.00027   36.7   2.1   18  170-187   581-598 (659)
378 PF11014 DUF2852:  Protein of u  47.4      96  0.0021   24.4   6.6   42   74-117    65-107 (115)
379 PLN03211 ABC transporter G-25;  47.2      13 0.00028   36.8   2.1   20  169-188   204-223 (659)
380 TIGR00630 uvra excinuclease AB  47.1      13 0.00028   38.6   2.2   22  167-188   483-504 (924)
381 PRK14246 phosphate ABC transpo  46.7      14 0.00031   31.6   2.1   21  168-188   150-170 (257)
382 COG1117 PstB ABC-type phosphat  46.5      14  0.0003   32.7   2.0   19  170-188   148-166 (253)
383 PRK10789 putative multidrug tr  46.1      13 0.00029   35.5   2.0   18  170-187   450-467 (569)
384 PLN03232 ABC transporter C fam  46.0      13 0.00028   40.2   2.1   15  170-184  1370-1384(1495)
385 PRK10522 multidrug transporter  45.2      14 0.00031   35.0   2.1   17  170-186   448-464 (547)
386 PF03961 DUF342:  Protein of un  44.7 1.5E+02  0.0032   27.8   8.7   36   75-110   326-362 (451)
387 KOG0063|consensus               43.6      11 0.00023   36.6   0.9   20  168-187   453-472 (592)
388 cd03289 ABCC_CFTR2 The CFTR su  42.8      17 0.00037   31.9   2.0   20  169-188   136-155 (275)
389 KOG0066|consensus               42.6      13 0.00027   36.4   1.2   18  168-185   701-718 (807)
390 TIGR01846 type_I_sec_HlyB type  42.3      14 0.00029   36.3   1.4   17  170-186   592-608 (694)
391 PF05384 DegS:  Sensor protein   41.9 1.4E+02   0.003   24.6   7.1   49   79-128    24-72  (159)
392 COG4161 ArtP ABC-type arginine  41.5      14  0.0003   31.7   1.2   15  171-185   141-155 (242)
393 TIGR00957 MRP_assoc_pro multi   41.4      17 0.00036   39.4   2.1   15  170-184  1420-1434(1522)
394 PTZ00243 ABC transporter; Prov  41.2      16 0.00034   39.8   1.8   15  170-184  1444-1458(1560)
395 PF04201 TPD52:  Tumour protein  40.7 2.1E+02  0.0046   23.8   8.5   55   77-131    24-82  (162)
396 KOG0927|consensus               40.2      14 0.00031   36.4   1.2   20  167-186   505-524 (614)
397 PF02183 HALZ:  Homeobox associ  40.2   1E+02  0.0023   20.0   5.6   32   81-112     4-35  (45)
398 COG4172 ABC-type uncharacteriz  39.4      19  0.0004   34.7   1.8   24  165-188   420-443 (534)
399 PRK09343 prefoldin subunit bet  38.3 1.9E+02   0.004   22.4   7.8   44   94-138    76-119 (121)
400 KOG0064|consensus               38.1      19 0.00042   35.7   1.7   16  171-186   612-627 (728)
401 TIGR00957 MRP_assoc_pro multi   38.0      18 0.00039   39.2   1.7   17  170-186   759-775 (1522)
402 KOG2483|consensus               37.7      23  0.0005   31.0   2.0   78    5-109    60-139 (232)
403 COG4026 Uncharacterized protei  37.0 2.5E+02  0.0053   25.0   8.2   23   82-104   135-157 (290)
404 PRK00349 uvrA excinuclease ABC  36.8      21 0.00046   37.1   1.9   23  167-189   485-507 (943)
405 TIGR00955 3a01204 The Eye Pigm  36.6      23 0.00049   34.5   2.0   19  169-187   164-182 (617)
406 PF06295 DUF1043:  Protein of u  36.1 2.1E+02  0.0045   22.3   7.2   42   94-135    30-74  (128)
407 PF06013 WXG100:  Proteins of 1  35.9 1.3E+02  0.0029   20.0   6.5   59   76-134     4-67  (86)
408 PRK05771 V-type ATP synthase s  35.8 2.4E+02  0.0051   27.8   8.9   48   79-126   212-259 (646)
409 TIGR01271 CFTR_protein cystic   35.3      23  0.0005   38.4   1.9   15  170-184  1352-1366(1490)
410 cd03227 ABC_Class2 ABC-type Cl  35.0      31 0.00067   27.3   2.2   21  170-190    76-96  (162)
411 PTZ00265 multidrug resistance   35.0      21 0.00046   38.7   1.6   20  168-187   576-595 (1466)
412 TIGR00956 3a01205 Pleiotropic   34.9      24 0.00052   38.0   2.0   21  168-188   206-226 (1394)
413 PRK00349 uvrA excinuclease ABC  34.5      26 0.00057   36.4   2.1   22  167-188   826-847 (943)
414 PF11172 DUF2959:  Protein of u  34.1 2.8E+02   0.006   23.9   7.9   42   74-115    55-97  (201)
415 TIGR00630 uvra excinuclease AB  34.1      27 0.00058   36.3   2.1   22  167-188   824-845 (924)
416 COG4175 ProV ABC-type proline/  33.8      28  0.0006   32.5   1.9   21  167-187   160-180 (386)
417 COG4988 CydD ABC-type transpor  33.8      22 0.00049   34.9   1.4   16  170-185   455-470 (559)
418 PF08946 Osmo_CC:  Osmosensory   33.7   1E+02  0.0023   20.4   4.1   28   87-114    10-37  (46)
419 COG4525 TauB ABC-type taurine   33.6      26 0.00057   30.8   1.7   22  167-188   128-149 (259)
420 TIGR02680 conserved hypothetic  33.4      30 0.00065   37.2   2.4   20  168-187  1244-1263(1353)
421 TIGR03642 cas_csx13 CRISPR-ass  33.4      31 0.00067   27.3   2.0   13  171-183    96-108 (124)
422 COG4987 CydC ABC-type transpor  33.4      28 0.00061   34.2   2.0   17  170-186   473-489 (573)
423 PF07526 POX:  Associated with   33.4 1.9E+02  0.0041   23.2   6.5   46   90-140    71-116 (140)
424 cd07599 BAR_Rvs167p The Bin/Am  33.2 2.7E+02  0.0058   23.2   7.8   52   82-134     2-53  (216)
425 PLN03130 ABC transporter C fam  33.2      22 0.00048   38.9   1.4   15  170-184  1373-1387(1622)
426 PF05377 FlaC_arch:  Flagella a  32.6 1.7E+02  0.0036   20.1   6.1   36   92-128     3-38  (55)
427 PF07673 DUF1602:  Protein of u  32.6      16 0.00035   23.4   0.2   11   15-25     13-23  (39)
428 PRK14127 cell division protein  32.6 1.3E+02  0.0028   23.3   5.2   38   75-112    22-60  (109)
429 PF04977 DivIC:  Septum formati  31.7 1.7E+02  0.0037   19.9   5.7   32   82-113    17-48  (80)
430 PHA03041 virion core protein;   31.5 2.2E+02  0.0048   23.4   6.6   47   81-127    99-145 (153)
431 PTZ00243 ABC transporter; Prov  31.5      32 0.00069   37.6   2.3   19  169-187   780-798 (1560)
432 PF06193 Orthopox_A5L:  Orthopo  31.3 3.1E+02  0.0068   22.9   7.8   49   80-128   112-160 (166)
433 TIGR01257 rim_protein retinal-  30.9      28 0.00062   39.5   1.8   23  166-188  1056-1078(2272)
434 COG1245 Predicted ATPase, RNas  30.8      30 0.00066   33.8   1.8   20  167-186   209-228 (591)
435 PF10073 DUF2312:  Uncharacteri  30.7 1.9E+02  0.0041   21.1   5.5   33   80-112     2-34  (74)
436 KOG3856|consensus               30.7 1.2E+02  0.0026   24.3   4.9   37   78-114     6-42  (135)
437 PF04111 APG6:  Autophagy prote  30.2 3.7E+02   0.008   24.2   8.6   17  180-196   241-257 (314)
438 PRK13694 hypothetical protein;  29.8   2E+02  0.0044   21.4   5.6   35   78-112     8-42  (83)
439 TIGR01271 CFTR_protein cystic   29.3      36 0.00079   36.9   2.2   18  170-187   547-564 (1490)
440 PF10079 DUF2317:  Uncharacteri  29.2 3.4E+02  0.0073   26.6   8.6   42   98-139   461-502 (542)
441 cd08327 CARD_RAIDD Caspase act  29.1 2.5E+02  0.0053   21.0   6.9   28    6-33      3-30  (94)
442 KOG0060|consensus               29.0      32 0.00068   34.3   1.6   16  171-186   570-585 (659)
443 smart00574 POX domain associat  27.1 2.9E+02  0.0062   22.5   6.5   44   92-140    73-116 (140)
444 COG0178 UvrA Excinuclease ATPa  27.1 1.3E+02  0.0027   31.5   5.4   61  100-185   433-495 (935)
445 PRK12765 flagellar capping pro  26.5 2.9E+02  0.0063   27.3   7.7   46   85-130   535-583 (595)
446 PHA01750 hypothetical protein   26.5 1.9E+02  0.0041   20.8   4.8   11   99-109    45-55  (75)
447 COG3750 Uncharacterized protei  26.4 2.6E+02  0.0055   20.8   5.6   32   79-110    11-42  (85)
448 COG4778 PhnL ABC-type phosphon  26.3      23  0.0005   30.5   0.1   18  170-187   151-168 (235)
449 PLN03140 ABC transporter G fam  26.0      44 0.00094   36.4   2.1   19  170-188  1018-1036(1470)
450 PF06005 DUF904:  Protein of un  24.9 2.6E+02  0.0057   19.9   9.0   19   79-97     15-33  (72)
451 PRK10535 macrolide transporter  24.8      49  0.0011   32.5   2.1   19  170-188   143-161 (648)
452 COG4178 ABC-type uncharacteriz  24.6      45 0.00098   33.1   1.8   16  171-186   515-530 (604)
453 TIGR02584 cas_NE0113 CRISPR-as  24.5      57  0.0012   28.2   2.2   14  171-184   124-137 (209)
454 KOG4010|consensus               24.0 3.1E+02  0.0068   23.6   6.4  100   80-186    42-145 (208)
455 PF09623 Cas_NE0113:  CRISPR-as  23.4      57  0.0012   28.3   2.0   15  171-185   118-132 (224)
456 PHA02109 hypothetical protein   23.4 2.6E+02  0.0056   23.9   5.8   58   60-117   166-228 (233)
457 PRK00888 ftsB cell division pr  23.2 3.4E+02  0.0073   20.5   8.6   31   82-112    27-57  (105)
458 PF03904 DUF334:  Domain of unk  23.2 3.4E+02  0.0074   23.9   6.7   74   33-107     8-82  (230)
459 PF08663 HalX:  HalX domain;  I  22.6 1.3E+02  0.0028   21.5   3.4   25   81-105    35-59  (71)
460 PF10046 BLOC1_2:  Biogenesis o  22.5 3.3E+02  0.0071   20.2   6.1   27   73-99     26-52  (99)
461 PF10234 Cluap1:  Clusterin-ass  22.5 5.6E+02   0.012   22.9   8.2   23  113-135   220-242 (267)
462 PRK00635 excinuclease ABC subu  22.1      53  0.0011   36.7   1.9   22  167-188   472-493 (1809)
463 PRK10803 tol-pal system protei  21.9 1.9E+02  0.0041   25.3   5.0   51   65-115    40-94  (263)
464 TIGR01257 rim_protein retinal-  21.8      54  0.0012   37.4   1.9   19  169-187  2068-2086(2272)
465 PF08580 KAR9:  Yeast cortical   21.8 4.1E+02  0.0088   26.9   7.8   48   87-134   240-288 (683)
466 PRK15326 type III secretion sy  21.6 3.4E+02  0.0073   20.0   6.2   40   73-112    36-75  (80)
467 PRK00635 excinuclease ABC subu  21.4      59  0.0013   36.3   2.1   21  167-187   805-825 (1809)
468 KOG4025|consensus               21.3 1.9E+02  0.0042   24.5   4.6   28  117-144   159-186 (207)
469 KOG0061|consensus               21.3      53  0.0011   32.3   1.6   17  170-186   169-185 (613)
470 PF06705 SF-assemblin:  SF-asse  21.3 5.2E+02   0.011   22.0   7.8   44   86-129    89-132 (247)
471 PF09178 DUF1945:  Domain of un  20.9      47   0.001   22.3   0.8   16  161-176    20-35  (51)
472 PF04568 IATP:  Mitochondrial A  20.8 2.9E+02  0.0062   21.1   5.2   23   89-111    72-98  (100)
473 PF15079 DUF4546:  Domain of un  20.5 3.6E+02  0.0079   22.9   6.1   21  114-134    85-105 (205)
474 PRK03947 prefoldin subunit alp  20.4 3.7E+02   0.008   20.8   6.0   31   82-112     6-36  (140)
475 COG1422 Predicted membrane pro  20.3 5.6E+02   0.012   22.0   8.0   28  102-129    97-124 (201)
476 COG1127 Ttg2A ABC-type transpo  20.0      67  0.0015   28.7   1.8   21  168-188   142-162 (263)

No 1  
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]
Probab=99.95  E-value=3.7e-28  Score=246.20  Aligned_cols=136  Identities=28%  Similarity=0.449  Sum_probs=124.7

Q ss_pred             CCCCCCccchh-hhhcCCCCchhHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         59 KWRSPVSGSDV-TAAVRPTPELPVRDYAKRSKEMQAVLAT-------LNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQEC  130 (199)
Q Consensus        59 ~lr~~~~~i~~-l~~~~~vN~~ai~ey~e~~er~e~L~~e-------~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~i  130 (199)
                      .|+..+..+.. +..+|+||+.|+++|++..++|++|..+       +++|.+.|++++++++.+|+.+|+.||.+|+.+
T Consensus       946 ~~~~~i~~le~~i~~lg~VN~~Aiee~e~~~~r~~~l~~~~~dl~~a~~~l~~~i~~~d~~~~~~f~~~f~~In~~F~~i 1025 (1163)
T COG1196         946 ELEREIERLEEEIEALGPVNLRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKRERFKETFDKINENFSEI 1025 (1163)
T ss_pred             HHHHHHHHHHHHHHhccCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            56666666655 5779999999999999999888876655       457888999999999999999999999999999


Q ss_pred             HhhhcCCceEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHhcHh
Q psy12760        131 YQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLW  194 (199)
Q Consensus       131 F~~L~~gG~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~~~  194 (199)
                      |+.|++||+|+|.+.+++|||++||+|.|+||||.+++++.|||||||++|||||||||+|+|-
T Consensus      1026 f~~L~~GG~a~L~l~~~dd~l~~Giei~a~ppgK~~~~l~~LSGGEKsLtAlAllFAi~~~~Pa 1089 (1163)
T COG1196        1026 FKELFGGGTAELELTEPDDPLTAGIEISARPPGKKLQSLSLLSGGEKSLTALALLFAIQKYRPA 1089 (1163)
T ss_pred             HHHhCCCCeeEEEeCCCCchhhcCcEEEEECCCCCccchhhcCCcHHHHHHHHHHHHHHhhCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999993


No 2  
>KOG0996|consensus
Probab=99.88  E-value=2.7e-22  Score=199.22  Aligned_cols=122  Identities=42%  Similarity=0.671  Sum_probs=112.8

Q ss_pred             cCCCCchhHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCceEEEEec
Q psy12760         73 VRPTPELPVRDYAKRSK-------EMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYK  145 (199)
Q Consensus        73 ~~~vN~~ai~ey~e~~e-------r~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~~gG~a~L~l~  145 (199)
                      ++.+|..++.+|....+       +++.....+++.++.+++|+++|.+.|+..|.-|+.++.++|++++.||+|+|++.
T Consensus      1090 l~~vd~~~i~eY~~k~~~y~~rv~~l~~~t~kr~~~re~l~~Lrk~RldEFm~gf~~Is~kLkemYQmIT~GGdAeLElV 1169 (1293)
T KOG0996|consen 1090 LREVDLGVIAEYAKKVELYLKRVAELEKFTQKRDEHREKLEELRKRRLDEFMAGFNIISMKLKEMYQMITLGGDAELELV 1169 (1293)
T ss_pred             hcCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcceeEee
Confidence            77888889888876654       44445567788999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHhcHh
Q psy12760        146 EYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLW  194 (199)
Q Consensus       146 ~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~~~  194 (199)
                      +..|||..||.+.|+||.|.|+.+..|||||||+++|||+|||++|+|-
T Consensus      1170 DslDPFseGV~FSVrPpKKSWK~I~NLSGGEKTLSSLALVFALH~YkPT 1218 (1293)
T KOG0996|consen 1170 DSLDPFSEGVMFSVRPPKKSWKNISNLSGGEKTLSSLALVFALHHYKPT 1218 (1293)
T ss_pred             ccCCCcccCceEEeeCchhhhhhcccCCcchhHHHHHHHHHHHHccCCC
Confidence            9999999999999999999999999999999999999999999999993


No 3  
>KOG0018|consensus
Probab=99.88  E-value=2e-22  Score=198.99  Aligned_cols=124  Identities=30%  Similarity=0.475  Sum_probs=112.5

Q ss_pred             hhhcCCCCchhHHHH-----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcC-CceEEEE
Q psy12760         70 TAAVRPTPELPVRDY-----AKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTF-GGKADLE  143 (199)
Q Consensus        70 l~~~~~vN~~ai~ey-----~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~~-gG~a~L~  143 (199)
                      +.++ .-|..|++.|     ++..++++.++++.+.++..+.+++++|..+|++||++|+.+++.||+.|++ -|.|+|.
T Consensus       945 l~~~-~Pn~kA~~~~d~v~~~~~~~EfE~ark~ak~ak~~F~~VK~~R~~~F~~~F~~va~~Id~IYK~Ltnt~g~AyL~ 1023 (1141)
T KOG0018|consen  945 LNRI-APNLKALERLDEVRFQEINEEFEAARKEAKKAKNAFNKVKKKRYERFMACFEHVADNIDRIYKELTNTEGQAYLG 1023 (1141)
T ss_pred             HHHh-CcchHHHhhhhhHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccceeec
Confidence            4456 5566776655     5566788889999999999999999999999999999999999999999983 3899999


Q ss_pred             eccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHhcHh
Q psy12760        144 YKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWLW  194 (199)
Q Consensus       144 l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~~~  194 (199)
                      ++|+++||..||.+.++||||+.++++.|||||||++||||+||++.|+|-
T Consensus      1024 ~en~~EPyl~GIky~~~pP~KRFr~m~~LSGGEKTvAaLALLFaihsy~Pa 1074 (1141)
T KOG0018|consen 1024 LENPEEPYLDGIKYHCMPPGKRFRPMDNLSGGEKTVAALALLFAIHSYKPA 1074 (1141)
T ss_pred             CCCCCcchhcCccccccCCccccCchhhcCccHHHHHHHHHHHHhccCCCC
Confidence            999999999999999999999999999999999999999999999999883


No 4  
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.
Probab=99.85  E-value=9.4e-21  Score=188.30  Aligned_cols=135  Identities=23%  Similarity=0.448  Sum_probs=119.6

Q ss_pred             CCCCCCCccchh-hhhcCCCCchhHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         58 SKWRSPVSGSDV-TAAVRPTPELPVRDYAKRSKEMQAVL-------ATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQE  129 (199)
Q Consensus        58 ~~lr~~~~~i~~-l~~~~~vN~~ai~ey~e~~er~e~L~-------~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~  129 (199)
                      ..++..++++.. +..++++|..|+++|+++.++|+.+.       ..++.+.+.|+.|++++...|..+|+.|+.+|+.
T Consensus       954 ~~l~~~l~~l~~~i~~l~~vN~~Ai~~~~~~~~~~~~l~~q~~dl~~~~~~l~~~i~~l~~~~~~~f~~~f~~~~~~f~~ 1033 (1164)
T TIGR02169       954 EDVQAELQRVEEEIRALEPVNMLAIQEYEEVLKRLDELKEKRAKLEEERKAILERIEEYEKKKREVFMEAFEAINENFNE 1033 (1164)
T ss_pred             HHHHHHHHHHHHHHHHcCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344444555544 66799999999999999888766655       5556788899999999999999999999999999


Q ss_pred             HHhhhcCCceEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHhcH
Q psy12760        130 CYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWL  193 (199)
Q Consensus       130 iF~~L~~gG~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~~  193 (199)
                      +|+.|+ ||.|.|.+++++||+..||.|.|.|||+...++..||||||++++||++||+|.++|
T Consensus      1034 ~~~~l~-~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lSgge~~~~~la~~~~~~~~~~ 1096 (1164)
T TIGR02169      1034 IFAELS-GGTGELILENPDDPFAGGLELSAKPKGKPVQRLEAMSGGEKSLTALSFIFAIQRYKP 1096 (1164)
T ss_pred             HHHHHh-CCeEEEEecCCCCcccCCeEEEEEcCCCCCCcchhcCcchHHHHHHHHHHHHHhcCC
Confidence            999999 999999999999999999999999999988899999999999999999999998877


No 5  
>KOG0964|consensus
Probab=99.78  E-value=9e-19  Score=172.06  Aligned_cols=125  Identities=19%  Similarity=0.231  Sum_probs=103.9

Q ss_pred             hhhcCCCCchhHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCceEEE
Q psy12760         70 TAAVRPTPELPVRDYAKRSKEMQ-------AVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADL  142 (199)
Q Consensus        70 l~~~~~vN~~ai~ey~e~~er~e-------~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~~gG~a~L  142 (199)
                      +..+++||..|+++|....++.+       +|....++|.+.|..|++++.++...+|.+|.++|+++|+.|.|||.|.|
T Consensus       965 lk~ys~VNKkAldQf~nfseQre~L~~R~eELd~s~~sI~eLi~vLdqrK~eai~~TFkqV~knFsevF~~LVp~G~a~i 1044 (1200)
T KOG0964|consen  965 LKGYSNVNKKALDQFVNFSEQRESLKKRQEELDRSKDSILELITVLDQRKYEAIDLTFKQVKKNFSEVFSRLVPGGTALI 1044 (1200)
T ss_pred             HhhcchhhHHHHHHHHHHHHHHHHHHHHHHHhccchhHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHhCCCCceee
Confidence            44589999999999976655554       45555678999999999999999999999999999999999999999976


Q ss_pred             EeccCC--------CC-C-------------CcceEEEEECCCC--cccccccCCcchHHHHHHHHHHHHHHhcHh
Q psy12760        143 EYKEYS--------DP-Y-------------AQGIKYVVRPPRK--SWKSIDCLSGGEKTLASLALVFALHYYWLW  194 (199)
Q Consensus       143 ~l~~~e--------dp-~-------------~~GI~I~V~p~gk--~~~~l~~LSGGEKSlaaLalIfAL~~~~~~  194 (199)
                      .+...+        |. .             ..||.|+|.|.++  ....+.+|||||||++|||||||+|++.|-
T Consensus      1045 im~k~d~~~d~~e~d~~~~~~s~~~~~sv~~ytGIsI~VSFnskq~E~~~m~QLSGGQKsvvALaLIFaIQrcDPA 1120 (1200)
T KOG0964|consen 1045 IMRKRDNANDHDEDDGDMDGESNEGKDSVEMYTGISIKVSFNSKQGETLEMEQLSGGQKSVVALALIFAIQRCDPA 1120 (1200)
T ss_pred             hhhccccccccccccccccccccccccchhhccceeEEEEeecCccHHHHHHHhcCchHHHHHHHHHHHHHhcCCc
Confidence            653211        11 1             2489999999864  456888999999999999999999999984


No 6  
>KOG0933|consensus
Probab=99.73  E-value=7.7e-18  Score=165.99  Aligned_cols=113  Identities=20%  Similarity=0.221  Sum_probs=99.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCceEEEEeccCCCCCCcceEEEEE
Q psy12760         81 VRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVR  160 (199)
Q Consensus        81 i~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~~gG~a~L~l~~~edp~~~GI~I~V~  160 (199)
                      .+.|.+++.+.+.+...+.+|++.|+.+|+++++.+..++.+||..|..||+.|+||..|+|...+..+ +..|++++|.
T Consensus       993 E~~~~~lk~k~~~Ie~Dk~kI~ktI~~lDe~k~~~L~kaw~~VN~dFG~IFs~LLPga~AkL~Ppeg~~-~~dGLEvkV~ 1071 (1174)
T KOG0933|consen  993 EEKEAALKTKKEIIEKDKSKIKKTIEKLDEKKREELNKAWEKVNKDFGSIFSTLLPGAMAKLEPPEGKT-VLDGLEVKVK 1071 (1174)
T ss_pred             HHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHhCCCccccccCCCCCc-cccceEEEEE
Confidence            345555666666677777799999999999999999999999999999999999999999998776655 5669999999


Q ss_pred             CCCCcccccccCCcchHHHHHHHHHHHHHHhcHh
Q psy12760        161 PPRKSWKSIDCLSGGEKTLASLALVFALHYYWLW  194 (199)
Q Consensus       161 p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~~~  194 (199)
                      ++|-...++..|||||||++||||||||..|+|-
T Consensus      1072 ~G~iWKeSL~ELSGGQRSLVALsLIlamL~fkPA 1105 (1174)
T KOG0933|consen 1072 FGGIWKESLSELSGGQRSLVALSLILAMLKFKPA 1105 (1174)
T ss_pred             eCccHHHHHHHhcCchHHHHHHHHHHHHHcCCCC
Confidence            9877778999999999999999999999999994


No 7  
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle.
Probab=99.71  E-value=1.7e-16  Score=157.18  Aligned_cols=125  Identities=24%  Similarity=0.319  Sum_probs=115.6

Q ss_pred             hhhhcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHhhhc----CCceEE
Q psy12760         69 VTAAVRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEF---DTNFVKIGKRVQECYQMLT----FGGKAD  141 (199)
Q Consensus        69 ~l~~~~~vN~~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F---~~~f~~In~~fs~iF~~L~----~gG~a~  141 (199)
                      .++.++++|+.|++.|..+..++++|..+++.+.+.|.++++....+|   ..+|..|+.+|+.+|..||    +||.+.
T Consensus       980 aiee~~~~~~~a~er~~~l~~q~~dL~~~~~~L~~~i~~i~~~~~~~f~~~~~~F~~v~~~f~~~F~~lf~~~~~~~~~~ 1059 (1179)
T TIGR02168       980 KIKELGPVNLAAIEEYEELKERYDFLTAQKEDLTEAKETLEEAIEEIDREARERFKDTFDQVNENFQRVFPKLFGGGEAE 1059 (1179)
T ss_pred             HHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCeEE
Confidence            355688999999999999999999999999999999999999999999   9999999999997777776    799999


Q ss_pred             EEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHhcH
Q psy12760        142 LEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYWL  193 (199)
Q Consensus       142 L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~~  193 (199)
                      |.+++++|||..|+.|.|.|+++....+..||||||+++++|++||++.+.|
T Consensus      1060 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lS~g~~~~~~l~~~~~~~~~~~ 1111 (1179)
T TIGR02168      1060 LRLTDPEDLLEAGIEIFAQPPGKKNQNLSLLSGGEKALTALALLFAIFKVKP 1111 (1179)
T ss_pred             EEeCCCCcccccCceEEEeCCCCccccccccCccHHHHHHHHHHHHHHccCC
Confidence            9999999999999999999999888899999999999999999999987776


No 8  
>KOG0979|consensus
Probab=99.65  E-value=1.7e-15  Score=149.77  Aligned_cols=165  Identities=18%  Similarity=0.200  Sum_probs=130.2

Q ss_pred             hhhhhhhccc-cchhhHHHHHhHhhhccCCcccccCCCCCCC------C--CCCCCCCCCccchh--------hhhcCCC
Q psy12760         14 KKRRAIVTRP-CSITSWMAVLSISDILSNSSIHTTPRSANTM------A--PASKWRSPVSGSDV--------TAAVRPT   76 (199)
Q Consensus        14 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~------~--p~~~lr~~~~~i~~--------l~~~~~v   76 (199)
                      +|--|--+++ |++.+|+-+              +|.++...      +  ....+++..++++.        ..++-.+
T Consensus       792 ~k~~a~~~~~~~~~~t~~~~--------------~~s~~~~~~ek~~~~~~e~~e~p~t~~eld~~I~~e~t~~~~~~n~  857 (1072)
T KOG0979|consen  792 KKKEAAEKRKEQSLQTLKRE--------------IMSPATNKIEKSLVLMKELAEEPTTMDELDQAITDELTRALKFENV  857 (1072)
T ss_pred             HHHHHHhcccchhHHHhhhc--------------cccccccchhhHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHHhcC
Confidence            3444556777 999999753              23333333      1  12556666666644        2237789


Q ss_pred             CchhHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCceEEEEeccCCC
Q psy12760         77 PELPVRDYAKRSKEMQAVLAT-------LNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSD  149 (199)
Q Consensus        77 N~~ai~ey~e~~er~e~L~~e-------~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~~gG~a~L~l~~~ed  149 (199)
                      |..++++|+.+.+++..|...       ++.+++.+.++++.|.+.+.+.+.+||.+|+++|+.+.+.|++.|.. ++.|
T Consensus       858 ne~~vq~y~~r~~el~~l~~~~~~~~~~le~i~~kl~~~ke~w~~~le~~V~~In~~Fs~~F~~mg~aGeV~L~~-~~~D  936 (1072)
T KOG0979|consen  858 NEDAVQQYEVREDELRELETKLEKLSEDLERIKDKLSDVKEVWLPKLEEMVEQINERFSQLFSSMGCAGEVSLEV-NPLD  936 (1072)
T ss_pred             ChHHHHHHHHHHHHHHHHHhhhhhhhhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHhhcccCceEEecc-Cccc
Confidence            999999999999888887655       45788899999999999999999999999999999999999999975 6777


Q ss_pred             CCCcceEEEEECC-CCccccc--ccCCcchHHHHHHHHHHHHHHhcH
Q psy12760        150 PYAQGIKYVVRPP-RKSWKSI--DCLSGGEKTLASLALVFALHYYWL  193 (199)
Q Consensus       150 p~~~GI~I~V~p~-gk~~~~l--~~LSGGEKSlaaLalIfAL~~~~~  193 (199)
                      .-..||.|.|+|+ +..++.+  +.+||||||++++-|++|||.+.|
T Consensus       937 ydkwgI~ImVkFR~s~~L~~L~sh~QSGGERSVSTiLYLlALQ~l~~  983 (1072)
T KOG0979|consen  937 YDKWGIMIMVKFRDSEGLKVLDSHRQSGGERSVSTILYLLALQELTP  983 (1072)
T ss_pred             HhHhceEEEEEEccCcccccccccccCCcchHHHHHHHHHHHhhccC
Confidence            6667999999999 4456555  579999999999999999999987


No 9  
>KOG0250|consensus
Probab=98.54  E-value=5.4e-07  Score=90.99  Aligned_cols=78  Identities=21%  Similarity=0.355  Sum_probs=57.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhc--CCceEEEEeccCCCCCCcceEEEE-ECCC-Cc--ccccccCCcchHHHHHHHH
Q psy12760        111 KRQKEFDTNFVKIGKRVQECYQMLT--FGGKADLEYKEYSDPYAQGIKYVV-RPPR-KS--WKSIDCLSGGEKTLASLAL  184 (199)
Q Consensus       111 kr~~~F~~~f~~In~~fs~iF~~L~--~gG~a~L~l~~~edp~~~GI~I~V-~p~g-k~--~~~l~~LSGGEKSlaaLal  184 (199)
                      .|...|...=..++......|..++  .|.++.+..++++.    .++|.| .|++ +.  ..+++.|||||||++++||
T Consensus       927 ~R~~~~qk~r~~~~~~~~~~F~~~l~~R~~sg~l~~~~e~k----tl~i~v~~~~~~~~~~v~d~~gLSGGERSFsTv~l 1002 (1074)
T KOG0250|consen  927 SREQKYQKFRKLLTRRATEEFDALLGKRGFSGKLEFDHEEK----TLSISVKLPTSGNEKAVRDTRGLSGGERSFSTVCL 1002 (1074)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhccccCcceeeccccc----ccchhhccCCCCcccccccccccCcccchHHHHHH
Confidence            3344444455556666667788887  56678898887664    567777 5553 33  6788999999999999999


Q ss_pred             HHHHHHhc
Q psy12760        185 VFALHYYW  192 (199)
Q Consensus       185 IfAL~~~~  192 (199)
                      ++|||...
T Consensus      1003 llsLW~~m 1010 (1074)
T KOG0250|consen 1003 LLSLWEVM 1010 (1074)
T ss_pred             HHHHhHhh
Confidence            99999864


No 10 
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD. This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndD is described as a putative ATPase. The small number of examples known so far include species from among the Firmicutes, Actinomycetes, Proteobacteria, and Cyanobacteria.
Probab=98.08  E-value=7.6e-05  Score=72.62  Aligned_cols=69  Identities=13%  Similarity=0.205  Sum_probs=47.2

Q ss_pred             HHHHHHHHHHHHHHhhhcCCc--eEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHhc
Q psy12760        118 TNFVKIGKRVQECYQMLTFGG--KADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYW  192 (199)
Q Consensus       118 ~~f~~In~~fs~iF~~L~~gG--~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~  192 (199)
                      .....+...++.+|+.|....  ...+.++. +     ...+.+.-+++...+...||||||++.++||++||.++.
T Consensus       502 ~~~~~le~~~~~~f~~l~~k~~~~~~v~id~-~-----~~~~~l~~~~g~~~~~~~lS~Ge~~~~~la~~~al~~~~  572 (650)
T TIGR03185       502 RKLQQLEEEITKSFKKLMRKHNLISRLKIDP-E-----TFAVSLYDNNGKHIDKERLSAGERQILAIALLWGLAKVS  572 (650)
T ss_pred             HHHHHHHHHHHHHHHHHhcccCceeEEEEcC-C-----ceeEEEEcCCCCCcCCCCCCHHHHHHHHHHHHHHHHHhc
Confidence            345567788889999998532  24455432 2     233444443344557889999999999999999998753


No 11 
>PRK03918 chromosome segregation protein; Provisional
Probab=98.07  E-value=0.0001  Score=73.08  Aligned_cols=70  Identities=27%  Similarity=0.387  Sum_probs=49.6

Q ss_pred             HHHHHHHHHHHHHHHhhhcCCceEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHh
Q psy12760        117 DTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYY  191 (199)
Q Consensus       117 ~~~f~~In~~fs~iF~~L~~gG~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~  191 (199)
                      ..+++.|+..++.+|+.+..|+...+.+..++    ..+.+.+..+| ...++..|||||+..++||+.+||..+
T Consensus       739 ~~~~~~l~~~~~~if~~l~~~~~~~~~l~~~~----~~~~i~~l~~g-~~~~~~~lS~G~~~~~~la~rlal~~~  808 (880)
T PRK03918        739 ERALSKVGEIASEIFEELTEGKYSGVRVKAEE----NKVKLFVVYQG-KERPLTFLSGGERIALGLAFRLALSLY  808 (880)
T ss_pred             HHHHHHHHHHHHHHHHHHcCCCeeEEEEecCC----CceEEEEeCCC-CcCChhhCCHhHHHHHHHHHHHHHHHH
Confidence            34677888888999999986554444543221    24566665544 345778999999999999998887644


No 12 
>PRK02224 chromosome segregation protein; Provisional
Probab=98.03  E-value=0.00011  Score=73.11  Aligned_cols=66  Identities=18%  Similarity=0.290  Sum_probs=47.3

Q ss_pred             HHHHHHHHHHHHHhhhcCC-ceEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHh
Q psy12760        119 NFVKIGKRVQECYQMLTFG-GKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYY  191 (199)
Q Consensus       119 ~f~~In~~fs~iF~~L~~g-G~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~  191 (199)
                      ....+...|+.+|+.++.+ +...|.+++  +   .+|.+ +.++|+. .++..||||||...+|||.+|+..+
T Consensus       735 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~~--~---~~i~~-~~~~g~~-~~~~~lS~G~~~~~~lalr~a~~~~  801 (880)
T PRK02224        735 NVETLERMLNETFDLVYQNDAYSHIELDG--E---YELTV-YQKDGEP-LEPEQLSGGERALFNLSLRCAIYRL  801 (880)
T ss_pred             HHHHHHHHHHHHHHHHcCCCCeeEEEecC--C---cceee-eCCCCCc-cChhhcCccHHHHHHHHHHHHHHHH
Confidence            3566777899999988754 456776632  2   25554 3445544 3668999999999999999998764


No 13 
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=97.80  E-value=0.00016  Score=72.80  Aligned_cols=77  Identities=31%  Similarity=0.345  Sum_probs=53.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcCCceEEEE-eccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHH
Q psy12760        112 RQKEFDTNFVKIGKRVQECYQMLTFGGKADLE-YKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       112 r~~~F~~~f~~In~~fs~iF~~L~~gG~a~L~-l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~  190 (199)
                      +...+....+.+...++.+|..+..++. .+. .....+ ...|..+.|.-++. +.++..|||||+.+++|||-+||..
T Consensus       758 ~~~~~~~~~~~i~~~~~~~l~~~~~~~~-~~~~~~~~~~-~~~~~~~~~~~~~~-~r~~~~LSGGE~~~~sLalrLALs~  834 (908)
T COG0419         758 RADILRNLLAQIEAEANEILSKLSLNRY-DLRRLTIRKD-GNGGLVVVVYDGGE-VRPIKTLSGGERFLASLALRLALSD  834 (908)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcccH-HHHHHHHHhc-cccceEEEEecCCC-ccccccCCchHHHHHHHHHHHHHHH
Confidence            4666777888899999999999986543 221 001111 11145555554444 7899999999999999999999987


Q ss_pred             h
Q psy12760        191 Y  191 (199)
Q Consensus       191 ~  191 (199)
                      +
T Consensus       835 ~  835 (908)
T COG0419         835 L  835 (908)
T ss_pred             H
Confidence            5


No 14 
>PRK10869 recombination and repair protein; Provisional
Probab=97.77  E-value=0.00048  Score=66.24  Aligned_cols=72  Identities=22%  Similarity=0.273  Sum_probs=45.8

Q ss_pred             HHHHHHHHHHHHHhhhc-CCceEEEEeccCCCC-CC---cceEEEEEC-CCCcccccc-cCCcchHHHHHHHHHHHHHH
Q psy12760        119 NFVKIGKRVQECYQMLT-FGGKADLEYKEYSDP-YA---QGIKYVVRP-PRKSWKSID-CLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       119 ~f~~In~~fs~iF~~L~-~gG~a~L~l~~~edp-~~---~GI~I~V~p-~gk~~~~l~-~LSGGEKSlaaLalIfAL~~  190 (199)
                      +...+.+.+....+.|. +++...+.+.....+ ..   ..|++.+.+ ||...+++. .+||||+++++||+.+++..
T Consensus       371 aA~~l~~~v~~~L~~L~m~~a~f~v~~~~~~~~~~~~G~d~veF~~~~n~g~~~~pL~k~lSgGe~~Ri~LA~~~~~~~  449 (553)
T PRK10869        371 YAKELAQLITESMHELSMPHGKFTIDVKFDPEHLSADGADRIEFRVTTNPGQPLQPIAKVASGGELSRIALAIQVITAR  449 (553)
T ss_pred             HHHHHHHHHHHHHHHcCCCCcEEEEEEecCCCCCCCCCceEEEEEEecCCCCCcchhhhhCCHHHHHHHHHHHHHHhcc
Confidence            33444444444445554 455555555322211 12   358888886 477888874 79999999999999999864


No 15 
>TIGR00634 recN DNA repair protein RecN. All proteins in this family for which functions are known are ATP binding proteins involved in the initiation of recombination and recombinational repair.
Probab=97.58  E-value=0.0015  Score=62.62  Aligned_cols=37  Identities=24%  Similarity=0.361  Sum_probs=30.8

Q ss_pred             ceEEEEEC-CCCccccc-ccCCcchHHHHHHHHHHHHHH
Q psy12760        154 GIKYVVRP-PRKSWKSI-DCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       154 GI~I~V~p-~gk~~~~l-~~LSGGEKSlaaLalIfAL~~  190 (199)
                      .|++.+.+ ||...+++ ..+||||++++++|..+++..
T Consensus       421 ~v~f~~~~n~g~~~~pl~~~lSgGe~~rv~la~~l~~~~  459 (563)
T TIGR00634       421 QVEFLFSANTGEPVKPLAKVASGGELSRVMLALKVVLSS  459 (563)
T ss_pred             EEEEEEecCCCCCCCChhhhcCHhHHHHHHHHHHHhhCC
Confidence            48888877 58777877 589999999999998888753


No 16 
>PF02463 SMC_N:  RecF/RecN/SMC N terminal domain;  InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []. The domain is also found in RecF and RecN proteins, which are involved in DNA metabolism and recombination.; PDB: 3HTK_A 1W1W_C 2WD5_A 3L51_A 1XEW_Y 3KTA_B 3NWC_B 1XEX_A 1GXL_C 1GXK_A ....
Probab=97.06  E-value=0.00031  Score=58.41  Aligned_cols=24  Identities=54%  Similarity=0.706  Sum_probs=20.3

Q ss_pred             cCCcchHHHHHHHHHHHHHHhcHh
Q psy12760        171 CLSGGEKTLASLALVFALHYYWLW  194 (199)
Q Consensus       171 ~LSGGEKSlaaLalIfAL~~~~~~  194 (199)
                      .||||||++++|||+||++++.|.
T Consensus       136 ~lSgGEk~~~~Lal~lA~~~~~~~  159 (220)
T PF02463_consen  136 FLSGGEKSLVALALLLALQRYKPS  159 (220)
T ss_dssp             GS-HHHHHHHHHHHHHHHHTCS--
T ss_pred             cccccccccccccccccccccccc
Confidence            699999999999999999999875


No 17 
>PHA02562 46 endonuclease subunit; Provisional
Probab=97.04  E-value=0.0061  Score=57.51  Aligned_cols=63  Identities=19%  Similarity=0.277  Sum_probs=40.9

Q ss_pred             HHHHHHHHHHHHHHHhhhcCCceEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHH
Q psy12760        117 DTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       117 ~~~f~~In~~fs~iF~~L~~gG~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...+..++..+.+++..+.  +  .+.+..++     |+...+...|....+...||||||.+++||+.||+
T Consensus       423 ~~~l~~~n~~~~~~L~~l~--~--~~~~~~~~-----~~~~~~~~~g~~~~~~~~lS~Ge~~r~~la~~l~~  485 (562)
T PHA02562        423 KKYIPYFNKQINHYLQIME--A--DYNFTLDE-----EFNETIKSRGREDFSYASFSQGEKARIDLALLFTW  485 (562)
T ss_pred             HHHHHHHHHHHHHHHHHhh--e--eEEEEech-----hhhhHHhcCCCCccChhhcChhHHHHHHHHHHHHH
Confidence            3455666667777666663  2  33333222     44444555555444678999999999999999985


No 18 
>PF13166 AAA_13:  AAA domain
Probab=96.24  E-value=0.092  Score=51.16  Aligned_cols=35  Identities=29%  Similarity=0.222  Sum_probs=25.7

Q ss_pred             cceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHH
Q psy12760        153 QGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       153 ~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~  190 (199)
                      .|..|..  +|+ ......||-|||+.+|+|+.||...
T Consensus       485 ~~y~l~~--~~~-~~~~~~LSEGEk~~iAf~yFla~l~  519 (712)
T PF13166_consen  485 KGYKLQR--KGG-SKPAKILSEGEKRAIAFAYFLAELK  519 (712)
T ss_pred             CeEEEEE--CCC-CcccCccCHHHHHHHHHHHHHHHHh
Confidence            3555544  332 2344899999999999999999876


No 19 
>PRK01156 chromosome segregation protein; Provisional
Probab=96.13  E-value=0.025  Score=56.74  Aligned_cols=29  Identities=41%  Similarity=0.533  Sum_probs=23.9

Q ss_pred             CCcccccccCCcchHHHHHHHHHHHHHHh
Q psy12760        163 RKSWKSIDCLSGGEKTLASLALVFALHYY  191 (199)
Q Consensus       163 gk~~~~l~~LSGGEKSlaaLalIfAL~~~  191 (199)
                      +....++..|||||+..+|||+.+|+..+
T Consensus       793 ~~~~~~~~~lS~G~~~~~~la~rlala~~  821 (895)
T PRK01156        793 GGMVEGIDSLSGGEKTAVAFALRVAVAQF  821 (895)
T ss_pred             CCccCccccCCHhHHHHHHHHHHHHHHHH
Confidence            34456778999999999999999998654


No 20 
>PF13514 AAA_27:  AAA domain
Probab=96.04  E-value=0.093  Score=54.33  Aligned_cols=70  Identities=26%  Similarity=0.194  Sum_probs=53.0

Q ss_pred             HHHHHHHHHHHHHhhhcCCceEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHhc
Q psy12760        119 NFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYW  192 (199)
Q Consensus       119 ~f~~In~~fs~iF~~L~~gG~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~  192 (199)
                      ....|....+.+|+.|+.|....|.++.+.+    +..+.|..+++...++..||+|=+--.-||+.||+....
T Consensus       977 ~~p~vl~~As~~f~~LT~G~Y~~l~~d~d~~----~~~l~~~~~~G~~~~~~~LS~GT~dQLYLALRLA~~e~~ 1046 (1111)
T PF13514_consen  977 RQPPVLARASEYFSRLTGGRYSRLRVDEDGD----KPVLVVVRADGERVPVEELSRGTRDQLYLALRLALAELL 1046 (1111)
T ss_pred             hhHHHHHHHHHHHHHHhCCCCceeeeccccC----cccceEEecCCeEeeHHHhCHHHHHHHHHHHHHHHHHHH
Confidence            3467777888999999988778887765322    333445545555678899999999999999999998754


No 21 
>PF13558 SbcCD_C:  Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A.
Probab=95.02  E-value=0.035  Score=40.92  Aligned_cols=26  Identities=46%  Similarity=0.402  Sum_probs=20.6

Q ss_pred             ccccccCCcchH-HHHHHHHHHHHHHh
Q psy12760        166 WKSIDCLSGGEK-TLASLALVFALHYY  191 (199)
Q Consensus       166 ~~~l~~LSGGEK-SlaaLalIfAL~~~  191 (199)
                      ......+||||| ..+++++..|+...
T Consensus        27 ~~~~~~~SGGEk~~~~~l~l~aal~~~   53 (90)
T PF13558_consen   27 SRSFGTLSGGEKQFPFYLALAAALAAL   53 (90)
T ss_dssp             EEEGGGS-HHHHHHHHHHHHHHHHHHH
T ss_pred             eccCCCCChhHhHHHHHHHHHHHHHHH
Confidence            356789999999 88999999888754


No 22 
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]
Probab=94.99  E-value=0.66  Score=45.21  Aligned_cols=38  Identities=24%  Similarity=0.350  Sum_probs=31.6

Q ss_pred             ceEEEEECC-CCccccc-ccCCcchHHHHHHHHHHHHHHh
Q psy12760        154 GIKYVVRPP-RKSWKSI-DCLSGGEKTLASLALVFALHYY  191 (199)
Q Consensus       154 GI~I~V~p~-gk~~~~l-~~LSGGEKSlaaLalIfAL~~~  191 (199)
                      -|++.+++. |.+.+++ +.-||||=|+..||+-.++...
T Consensus       412 ~VeF~istNpG~~~~PL~KvASGGELSRimLAlk~i~~~~  451 (557)
T COG0497         412 KVEFLISTNPGEPLKPLAKVASGGELSRIMLALKVILSRK  451 (557)
T ss_pred             eEEEEEeCCCCCCCccHHhhcchhHHHHHHHHHHHHHhcc
Confidence            677888774 7788887 5899999999999998887665


No 23 
>PRK04778 septation ring formation regulator EzrA; Provisional
Probab=94.66  E-value=0.068  Score=51.62  Aligned_cols=94  Identities=9%  Similarity=0.085  Sum_probs=68.5

Q ss_pred             HhhhccCCcccccCCCCCCCCCCCCCCCCCccchh-hhhcCCCCchhHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         35 ISDILSNSSIHTTPRSANTMAPASKWRSPVSGSDV-TAAVRPTPELPVR-DYAKRSKEMQAVLATLNTYCTGYEQCLSKR  112 (199)
Q Consensus        35 ~~~~~~~~~~~~~p~~~~~~~p~~~lr~~~~~i~~-l~~~~~vN~~ai~-ey~e~~er~e~L~~e~~~l~~~I~~L~~kr  112 (199)
                      +-..+-++.+|-+|...-+++.  .....++.+.. +.. ||||+.|++ +|++..++++.|..+..++.+....+.+..
T Consensus       430 ikr~l~k~~lpgip~~y~~~~~--~~~~~i~~l~~~L~~-g~VNm~ai~~e~~e~~~~~~~L~~q~~dL~~~a~~lE~~I  506 (569)
T PRK04778        430 IKRYLEKSNLPGLPEDYLEMFF--EVSDEIEALAEELEE-KPINMEAVNRLLEEATEDVETLEEETEELVENATLTEQLI  506 (569)
T ss_pred             HHHHHHHcCCCCCcHHHHHHHH--HHHHHHHHHHHHhcc-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3344556777777766444333  33444555544 445 999999999 999999999999999988877655555432


Q ss_pred             --HHHHHHHHHHHHHHHHHHH
Q psy12760        113 --QKEFDTNFVKIGKRVQECY  131 (199)
Q Consensus       113 --~~~F~~~f~~In~~fs~iF  131 (199)
                        ..+|..+|+.|+.+|..--
T Consensus       507 qy~nRfr~~~~~V~~~f~~Ae  527 (569)
T PRK04778        507 QYANRYRSDNEEVAEALNEAE  527 (569)
T ss_pred             HHHhccCCCCHHHHHHHHHHH
Confidence              8899999999999999543


No 24 
>PRK00064 recF recombination protein F; Reviewed
Probab=93.84  E-value=2.3  Score=38.78  Aligned_cols=70  Identities=19%  Similarity=0.172  Sum_probs=44.6

Q ss_pred             HHHHHHHHHHHHHHHhhhcCCc-eEEEEeccCC------------------------------CCCCcceEEEEECCCCc
Q psy12760        117 DTNFVKIGKRVQECYQMLTFGG-KADLEYKEYS------------------------------DPYAQGIKYVVRPPRKS  165 (199)
Q Consensus       117 ~~~f~~In~~fs~iF~~L~~gG-~a~L~l~~~e------------------------------dp~~~GI~I~V~p~gk~  165 (199)
                      ..+++.++..|+++|+.+..+. ...+.+....                              -|.-+.+.+.+  .|  
T Consensus       192 ~~~~~~L~~~~~~~~~~l~~~~~~~~l~y~~~~~~~~~~~~~~~~~~l~~~~~~d~~~g~T~~GpHrdDl~~~~--~g--  267 (361)
T PRK00064        192 LEYLERLAPLAAKTHQEISPEFELASLSYQSSVEDDAEKIEEDLLEALAKNRERDRARGRTLVGPHRDDLRFRI--NG--  267 (361)
T ss_pred             HHHHHHHHHHHHHHHHHhcCCCCceEEEEeCCCCcchhHHHHHHHHHHHHhHHHHHhcCCCCCCcchhceEEEE--CC--
Confidence            3478899999999999986432 4455443220                              01111233333  23  


Q ss_pred             ccccccCCcchHHHHHHHHHHHHHH
Q psy12760        166 WKSIDCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       166 ~~~l~~LSGGEKSlaaLalIfAL~~  190 (199)
                      ......+|+||+..+++|+.+|-..
T Consensus       268 ~~~~~~~S~Gq~~~~~lal~la~~~  292 (361)
T PRK00064        268 LPAADFGSTGQQKLLLLALKLAEAE  292 (361)
T ss_pred             CCHHHhCChHHHHHHHHHHHHHHHH
Confidence            3455689999999999999998543


No 25 
>COG4694 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=93.48  E-value=0.99  Score=44.34  Aligned_cols=24  Identities=29%  Similarity=0.223  Sum_probs=20.0

Q ss_pred             ccCCcchHHHHHHHHHHHHHHhcH
Q psy12760        170 DCLSGGEKTLASLALVFALHYYWL  193 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL~~~~~  193 (199)
                      +.||-|||+..|++|.+|=.+-+|
T Consensus       528 n~LSEGekt~iaf~yflakL~enp  551 (758)
T COG4694         528 NTLSEGEKTFIAFLYFLAKLKENP  551 (758)
T ss_pred             ccccccchhHHHHHHHHHHHHhCc
Confidence            469999999999999988766555


No 26 
>TIGR00618 sbcc exonuclease SbcC. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=92.03  E-value=0.94  Score=46.70  Aligned_cols=27  Identities=48%  Similarity=0.557  Sum_probs=22.6

Q ss_pred             CCcccccccCCcchHHHHHHHHHHHHH
Q psy12760        163 RKSWKSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       163 gk~~~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      +....++..|||||+.+++||+.+++.
T Consensus       942 ~~~~r~~~~lSgGe~~~~~la~al~ls  968 (1042)
T TIGR00618       942 TGSVRPSATLSGGETFLASLSLALALA  968 (1042)
T ss_pred             CCCcCCcccCCHHHHHHHHHHHHHHHH
Confidence            344567789999999999999999983


No 27 
>TIGR00611 recf recF protein. All proteins in this family for which functions are known are DNA binding proteins that assist the filamentation of RecA onto DNA for the initiation of recombination or recombinational repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=91.99  E-value=5.1  Score=36.72  Aligned_cols=70  Identities=20%  Similarity=0.152  Sum_probs=44.6

Q ss_pred             HHHHHHHHHHHHHHhhhcCCc-eEEEEeccC----CC----------------------CCCcceEEEEECCCCcccccc
Q psy12760        118 TNFVKIGKRVQECYQMLTFGG-KADLEYKEY----SD----------------------PYAQGIKYVVRPPRKSWKSID  170 (199)
Q Consensus       118 ~~f~~In~~fs~iF~~L~~gG-~a~L~l~~~----ed----------------------p~~~GI~I~V~p~gk~~~~l~  170 (199)
                      .+++.++..|+.+|..+..+. ...+.....    .+                      |.-+.+.+.+  .|..  --.
T Consensus       199 ~~~~~l~~~~~~~~~~l~~~~~~~~l~y~~~~~~~~~~~~~~L~~~~~~d~~~g~T~~GPHRdDl~~~~--~g~~--~~~  274 (365)
T TIGR00611       199 EFIEKLEPEAQKAHQLLLPELESLSLFYRGELWDKETDYAEALARNFERDLERGYTLVGPHRDDLRFRL--NGLP--VED  274 (365)
T ss_pred             HHHHHHHHHHHHHHHHhcCCCcceEEEEeCchHHHHHHHHHHHHHhHHHHHHcCCCCCCcchhceEEEE--CCEE--HHH
Confidence            378888999999999986443 455555421    01                      2223444444  2221  124


Q ss_pred             cCCcchHHHHHHHHHHHHHHh
Q psy12760        171 CLSGGEKTLASLALVFALHYY  191 (199)
Q Consensus       171 ~LSGGEKSlaaLalIfAL~~~  191 (199)
                      .+|+||+..+++|+.+|-..+
T Consensus       275 ~~S~Gq~r~l~lal~la~~~~  295 (365)
T TIGR00611       275 FASQGQLRSLALALRLAEGEL  295 (365)
T ss_pred             hcChhHHHHHHHHHHHHHHHH
Confidence            799999999999999987543


No 28 
>PRK14079 recF recombination protein F; Provisional
Probab=91.86  E-value=4.4  Score=36.76  Aligned_cols=67  Identities=21%  Similarity=0.283  Sum_probs=41.1

Q ss_pred             HHHHHHHHHHHHHHHhhhcCCceEEEEeccC--CC----------------------CCCcceEEEEECCCCcccccccC
Q psy12760        117 DTNFVKIGKRVQECYQMLTFGGKADLEYKEY--SD----------------------PYAQGIKYVVRPPRKSWKSIDCL  172 (199)
Q Consensus       117 ~~~f~~In~~fs~iF~~L~~gG~a~L~l~~~--ed----------------------p~~~GI~I~V~p~gk~~~~l~~L  172 (199)
                      ...++.++..++++|+.+..+....+.....  .+                      |.-+.+.+.+  .|+.  --..+
T Consensus       189 ~~~~~~l~~~~~~~~~~l~~~~~l~l~y~~~~~~~~~~~~l~~~~~~d~~~g~T~~GpHRdD~~~~~--~g~~--~~~~~  264 (349)
T PRK14079        189 RRALTRLSELAREAYAELGSRKPLRLELSESTAPEGYLAALEARRAEELARGATVVGPHRDDLVLTL--EGRP--AHRYA  264 (349)
T ss_pred             HHHHHHHHHHHHHHHhhcCCCCcEEEEEecCcCHHHHHHHHHHhhHHHHHcCCCCCCCchhceEEEE--CCEe--hHHhC
Confidence            3478899999999999984223344433221  01                      1122333333  2322  22479


Q ss_pred             CcchHHHHHHHHHHH
Q psy12760        173 SGGEKTLASLALVFA  187 (199)
Q Consensus       173 SGGEKSlaaLalIfA  187 (199)
                      |+||+..+++|+.+|
T Consensus       265 S~Gqqr~~~lal~la  279 (349)
T PRK14079        265 SRGEARTVALALRLA  279 (349)
T ss_pred             ChhHHHHHHHHHHHH
Confidence            999999999999998


No 29 
>PRK10246 exonuclease subunit SbcC; Provisional
Probab=91.71  E-value=1.8  Score=44.88  Aligned_cols=35  Identities=37%  Similarity=0.471  Sum_probs=26.7

Q ss_pred             ceEEEEEC--CCCcccccccCCcchHHHHHHHHHHHH
Q psy12760        154 GIKYVVRP--PRKSWKSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       154 GI~I~V~p--~gk~~~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      |+++.|.-  .+....+...|||||+.+++||+.+++
T Consensus       930 ~l~~~~~d~~~~~~~r~~~~LSgGe~~~~~la~al~~  966 (1047)
T PRK10246        930 ALELEVVDTWQADAVRDTRTLSGGESFLVSLALALAL  966 (1047)
T ss_pred             CCceeeeehhccCCCCCcccCCHHHHHHHHHHHHHHh
Confidence            66655543  234456788999999999999999997


No 30 
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=91.37  E-value=0.058  Score=46.74  Aligned_cols=23  Identities=35%  Similarity=0.400  Sum_probs=20.5

Q ss_pred             cccccCCcchHHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      .+...||||||+++|||=++|+.
T Consensus       134 r~p~~LSGGqkqRvaIA~vLa~~  156 (235)
T COG1122         134 RPPFNLSGGQKQRVAIAGVLAMG  156 (235)
T ss_pred             CCccccCCcceeeHHhhHHHHcC
Confidence            45678999999999999999986


No 31 
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=89.76  E-value=0.17  Score=43.92  Aligned_cols=21  Identities=29%  Similarity=0.384  Sum_probs=17.0

Q ss_pred             cccccCCcchHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfA  187 (199)
                      +...+||||||+++|+|=-++
T Consensus       138 ~~p~eLSGGqqQRVAIARAL~  158 (226)
T COG1136         138 KKPSELSGGQQQRVAIARALI  158 (226)
T ss_pred             CCchhcCHHHHHHHHHHHHHh
Confidence            345799999999999986554


No 32 
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=89.65  E-value=0.22  Score=43.97  Aligned_cols=21  Identities=38%  Similarity=0.586  Sum_probs=17.9

Q ss_pred             cccccCCcchHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfA  187 (199)
                      +.+++||||||+++-+|-.+|
T Consensus       134 r~~~~LSGGerQrv~iArALa  154 (258)
T COG1120         134 RPVDELSGGERQRVLIARALA  154 (258)
T ss_pred             CcccccChhHHHHHHHHHHHh
Confidence            456789999999999997776


No 33 
>TIGR00606 rad50 rad50. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=89.57  E-value=2  Score=45.58  Aligned_cols=70  Identities=21%  Similarity=0.217  Sum_probs=41.9

Q ss_pred             HHHHHHHHHHHHhhhcCCceE-EEEeccCCCC-----C--CcceEEEE-ECCCCc-ccccccCCcchHHHHHHHHHHHHH
Q psy12760        120 FVKIGKRVQECYQMLTFGGKA-DLEYKEYSDP-----Y--AQGIKYVV-RPPRKS-WKSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       120 f~~In~~fs~iF~~L~~gG~a-~L~l~~~edp-----~--~~GI~I~V-~p~gk~-~~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      .+.||..+.++|...+.|-.+ .+.+ .++..     .  ...-.+.+ .|.|.. ......||||||.+++|.+.+||.
T Consensus      1139 ~~~~n~~~~~~w~~~~~~~~~~~i~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lS~Gq~~~~~~~~rlala 1217 (1311)
T TIGR00606      1139 MEEINKIIRDLWRSTYRGQDIEYIEI-RSDADENVSASDKRRNYNYRVVMLKGDTALDMRGRCSAGQKVLASLIIRLALA 1217 (1311)
T ss_pred             HHHHHHHHHHHHHHHcCccHHHHhhc-CCCCChHHHHHHHcCchHHHhccCCCCeecCCCCCCchhhhhHhhHhHHHHHH
Confidence            678999999999999965432 2333 22211     0  11222333 344422 233368999999988777777665


Q ss_pred             H
Q psy12760        190 Y  190 (199)
Q Consensus       190 ~  190 (199)
                      .
T Consensus      1218 ~ 1218 (1311)
T TIGR00606      1218 E 1218 (1311)
T ss_pred             H
Confidence            4


No 34 
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle.
Probab=89.17  E-value=1.8  Score=43.80  Aligned_cols=53  Identities=11%  Similarity=0.193  Sum_probs=36.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy12760         80 PVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQ  132 (199)
Q Consensus        80 ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~  132 (199)
                      ...+|+.+.+.++.|...+.++.+.+..+.+++.+.|..++++++..|..+|.
T Consensus       998 l~~q~~dL~~~~~~L~~~i~~i~~~~~~~f~~~~~~F~~v~~~f~~~F~~lf~ 1050 (1179)
T TIGR02168       998 LKERYDFLTAQKEDLTEAKETLEEAIEEIDREARERFKDTFDQVNENFQRVFP 1050 (1179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44566666677777777777777777777766677777777777777776664


No 35 
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=87.25  E-value=0.29  Score=41.81  Aligned_cols=32  Identities=56%  Similarity=0.952  Sum_probs=26.0

Q ss_pred             EECCCCcccccccCCcchHHHHHHHHHHHHHH
Q psy12760        159 VRPPRKSWKSIDCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       159 V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~  190 (199)
                      ..|+++....+..||||||.+++||..++...
T Consensus       143 ~~p~~~~~~~~~~LS~G~k~rl~la~al~~~~  174 (247)
T cd03275         143 KNPPGKRFRDMDNLSGGEKTMAALALLFAIHS  174 (247)
T ss_pred             ccCcchhhhhHHHcCHHHHHHHHHHHHHHHhc
Confidence            34556666777899999999999999999753


No 36 
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms.  SMCs are generally present as single proteins in bacteria, and as at least six distinct proteins in eukaryotes.  The proteins range in size from approximately 110 to 170 kDa, and each has five distinct domains: amino- and carboxy-terminal globular domains, which contain sequences characteristic of ATPases, two coiled-coil regions separating the terminal domains , and a central flexible hinge.  SMC proteins function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair, and epigenetic silencing of gene expression.
Probab=85.70  E-value=1.4  Score=36.02  Aligned_cols=30  Identities=53%  Similarity=0.759  Sum_probs=22.1

Q ss_pred             EEEECCCCcccccccCCcchHHHHHHHHHHHHH
Q psy12760        157 YVVRPPRKSWKSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       157 I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      +..-|.|+.. .+  ||||||.+++++..++.+
T Consensus        83 ~~~~~~~~~~-~~--LS~Ge~~r~~Laral~~~  112 (178)
T cd03239          83 YFLVLQGKVE-QI--LSGGEKSLSALALIFALQ  112 (178)
T ss_pred             eEEecCCcCc-cc--CCHHHHHHHHHHHHHHHh
Confidence            4454555443 33  999999999999998864


No 37 
>COG4717 Uncharacterized conserved protein [Function unknown]
Probab=85.67  E-value=16  Score=37.79  Aligned_cols=62  Identities=29%  Similarity=0.223  Sum_probs=46.9

Q ss_pred             HHHHHHHhhhcCCceEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHHHHHHHHHHHHHHhc
Q psy12760        125 KRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFALHYYW  192 (199)
Q Consensus       125 ~~fs~iF~~L~~gG~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~~~  192 (199)
                      ..-+.+|..|+.|-.-.+....++|      .|.|.-..+.......||-|=|=-.=+|+.||+.+..
T Consensus       861 ~~A~~~F~hlT~G~Yt~Iy~~e~~d------~I~V~~~~G~~~~~~ELSqgT~EQLYlAlRfali~~~  922 (984)
T COG4717         861 QEASEFFMHLTDGRYTGIYTQEDKD------SIIVEHRAGGSKLAEELSQGTKEQLYLALRFALIHEV  922 (984)
T ss_pred             HHHHHHHhhccCCceeeeecccCCc------eeEEEecccccccHHHHhhhHHHHHHHHHHHHHHhhh
Confidence            4456889999976666665543332      5667766666677789999999999999999998753


No 38 
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]
Probab=84.88  E-value=0.46  Score=40.96  Aligned_cols=18  Identities=33%  Similarity=0.361  Sum_probs=14.8

Q ss_pred             ccccCCcchHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALV  185 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalI  185 (199)
                      -..+||||||+++|||=-
T Consensus       126 LP~~LSGGqRQRvALARc  143 (231)
T COG3840         126 LPGELSGGQRQRVALARC  143 (231)
T ss_pred             CccccCchHHHHHHHHHH
Confidence            345899999999999853


No 39 
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]
Probab=84.69  E-value=0.5  Score=40.81  Aligned_cols=18  Identities=33%  Similarity=0.362  Sum_probs=14.9

Q ss_pred             cccccCCcchHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLAL  184 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLal  184 (199)
                      .-..+|||||++.+|+|=
T Consensus       133 ~lP~~LSGGEQQRvaIAR  150 (223)
T COG2884         133 ALPSQLSGGEQQRVAIAR  150 (223)
T ss_pred             cCccccCchHHHHHHHHH
Confidence            344689999999999984


No 40 
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=84.35  E-value=0.24  Score=43.16  Aligned_cols=21  Identities=43%  Similarity=0.672  Sum_probs=18.2

Q ss_pred             cccccCCcchHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfA  187 (199)
                      +.+++||||||+++=+|.++|
T Consensus       131 ryLd~LSGGQrQRAfIAMVla  151 (252)
T COG4604         131 RYLDELSGGQRQRAFIAMVLA  151 (252)
T ss_pred             HhHHhcccchhhhhhhheeee
Confidence            467899999999999998876


No 41 
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=83.88  E-value=0.43  Score=41.75  Aligned_cols=23  Identities=26%  Similarity=0.359  Sum_probs=19.0

Q ss_pred             cccccCCcchHHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      ....+||||||+++|+|=-+|+.
T Consensus       132 ~yP~qLSGGQqQRVAIARALaM~  154 (240)
T COG1126         132 AYPAQLSGGQQQRVAIARALAMD  154 (240)
T ss_pred             hCccccCcHHHHHHHHHHHHcCC
Confidence            34469999999999999877764


No 42 
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=83.78  E-value=0.88  Score=34.44  Aligned_cols=20  Identities=40%  Similarity=0.478  Sum_probs=16.7

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ....||||||.+++||..++
T Consensus       105 ~~~~LS~Ge~~rl~la~al~  124 (137)
T PF00005_consen  105 RASSLSGGEKQRLALARALL  124 (137)
T ss_dssp             CGGGSCHHHHHHHHHHHHHH
T ss_pred             ccchhhHHHHHHHHHHHHHH
Confidence            34799999999999998664


No 43 
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=83.19  E-value=0.73  Score=42.21  Aligned_cols=26  Identities=31%  Similarity=0.285  Sum_probs=19.9

Q ss_pred             CCcccccccCCcchHHHHHHHHHHHH
Q psy12760        163 RKSWKSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       163 gk~~~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ++.-....+||||||+++|+|=-+|.
T Consensus       133 dk~~~yP~qLSGGQKQRVaIARALa~  158 (339)
T COG1135         133 DKADRYPAQLSGGQKQRVAIARALAN  158 (339)
T ss_pred             hhhccCchhcCcchhhHHHHHHHHhc
Confidence            34444557999999999999976664


No 44 
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=83.15  E-value=0.65  Score=41.02  Aligned_cols=20  Identities=25%  Similarity=0.348  Sum_probs=15.9

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ..++|||||++++|+|=-++
T Consensus       138 ~P~eLSGGQ~QRiaIARAL~  157 (252)
T COG1124         138 RPHELSGGQRQRIAIARALI  157 (252)
T ss_pred             CchhcChhHHHHHHHHHHhc
Confidence            44689999999999985443


No 45 
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]
Probab=82.94  E-value=0.57  Score=45.31  Aligned_cols=21  Identities=43%  Similarity=0.556  Sum_probs=18.1

Q ss_pred             cccccCCcchHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfA  187 (199)
                      +++..||||||.++.||.++.
T Consensus       435 ~~v~~LSGGEk~Rl~La~ll~  455 (530)
T COG0488         435 KPVGVLSGGEKARLLLAKLLL  455 (530)
T ss_pred             CchhhcCHhHHHHHHHHHHhc
Confidence            566789999999999998874


No 46 
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=82.13  E-value=0.9  Score=40.13  Aligned_cols=21  Identities=43%  Similarity=0.521  Sum_probs=17.8

Q ss_pred             cccccCCcchHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfA  187 (199)
                      +.+..|||||++++-||--||
T Consensus       135 r~i~~LSGGQ~QRV~lARAL~  155 (254)
T COG1121         135 RQIGELSGGQKQRVLLARALA  155 (254)
T ss_pred             CcccccCcHHHHHHHHHHHhc
Confidence            567899999999999987655


No 47 
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=82.09  E-value=1  Score=37.15  Aligned_cols=21  Identities=33%  Similarity=0.390  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++++|..++.
T Consensus       129 ~~~~LSgG~~qrv~la~al~~  149 (213)
T cd03235         129 QIGELSGGQQQRVLLARALVQ  149 (213)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            346899999999999987764


No 48 
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=81.46  E-value=0.82  Score=40.29  Aligned_cols=21  Identities=38%  Similarity=0.627  Sum_probs=15.9

Q ss_pred             cccccCCcchHHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      +++..||||||+  |++|++|..
T Consensus       144 ~~iglLSGGQRQ--alsL~MAtl  164 (263)
T COG1101         144 DRIGLLSGGQRQ--ALSLLMATL  164 (263)
T ss_pred             ChhhhccchHHH--HHHHHHHhc
Confidence            466789999998  566677654


No 49 
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=81.28  E-value=0.99  Score=37.26  Aligned_cols=20  Identities=30%  Similarity=0.298  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+++++|-.|+.
T Consensus       136 ~~~LSgG~~qrv~laral~~  155 (216)
T TIGR00960       136 PMQLSGGEQQRVAIARAIVH  155 (216)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            35899999999999987764


No 50 
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=81.05  E-value=0.83  Score=40.30  Aligned_cols=19  Identities=32%  Similarity=0.387  Sum_probs=15.8

Q ss_pred             cccCCcchHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfA  187 (199)
                      ..+||||+|+++|||=-+|
T Consensus       128 P~qLSGGMrQRVaiARAL~  146 (248)
T COG1116         128 PHQLSGGMRQRVAIARALA  146 (248)
T ss_pred             ccccChHHHHHHHHHHHHh
Confidence            3689999999999986554


No 51 
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=80.93  E-value=0.99  Score=37.82  Aligned_cols=21  Identities=43%  Similarity=0.392  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++++|-.++.
T Consensus       133 ~~~~LSgG~~qrv~ia~al~~  153 (235)
T cd03261         133 YPAELSGGMKKRVALARALAL  153 (235)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999987764


No 52 
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=80.39  E-value=1.1  Score=37.01  Aligned_cols=20  Identities=30%  Similarity=0.365  Sum_probs=17.1

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+++++|-.++.
T Consensus       139 ~~~LS~G~~qrv~laral~~  158 (221)
T TIGR02211       139 PSELSGGERQRVAIARALVN  158 (221)
T ss_pred             hhhCCHHHHHHHHHHHHHhC
Confidence            36899999999999988764


No 53 
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=80.36  E-value=1.2  Score=36.48  Aligned_cols=20  Identities=40%  Similarity=0.453  Sum_probs=16.9

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+.++||..|+.
T Consensus       132 ~~~LSgG~~qrv~laral~~  151 (211)
T cd03225         132 PFTLSGGQKQRVAIAGVLAM  151 (211)
T ss_pred             cccCCHHHHHHHHHHHHHhc
Confidence            46899999999999987763


No 54 
>PRK04863 mukB cell division protein MukB; Provisional
Probab=80.23  E-value=3.1  Score=45.03  Aligned_cols=24  Identities=17%  Similarity=0.196  Sum_probs=20.2

Q ss_pred             ccccCCcchHHHHHHHHHHHHHHh
Q psy12760        168 SIDCLSGGEKTLASLALVFALHYY  191 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL~~~  191 (199)
                      ....||||||+.++++++.|...|
T Consensus      1362 ~~~~lSgGE~~~~~~~~l~a~l~~ 1385 (1486)
T PRK04863       1362 ESGALSTGEAIGTGMSILVMVVQS 1385 (1486)
T ss_pred             CCCCCCcchhHHHHHHHHHHHHHH
Confidence            357899999999999999994444


No 55 
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=80.08  E-value=1.1  Score=36.90  Aligned_cols=20  Identities=35%  Similarity=0.383  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+++++|..++.
T Consensus       128 ~~~LSgG~~qrl~la~al~~  147 (213)
T cd03259         128 PHELSGGQQQRVALARALAR  147 (213)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            35899999999999987764


No 56 
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=80.02  E-value=0.96  Score=38.67  Aligned_cols=17  Identities=53%  Similarity=0.640  Sum_probs=14.4

Q ss_pred             cccccCCcchHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLA  183 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLa  183 (199)
                      +++..||||||+++||+
T Consensus       129 k~it~lSGGE~QriAli  145 (223)
T COG4619         129 KNITELSGGEKQRIALI  145 (223)
T ss_pred             chhhhccchHHHHHHHH
Confidence            45678999999999876


No 57 
>KOG0062|consensus
Probab=80.01  E-value=0.89  Score=44.19  Aligned_cols=20  Identities=40%  Similarity=0.581  Sum_probs=17.0

Q ss_pred             ccccccCCcchHHHHHHHHH
Q psy12760        166 WKSIDCLSGGEKTLASLALV  185 (199)
Q Consensus       166 ~~~l~~LSGGEKSlaaLalI  185 (199)
                      .+++..||||||+.+++|-+
T Consensus       477 ~~si~~LSGGQKsrvafA~~  496 (582)
T KOG0062|consen  477 LQSIASLSGGQKSRVAFAAC  496 (582)
T ss_pred             hccccccCCcchhHHHHHHH
Confidence            46688999999999999854


No 58 
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=79.70  E-value=1.3  Score=36.72  Aligned_cols=19  Identities=37%  Similarity=0.485  Sum_probs=16.8

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..||||||+.+++|..++.
T Consensus       130 ~~LSgG~~qrl~la~al~~  148 (220)
T cd03293         130 HQLSGGMRQRVALARALAV  148 (220)
T ss_pred             ccCCHHHHHHHHHHHHHHc
Confidence            5899999999999988775


No 59 
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=79.46  E-value=1.1  Score=37.01  Aligned_cols=20  Identities=30%  Similarity=0.351  Sum_probs=16.9

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+.++||-.++.
T Consensus       138 ~~~LS~G~~qrv~la~al~~  157 (218)
T cd03255         138 PSELSGGQQQRVAIARALAN  157 (218)
T ss_pred             hhhcCHHHHHHHHHHHHHcc
Confidence            35899999999999987764


No 60 
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=79.46  E-value=1.2  Score=38.25  Aligned_cols=21  Identities=29%  Similarity=0.390  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+.++||..++.
T Consensus       112 ~~~~LSgGe~qrv~iaraL~~  132 (246)
T cd03237         112 EVPELSGGELQRVAIAACLSK  132 (246)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            456899999999999987764


No 61 
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function.  Barmotin belongs to the SMC protein family.  SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w
Probab=79.36  E-value=1.4  Score=36.61  Aligned_cols=24  Identities=50%  Similarity=0.796  Sum_probs=20.1

Q ss_pred             ccccccCCcchHHHHHHHHHHHHH
Q psy12760        166 WKSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       166 ~~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      ......||||||.++++|..+++.
T Consensus       108 ~~~~~~LS~G~kqrl~la~~l~~~  131 (197)
T cd03278         108 VQRLSLLSGGEKALTALALLFAIF  131 (197)
T ss_pred             ccchhhcCHHHHHHHHHHHHHHHh
Confidence            345678999999999999988763


No 62 
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]
Probab=79.36  E-value=1.2  Score=43.38  Aligned_cols=22  Identities=32%  Similarity=0.454  Sum_probs=18.9

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +..++||||||+++|+|--+|+
T Consensus       425 ryP~elSGGQrQRvaIARALa~  446 (539)
T COG1123         425 RYPHELSGGQRQRVAIARALAL  446 (539)
T ss_pred             cCchhcCcchhHHHHHHHHHhc
Confidence            3457999999999999998875


No 63 
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage.  When replication is prematurely disrupted by DNA damage, several recF pathway gene products play critical roles processing the arrested replication fork, allowing it to resume and complete its task.  This CD represents the nucleotide binding domain of RecF.  RecF  belongs to a large superfamily of ABC transporters involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases with a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=79.29  E-value=7.1  Score=33.79  Aligned_cols=31  Identities=23%  Similarity=0.247  Sum_probs=22.7

Q ss_pred             ceEEEEECCCCcccccccCCcchHHHHHHHHHHHH
Q psy12760        154 GIKYVVRPPRKSWKSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       154 GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      -+.+.+.+    ....+.+|+||+..+++|..+|.
T Consensus       170 ~l~~~vd~----~~~~~~lS~Gq~~~~~la~~la~  200 (270)
T cd03242         170 DLLFFLND----KPAADFGSQGQQRTLALALKLAE  200 (270)
T ss_pred             heEEEECC----EeHHHhCChHHHHHHHHHHHHHH
Confidence            45555543    22467899999999999998874


No 64 
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=79.25  E-value=1.4  Score=36.90  Aligned_cols=21  Identities=29%  Similarity=0.409  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       141 ~~~~LS~G~~qrv~la~al~~  161 (241)
T cd03256         141 RADQLSGGQQQRVAIARALMQ  161 (241)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            446899999999999987764


No 65 
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=78.96  E-value=1.3  Score=36.41  Aligned_cols=20  Identities=30%  Similarity=0.375  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+.+++|-.++.
T Consensus       135 ~~~LS~G~~qrl~la~al~~  154 (214)
T TIGR02673       135 PEQLSGGEQQRVAIARAIVN  154 (214)
T ss_pred             hhhCCHHHHHHHHHHHHHhC
Confidence            35899999999999988764


No 66 
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=78.79  E-value=1.2  Score=36.62  Aligned_cols=21  Identities=24%  Similarity=0.192  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|..++.
T Consensus       123 ~~~~LS~G~~qrv~la~al~~  143 (208)
T cd03268         123 KVKGFSLGMKQRLGIALALLG  143 (208)
T ss_pred             hHhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999988764


No 67 
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=78.30  E-value=1.2  Score=40.92  Aligned_cols=16  Identities=38%  Similarity=0.376  Sum_probs=13.8

Q ss_pred             cccCCcchHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLAL  184 (199)
Q Consensus       169 l~~LSGGEKSlaaLal  184 (199)
                      ..+||||||+++|++=
T Consensus       131 P~~LSGGQrQRVAlaR  146 (338)
T COG3839         131 PLQLSGGQRQRVALAR  146 (338)
T ss_pred             cccCChhhHHHHHHHH
Confidence            3589999999999974


No 68 
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=78.12  E-value=1.3  Score=36.28  Aligned_cols=21  Identities=14%  Similarity=0.199  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|..++.
T Consensus       125 ~~~~LS~G~~qrl~la~al~~  145 (210)
T cd03269         125 RVEELSKGNQQKVQFIAAVIH  145 (210)
T ss_pred             cHhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999988775


No 69 
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=78.06  E-value=1.9  Score=35.78  Aligned_cols=26  Identities=27%  Similarity=0.620  Sum_probs=21.4

Q ss_pred             cccccccCCcchHHHHHHHHHHHHHH
Q psy12760        165 SWKSIDCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       165 ~~~~l~~LSGGEKSlaaLalIfAL~~  190 (199)
                      ..+....||||||..+++|..+|++.
T Consensus       103 ~~~~~~~lS~G~k~r~~ia~al~~~~  128 (198)
T cd03276         103 AVRDVKTLSGGERSFSTVCLLLSLWE  128 (198)
T ss_pred             cCCcccccChhHHHHHHHHHHHHHhc
Confidence            34567799999999999999988653


No 70 
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=78.04  E-value=1.4  Score=36.96  Aligned_cols=20  Identities=30%  Similarity=0.396  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+++++|-.++.
T Consensus       112 ~~~LSgG~~qrv~la~al~~  131 (230)
T TIGR01184       112 PGQLSGGMKQRVAIARALSI  131 (230)
T ss_pred             hhhCCHHHHHHHHHHHHHHc
Confidence            46899999999999988764


No 71 
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=77.91  E-value=1.6  Score=35.81  Aligned_cols=21  Identities=29%  Similarity=0.289  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++++|-.++.
T Consensus       123 ~~~~LS~G~~qrv~laral~~  143 (205)
T cd03226         123 HPLSLSGGQKQRLAIAAALLS  143 (205)
T ss_pred             CchhCCHHHHHHHHHHHHHHh
Confidence            345899999999999987764


No 72 
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=77.64  E-value=1.6  Score=38.14  Aligned_cols=21  Identities=33%  Similarity=0.346  Sum_probs=18.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.|+.
T Consensus       141 ~~~~LSgGqkqrvaiA~aL~~  161 (288)
T PRK13643        141 SPFELSGGQMRRVAIAGILAM  161 (288)
T ss_pred             CcccCCHHHHHHHHHHHHHHh
Confidence            446899999999999998876


No 73 
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=77.59  E-value=1.5  Score=36.68  Aligned_cols=21  Identities=24%  Similarity=0.184  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+.+++|..++.
T Consensus       140 ~~~~LSgG~~qrv~la~al~~  160 (236)
T cd03219         140 PAGELSYGQQRRLEIARALAT  160 (236)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            456899999999999987764


No 74 
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=77.52  E-value=1.5  Score=36.34  Aligned_cols=20  Identities=20%  Similarity=0.302  Sum_probs=16.8

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      +..||||||.++++|-.++.
T Consensus       129 ~~~LS~G~~qr~~la~al~~  148 (220)
T cd03265         129 VKTYSGGMRRRLEIARSLVH  148 (220)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            46899999999999877663


No 75 
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=77.28  E-value=1.6  Score=40.87  Aligned_cols=23  Identities=22%  Similarity=0.276  Sum_probs=19.2

Q ss_pred             ccccccCCcchHHHHHHHHHHHH
Q psy12760        166 WKSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       166 ~~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+....||||||++++||-.++.
T Consensus       386 ~~~~~~LSgGq~qrv~la~al~~  408 (491)
T PRK10982        386 RTQIGSLSGGNQQKVIIGRWLLT  408 (491)
T ss_pred             ccccccCCcHHHHHHHHHHHHhc
Confidence            34667999999999999988764


No 76 
>PRK13409 putative ATPase RIL; Provisional
Probab=77.25  E-value=1.5  Score=42.63  Aligned_cols=22  Identities=32%  Similarity=0.445  Sum_probs=18.3

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +.+..||||||++++||-.++.
T Consensus       449 ~~~~~LSGGe~QRvaiAraL~~  470 (590)
T PRK13409        449 KNVKDLSGGELQRVAIAACLSR  470 (590)
T ss_pred             CCcccCCHHHHHHHHHHHHHhc
Confidence            3456899999999999988764


No 77 
>KOG0058|consensus
Probab=77.09  E-value=1.4  Score=44.22  Aligned_cols=14  Identities=43%  Similarity=0.612  Sum_probs=12.9

Q ss_pred             ccCCcchHHHHHHH
Q psy12760        170 DCLSGGEKTLASLA  183 (199)
Q Consensus       170 ~~LSGGEKSlaaLa  183 (199)
                      .+||||||++.|+|
T Consensus       603 ~qLSGGQKQRIAIA  616 (716)
T KOG0058|consen  603 SQLSGGQKQRIAIA  616 (716)
T ss_pred             ccccchHHHHHHHH
Confidence            48999999999997


No 78 
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=76.98  E-value=1.7  Score=35.23  Aligned_cols=20  Identities=45%  Similarity=0.713  Sum_probs=16.8

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+++++|..++.
T Consensus       125 ~~~LS~G~~qrv~laral~~  144 (190)
T TIGR01166       125 THCLSGGEKKRVAIAGAVAM  144 (190)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            36899999999999987763


No 79 
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=76.93  E-value=1.7  Score=36.39  Aligned_cols=21  Identities=33%  Similarity=0.458  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       142 ~~~~LSgG~~qrv~la~al~~  162 (243)
T TIGR02315       142 RADQLSGGQQQRVAIARALAQ  162 (243)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            346899999999999987764


No 80 
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=76.87  E-value=1.8  Score=35.67  Aligned_cols=21  Identities=29%  Similarity=0.302  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|..++.
T Consensus       137 ~~~~LSgG~~qrl~la~al~~  157 (220)
T cd03245         137 RGRGLSGGQRQAVALARALLN  157 (220)
T ss_pred             CCccCCHHHHHHHHHHHHHhc
Confidence            356899999999999988774


No 81 
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=76.74  E-value=1.8  Score=36.61  Aligned_cols=21  Identities=33%  Similarity=0.382  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++++|-.|+.
T Consensus       141 ~~~~LSgG~~qrv~laral~~  161 (247)
T TIGR00972       141 SALGLSGGQQQRLCIARALAV  161 (247)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999988764


No 82 
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=76.53  E-value=1.7  Score=35.63  Aligned_cols=20  Identities=30%  Similarity=0.315  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.++++|..++.
T Consensus       134 ~~~LS~G~~qrv~laral~~  153 (214)
T cd03292         134 PAELSGGEQQRVAIARAIVN  153 (214)
T ss_pred             hhhcCHHHHHHHHHHHHHHc
Confidence            35899999999999988764


No 83 
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.
Probab=76.48  E-value=1.8  Score=36.30  Aligned_cols=21  Identities=33%  Similarity=0.232  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||..++.
T Consensus       122 ~~~~LS~G~~qrv~laral~~  142 (230)
T TIGR02770       122 YPFQLSGGMLQRVMIALALLL  142 (230)
T ss_pred             ChhhcCHHHHHHHHHHHHHhc
Confidence            446899999999999988764


No 84 
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=76.48  E-value=1.8  Score=36.00  Aligned_cols=20  Identities=35%  Similarity=0.305  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+++++|-.++.
T Consensus       139 ~~~LSgG~~qrv~la~al~~  158 (227)
T cd03260         139 ALGLSGGQQQRLCLARALAN  158 (227)
T ss_pred             cccCCHHHHHHHHHHHHHhc
Confidence            46899999999999987764


No 85 
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=76.43  E-value=1.4  Score=40.37  Aligned_cols=21  Identities=33%  Similarity=0.452  Sum_probs=18.1

Q ss_pred             cccCCcchHHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL~  189 (199)
                      ..+||||||+++|||=-+|..
T Consensus       135 P~QLSGGQrQRVALARALA~e  155 (345)
T COG1118         135 PAQLSGGQRQRVALARALAVE  155 (345)
T ss_pred             chhcChHHHHHHHHHHHhhcC
Confidence            358999999999999888764


No 86 
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=76.29  E-value=1.8  Score=37.38  Aligned_cols=21  Identities=29%  Similarity=0.325  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||..++.
T Consensus       142 ~~~~LSgG~~qrv~la~al~~  162 (280)
T PRK13649        142 NPFELSGGQMRRVAIAGILAM  162 (280)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            456899999999999987765


No 87 
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=76.26  E-value=1.7  Score=36.42  Aligned_cols=20  Identities=30%  Similarity=0.365  Sum_probs=17.1

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.++++|..++.
T Consensus       143 ~~~LSgG~~qrl~la~al~~  162 (233)
T PRK11629        143 PSELSGGERQRVAIARALVN  162 (233)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            35899999999999987764


No 88 
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=76.26  E-value=1.9  Score=36.07  Aligned_cols=21  Identities=24%  Similarity=0.283  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.++.
T Consensus       135 ~~~~LSgG~~qrv~laral~~  155 (237)
T cd03252         135 QGAGLSGGQRQRIAIARALIH  155 (237)
T ss_pred             CCCcCCHHHHHHHHHHHHHhh
Confidence            456899999999999988764


No 89 
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=76.16  E-value=1.7  Score=37.49  Aligned_cols=21  Identities=33%  Similarity=0.338  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       130 ~~~~LSgGqkqrl~laraL~~  150 (257)
T PRK11247        130 WPAALSGGQKQRVALARALIH  150 (257)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999988765


No 90 
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=76.12  E-value=1.9  Score=36.98  Aligned_cols=21  Identities=43%  Similarity=0.472  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       131 ~~~~LSgGe~qrv~la~al~~  151 (258)
T PRK13548        131 DYPQLSGGEQQRVQLARVLAQ  151 (258)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            346999999999999988874


No 91 
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=76.10  E-value=1.1  Score=41.29  Aligned_cols=20  Identities=30%  Similarity=0.393  Sum_probs=16.5

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ..++|||||++++|||=-+|
T Consensus       133 ~p~qLSGGQqQRVALARAL~  152 (352)
T COG3842         133 KPHQLSGGQQQRVALARALV  152 (352)
T ss_pred             ChhhhChHHHHHHHHHHHhh
Confidence            45689999999999986554


No 92 
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=76.03  E-value=1.8  Score=40.43  Aligned_cols=22  Identities=23%  Similarity=0.264  Sum_probs=18.8

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||++++||..|+.
T Consensus       131 ~~~~~LSgG~~qrv~la~al~~  152 (490)
T PRK10938        131 RRFKYLSTGETRKTLLCQALMS  152 (490)
T ss_pred             CCcccCCHHHHHHHHHHHHHHc
Confidence            4567999999999999988874


No 93 
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=75.94  E-value=1.8  Score=36.02  Aligned_cols=21  Identities=33%  Similarity=0.472  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|..++.
T Consensus       130 ~~~~LS~G~~qrl~la~al~~  150 (232)
T cd03218         130 KASSLSGGERRRVEIARALAT  150 (232)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            446899999999999987764


No 94 
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=75.85  E-value=1.9  Score=36.45  Aligned_cols=21  Identities=29%  Similarity=0.409  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++++|..++.
T Consensus       143 ~~~~LSgG~~qrv~laral~~  163 (250)
T PRK14247        143 PAGKLSGGQQQRLCIARALAF  163 (250)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            446899999999999988764


No 95 
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=75.80  E-value=1.8  Score=37.32  Aligned_cols=21  Identities=43%  Similarity=0.371  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+.++||-.++.
T Consensus       140 ~~~~LSgGq~qrv~laral~~  160 (269)
T PRK11831        140 MPSELSGGMARRAALARAIAL  160 (269)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999988764


No 96 
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=75.72  E-value=1.9  Score=36.56  Aligned_cols=21  Identities=19%  Similarity=0.173  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+.+++|-.++-
T Consensus       145 ~~~~LSgG~~qrv~laral~~  165 (253)
T TIGR02323       145 LPRAFSGGMQQRLQIARNLVT  165 (253)
T ss_pred             CchhcCHHHHHHHHHHHHHhc
Confidence            456899999999999988753


No 97 
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=75.69  E-value=1.9  Score=40.74  Aligned_cols=21  Identities=43%  Similarity=0.351  Sum_probs=18.2

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||+++++|-.++.
T Consensus       165 ~~~~LSgGq~qrv~iA~al~~  185 (520)
T TIGR03269       165 IARDLSGGEKQRVVLARQLAK  185 (520)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            457899999999999988874


No 98 
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=75.49  E-value=2  Score=37.05  Aligned_cols=21  Identities=38%  Similarity=0.623  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       133 ~~~~LSgG~~qrl~laraL~~  153 (271)
T PRK13638        133 PIQCLSHGQKKRVAIAGALVL  153 (271)
T ss_pred             CchhCCHHHHHHHHHHHHHHc
Confidence            346899999999999987764


No 99 
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=75.44  E-value=1.8  Score=35.57  Aligned_cols=21  Identities=24%  Similarity=0.370  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++-
T Consensus       126 ~~~~LS~G~~qrl~la~al~~  146 (204)
T PRK13538        126 PVRQLSAGQQRRVALARLWLT  146 (204)
T ss_pred             ChhhcCHHHHHHHHHHHHHhc
Confidence            346899999999999887764


No 100
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=75.33  E-value=1.9  Score=35.44  Aligned_cols=21  Identities=29%  Similarity=0.381  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|-.|+.
T Consensus       127 ~~~~LS~G~~qrv~la~al~~  147 (211)
T cd03264         127 KIGSLSGGMRRRVGIAQALVG  147 (211)
T ss_pred             chhhCCHHHHHHHHHHHHHhc
Confidence            336899999999999987764


No 101
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=75.31  E-value=2.1  Score=36.16  Aligned_cols=21  Identities=38%  Similarity=0.468  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||..++.
T Consensus       128 ~~~~LS~G~~qrl~la~al~~  148 (241)
T PRK14250        128 DVKNLSGGEAQRVSIARTLAN  148 (241)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999988763


No 102
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]
Probab=75.29  E-value=1.8  Score=38.54  Aligned_cols=23  Identities=30%  Similarity=0.429  Sum_probs=19.5

Q ss_pred             cccccCCcchHHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      +..++||||||+++++|=.+|+.
T Consensus       105 ryPhelSGGQrQRi~IARALal~  127 (268)
T COG4608         105 RYPHELSGGQRQRIGIARALALN  127 (268)
T ss_pred             cCCcccCchhhhhHHHHHHHhhC
Confidence            34479999999999999988874


No 103
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=75.19  E-value=2  Score=35.24  Aligned_cols=20  Identities=25%  Similarity=0.328  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..+++|..++.
T Consensus       128 ~~~LS~G~~qr~~laral~~  147 (213)
T cd03301         128 PKQLSGGQRQRVALGRAIVR  147 (213)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            36899999999999987764


No 104
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=75.18  E-value=1.8  Score=35.70  Aligned_cols=20  Identities=40%  Similarity=0.398  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.++++|..|+.
T Consensus       131 ~~~LS~G~~qrv~la~al~~  150 (220)
T cd03263         131 ARTLSGGMKRKLSLAIALIG  150 (220)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            46899999999999987764


No 105
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=75.14  E-value=2.1  Score=35.18  Aligned_cols=19  Identities=42%  Similarity=0.515  Sum_probs=16.7

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..||||||..+++|..++.
T Consensus       127 ~~LS~G~~qrv~ia~al~~  145 (211)
T cd03298         127 GELSGGERQRVALARVLVR  145 (211)
T ss_pred             ccCCHHHHHHHHHHHHHhc
Confidence            4899999999999988864


No 106
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (for
Probab=75.11  E-value=2.3  Score=35.86  Aligned_cols=23  Identities=22%  Similarity=0.465  Sum_probs=19.1

Q ss_pred             ccccCCcchHHHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL~~  190 (199)
                      ....||||||+++.++.++|++.
T Consensus       123 ~~~~LS~G~~q~~~i~~~la~~~  145 (213)
T cd03277         123 DPHHQSGGERSVSTMLYLLSLQE  145 (213)
T ss_pred             chhhccccHHHHHHHHHHHHHHh
Confidence            44689999999999998888653


No 107
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=75.11  E-value=2  Score=36.17  Aligned_cols=21  Identities=29%  Similarity=0.396  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||..++.
T Consensus       141 ~~~~LS~Gq~qrv~la~al~~  161 (250)
T PRK11264        141 YPRRLSGGQQQRVAIARALAM  161 (250)
T ss_pred             ChhhCChHHHHHHHHHHHHhc
Confidence            456899999999999988764


No 108
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=75.07  E-value=1.7  Score=35.76  Aligned_cols=21  Identities=14%  Similarity=0.221  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|--++.
T Consensus       133 ~~~~LS~G~~qrv~laral~~  153 (218)
T cd03266         133 RVGGFSTGMRQKVAIARALVH  153 (218)
T ss_pred             hhhhcCHHHHHHHHHHHHHhc
Confidence            456899999999999987764


No 109
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).
Probab=74.97  E-value=1.9  Score=40.36  Aligned_cols=22  Identities=36%  Similarity=0.406  Sum_probs=18.9

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +.+..||||||++++||..++.
T Consensus       399 ~~~~~LSgGqkqrv~la~al~~  420 (500)
T TIGR02633       399 LPIGRLSGGNQQKAVLAKMLLT  420 (500)
T ss_pred             CccccCCHHHHHHHHHHHHHhh
Confidence            4567899999999999998874


No 110
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=74.86  E-value=2  Score=35.71  Aligned_cols=20  Identities=40%  Similarity=0.414  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+++++|..++.
T Consensus       144 ~~~LS~Ge~qrl~la~al~~  163 (228)
T PRK10584        144 PAQLSGGEQQRVALARAFNG  163 (228)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            35899999999999987764


No 111
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=74.86  E-value=1.9  Score=39.37  Aligned_cols=21  Identities=19%  Similarity=0.371  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       130 ~~~~LSgGq~QRvaLAraL~~  150 (369)
T PRK11000        130 KPKALSGGQRQRVAIGRTLVA  150 (369)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999988764


No 112
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=74.75  E-value=2  Score=40.46  Aligned_cols=23  Identities=22%  Similarity=0.258  Sum_probs=19.2

Q ss_pred             ccccccCCcchHHHHHHHHHHHH
Q psy12760        166 WKSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       166 ~~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+....||||||++++||-.|+.
T Consensus       404 ~~~~~~LSgGq~qrv~lAral~~  426 (510)
T PRK09700        404 NQNITELSGGNQQKVLISKWLCC  426 (510)
T ss_pred             cCccccCChHHHHHHHHHHHHhc
Confidence            34567899999999999988764


No 113
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]
Probab=74.72  E-value=1.7  Score=38.12  Aligned_cols=20  Identities=30%  Similarity=0.541  Sum_probs=16.0

Q ss_pred             cccccCCcchHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVF  186 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIf  186 (199)
                      +.--.|||||+++.|+|=-+
T Consensus       132 ~~aG~LSGGEQQMLAiaRAL  151 (237)
T COG0410         132 QRAGTLSGGEQQMLAIARAL  151 (237)
T ss_pred             CcccCCChHHHHHHHHHHHH
Confidence            44568999999999998543


No 114
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=74.68  E-value=2  Score=36.01  Aligned_cols=21  Identities=29%  Similarity=0.377  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||..+++|..++.
T Consensus       139 ~~~~LSgG~~qrv~laral~~  159 (224)
T cd03220         139 PVKTYSSGMKARLAFAIATAL  159 (224)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999887764


No 115
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=74.65  E-value=2  Score=36.06  Aligned_cols=21  Identities=19%  Similarity=0.335  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.++.
T Consensus       129 ~~~~LS~G~~qrl~laral~~  149 (236)
T TIGR03864       129 KVRELNGGHRRRVEIARALLH  149 (236)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            345899999999999988774


No 116
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=74.62  E-value=2.1  Score=35.37  Aligned_cols=21  Identities=33%  Similarity=0.433  Sum_probs=17.1

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++++|-.++.
T Consensus       142 ~~~~LS~G~~qrv~laral~~  162 (228)
T cd03257         142 YPHELSGGQRQRVAIARALAL  162 (228)
T ss_pred             CchhcCHHHHHHHHHHHHHhc
Confidence            346899999999999877653


No 117
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=74.57  E-value=2.1  Score=38.00  Aligned_cols=22  Identities=41%  Similarity=0.424  Sum_probs=18.8

Q ss_pred             ccccCCcchHHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      ....||||||.+++||-.++..
T Consensus       162 ~~~~LSgGqkqrvalA~aL~~~  183 (305)
T PRK13651        162 SPFELSGGQKRRVALAGILAME  183 (305)
T ss_pred             ChhhCCHHHHHHHHHHHHHHhC
Confidence            4568999999999999988753


No 118
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=74.49  E-value=2  Score=40.67  Aligned_cols=22  Identities=27%  Similarity=0.362  Sum_probs=18.7

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||++++||-.++.
T Consensus       152 ~~~~~LSgGe~qrv~iAraL~~  173 (529)
T PRK15134        152 DYPHQLSGGERQRVMIAMALLT  173 (529)
T ss_pred             hCCcccCHHHHHHHHHHHHHhc
Confidence            3557999999999999988874


No 119
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=74.44  E-value=2.3  Score=36.05  Aligned_cols=21  Identities=33%  Similarity=0.382  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       146 ~~~~LSgGq~qrv~laral~~  166 (253)
T PRK14242        146 SALGLSGGQQQRLCIARALAV  166 (253)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999887764


No 120
>PRK10636 putative ABC transporter ATP-binding protein; Provisional
Probab=74.35  E-value=1.8  Score=42.28  Aligned_cols=21  Identities=38%  Similarity=0.412  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||++++||-.++.
T Consensus       427 ~~~~LSgGekqRl~La~~l~~  447 (638)
T PRK10636        427 ETRRFSGGEKARLVLALIVWQ  447 (638)
T ss_pred             chhhCCHHHHHHHHHHHHHhc
Confidence            446799999999999988764


No 121
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit. This model describes spermidine/putrescine ABC transporter, ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Polyamines like spermidine and putrescine play vital role in cell proliferation, differentiation, and ion homeostasis. The concentration of polyamines within the cell are regulated by biosynthesis, degradation and transport (uptake and efflux included).
Probab=74.33  E-value=2  Score=38.37  Aligned_cols=20  Identities=30%  Similarity=0.424  Sum_probs=17.3

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||++++||-.++.
T Consensus        98 ~~~LSgGq~qRvalaraL~~  117 (325)
T TIGR01187        98 PHQLSGGQQQRVALARALVF  117 (325)
T ss_pred             hhhCCHHHHHHHHHHHHHHh
Confidence            46899999999999988764


No 122
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=74.32  E-value=2  Score=40.42  Aligned_cols=22  Identities=41%  Similarity=0.466  Sum_probs=19.0

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +.+..||||||++++||..|+.
T Consensus       401 ~~~~~LSgG~kqrv~lA~al~~  422 (506)
T PRK13549        401 LAIARLSGGNQQKAVLAKCLLL  422 (506)
T ss_pred             cccccCCHHHHHHHHHHHHHhh
Confidence            4567999999999999988874


No 123
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT. This ATP-binding component of an ABC transport system is found in Salmonella and Burkholderia lineages in the vicinity of enzymes for the breakdown of 2-aminoethylphosphonate.
Probab=74.00  E-value=2.1  Score=39.20  Aligned_cols=21  Identities=29%  Similarity=0.302  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++|||--++.
T Consensus       134 ~~~~LSgGq~QRvaLARAL~~  154 (362)
T TIGR03258       134 LPAQLSGGMQQRIAIARAIAI  154 (362)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999988764


No 124
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional
Probab=74.00  E-value=2.1  Score=38.60  Aligned_cols=20  Identities=25%  Similarity=0.282  Sum_probs=17.6

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ..+||||||++++||-.++.
T Consensus       159 p~~LSgG~~QRv~iArAL~~  178 (331)
T PRK15079        159 PHEFSGGQCQRIGIARALIL  178 (331)
T ss_pred             cccCCHHHHHHHHHHHHHhc
Confidence            46899999999999988875


No 125
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=73.99  E-value=2.3  Score=35.06  Aligned_cols=21  Identities=43%  Similarity=0.406  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.++.
T Consensus       128 ~~~~LS~G~~qrv~la~al~~  148 (214)
T cd03297         128 YPAQLSGGEKQRVALARALAA  148 (214)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            346899999999999987764


No 126
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=73.84  E-value=2  Score=36.88  Aligned_cols=20  Identities=45%  Similarity=0.501  Sum_probs=16.7

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ...+|||||++++|||=-||
T Consensus       143 yP~qLSGGEQQRVAiARAfa  162 (228)
T COG4181         143 YPAQLSGGEQQRVALARAFA  162 (228)
T ss_pred             CccccCchHHHHHHHHHHhc
Confidence            34699999999999997665


No 127
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=73.73  E-value=2.5  Score=34.10  Aligned_cols=21  Identities=38%  Similarity=0.464  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|-.++.
T Consensus        94 ~~~~LS~G~~qrl~laral~~  114 (180)
T cd03214          94 PFNELSGGERQRVLLARALAQ  114 (180)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            346899999999999987764


No 128
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=73.65  E-value=2.4  Score=35.20  Aligned_cols=21  Identities=29%  Similarity=0.287  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       136 ~~~~LS~G~~~rv~la~al~~  156 (229)
T cd03254         136 NGGNLSQGERQLLAIARAMLR  156 (229)
T ss_pred             CCCcCCHHHHHHHHHHHHHhc
Confidence            356899999999999988764


No 129
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=73.57  E-value=2.1  Score=37.67  Aligned_cols=21  Identities=33%  Similarity=0.352  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||++++||..++.
T Consensus       132 ~~~~LSgG~~qrv~la~al~~  152 (303)
T TIGR01288       132 RVALLSGGMKRRLTLARALIN  152 (303)
T ss_pred             chhhCCHHHHHHHHHHHHHhc
Confidence            446899999999999987763


No 130
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional
Probab=73.56  E-value=2.4  Score=35.83  Aligned_cols=21  Identities=29%  Similarity=0.417  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       145 ~~~~LS~G~~qrv~laral~~  165 (252)
T PRK14272        145 PATGLSGGQQQRLCIARALAV  165 (252)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            356899999999999987664


No 131
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=73.56  E-value=2.2  Score=40.34  Aligned_cols=22  Identities=23%  Similarity=0.351  Sum_probs=18.8

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||++++||-.++.
T Consensus       421 ~~~~~LSgG~~qrv~la~al~~  442 (529)
T PRK15134        421 RYPAEFSGGQRQRIAIARALIL  442 (529)
T ss_pred             cCCccCCHHHHHHHHHHHHHhC
Confidence            4567899999999999988874


No 132
>PRK10908 cell division protein FtsE; Provisional
Probab=73.51  E-value=2.4  Score=35.21  Aligned_cols=20  Identities=30%  Similarity=0.240  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.++++|-.++.
T Consensus       135 ~~~LS~G~~qrv~laral~~  154 (222)
T PRK10908        135 PIQLSGGEQQRVGIARAVVN  154 (222)
T ss_pred             chhCCHHHHHHHHHHHHHHc
Confidence            36899999999999987764


No 133
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=73.50  E-value=2.3  Score=37.42  Aligned_cols=21  Identities=43%  Similarity=0.577  Sum_probs=17.9

Q ss_pred             cccccCCcchHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfA  187 (199)
                      +....|||||++++.+|=.+|
T Consensus       131 R~y~~LSGGEqQRVqlARvLa  151 (259)
T COG4559         131 RDYRTLSGGEQQRVQLARVLA  151 (259)
T ss_pred             cchhhcCchHHHHHHHHHHHH
Confidence            345689999999999998887


No 134
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=73.50  E-value=2.2  Score=35.19  Aligned_cols=21  Identities=29%  Similarity=0.417  Sum_probs=17.1

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|-.++.
T Consensus       129 ~~~~LS~G~~qrv~laral~~  149 (222)
T cd03224         129 LAGTLSGGEQQMLAIARALMS  149 (222)
T ss_pred             chhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999977753


No 135
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=73.37  E-value=2.2  Score=35.72  Aligned_cols=21  Identities=19%  Similarity=0.398  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++.
T Consensus       134 ~~~~LS~G~~qrl~la~al~~  154 (237)
T PRK11614        134 RAGTMSGGEQQMLAIGRALMS  154 (237)
T ss_pred             chhhCCHHHHHHHHHHHHHHh
Confidence            345899999999999988764


No 136
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=73.35  E-value=2.4  Score=34.75  Aligned_cols=20  Identities=30%  Similarity=0.444  Sum_probs=17.1

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..+++|..++.
T Consensus       133 ~~~LS~G~~qrv~la~al~~  152 (213)
T cd03262         133 PAQLSGGQQQRVAIARALAM  152 (213)
T ss_pred             ccccCHHHHHHHHHHHHHhc
Confidence            46899999999999887764


No 137
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=73.34  E-value=2.4  Score=37.95  Aligned_cols=21  Identities=38%  Similarity=0.434  Sum_probs=18.0

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       173 ~~~~LSgGqkqRvaiAraL~~  193 (320)
T PRK13631        173 SPFGLSGGQKRRVAIAGILAI  193 (320)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            346899999999999988875


No 138
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=73.33  E-value=2.3  Score=35.44  Aligned_cols=21  Identities=24%  Similarity=0.271  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++.
T Consensus       128 ~~~~LS~G~~qrv~la~al~~  148 (230)
T TIGR03410       128 RGGDLSGGQQQQLAIARALVT  148 (230)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            446899999999999887764


No 139
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional
Probab=73.27  E-value=2.4  Score=40.07  Aligned_cols=23  Identities=22%  Similarity=0.267  Sum_probs=19.4

Q ss_pred             ccccccCCcchHHHHHHHHHHHH
Q psy12760        166 WKSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       166 ~~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+....||||||++++||..++.
T Consensus       398 ~~~~~~LSgG~kqrl~la~al~~  420 (510)
T PRK15439        398 EQAARTLSGGNQQKVLIAKCLEA  420 (510)
T ss_pred             cCccccCCcHHHHHHHHHHHHhh
Confidence            34567999999999999988764


No 140
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=73.23  E-value=2.5  Score=36.88  Aligned_cols=21  Identities=38%  Similarity=0.300  Sum_probs=18.2

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       142 ~~~~LSgGq~qrl~laral~~  162 (287)
T PRK13641        142 SPFELSGGQMRRVAIAGVMAY  162 (287)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            456899999999999988875


No 141
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=73.22  E-value=2.2  Score=34.76  Aligned_cols=21  Identities=24%  Similarity=0.275  Sum_probs=17.1

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.++.
T Consensus       124 ~~~~LS~G~~qrv~la~al~~  144 (198)
T TIGR01189       124 PAAQLSAGQQRRLALARLWLS  144 (198)
T ss_pred             ChhhcCHHHHHHHHHHHHHhc
Confidence            346899999999999877664


No 142
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=73.07  E-value=2.3  Score=35.23  Aligned_cols=21  Identities=29%  Similarity=0.328  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||..+++|..++.
T Consensus       134 ~~~~LS~G~~qrv~laral~~  154 (214)
T PRK13543        134 LVRQLSAGQKKRLALARLWLS  154 (214)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999988764


No 143
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=73.05  E-value=2.3  Score=35.72  Aligned_cols=20  Identities=35%  Similarity=0.468  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.+++||-.++.
T Consensus       134 ~~~LS~G~~qrl~la~al~~  153 (239)
T cd03296         134 PAQLSGGQRQRVALARALAV  153 (239)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            46899999999999987765


No 144
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=72.98  E-value=3.3  Score=34.44  Aligned_cols=23  Identities=48%  Similarity=0.469  Sum_probs=18.3

Q ss_pred             ccccCCcchHHHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL~~  190 (199)
                      ....|||||+.++++|+.+|+..
T Consensus       112 ~~~~LS~G~~~~~~la~rlala~  134 (204)
T cd03240         112 MRGRCSGGEKVLASLIIRLALAE  134 (204)
T ss_pred             CccccCccHHHHHHHHHHHHHHH
Confidence            45689999999998887776643


No 145
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=72.96  E-value=2.6  Score=35.88  Aligned_cols=21  Identities=19%  Similarity=0.162  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|-.|+.
T Consensus       148 ~~~~LS~Gq~qrl~laral~~  168 (258)
T PRK11701        148 LPTTFSGGMQQRLQIARNLVT  168 (258)
T ss_pred             CCccCCHHHHHHHHHHHHHhc
Confidence            446899999999999987763


No 146
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=72.95  E-value=2.4  Score=35.68  Aligned_cols=20  Identities=25%  Similarity=0.350  Sum_probs=17.1

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..+++|-.|+.
T Consensus       139 ~~~LS~G~~qrv~laral~~  158 (242)
T PRK11124        139 PLHLSGGQQQRVAIARALMM  158 (242)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            35899999999999987764


No 147
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=72.92  E-value=2.2  Score=40.11  Aligned_cols=23  Identities=30%  Similarity=0.214  Sum_probs=19.3

Q ss_pred             ccccccCCcchHHHHHHHHHHHH
Q psy12760        166 WKSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       166 ~~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+....||||||+++++|..++.
T Consensus       391 ~~~~~~LSgGq~qrl~la~al~~  413 (501)
T PRK11288        391 EQLIMNLSGGNQQKAILGRWLSE  413 (501)
T ss_pred             cCccccCCHHHHHHHHHHHHHcc
Confidence            34667999999999999998763


No 148
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=72.87  E-value=2.5  Score=36.46  Aligned_cols=20  Identities=40%  Similarity=0.448  Sum_probs=16.8

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.+++||-.++.
T Consensus       158 ~~~LS~Gq~qrv~lAral~~  177 (269)
T cd03294         158 PDELSGGMQQRVGLARALAV  177 (269)
T ss_pred             cccCCHHHHHHHHHHHHHhc
Confidence            35899999999999987763


No 149
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=72.86  E-value=2.3  Score=34.86  Aligned_cols=21  Identities=24%  Similarity=0.332  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++.
T Consensus       122 ~~~~LS~G~~qrl~laral~~  142 (201)
T cd03231         122 PVAQLSAGQQRRVALARLLLS  142 (201)
T ss_pred             chhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999988764


No 150
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria.
Probab=72.86  E-value=2.2  Score=38.76  Aligned_cols=21  Identities=33%  Similarity=0.365  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...+||||||++++||--||.
T Consensus       137 ~~~~LSgGqkQRV~IARAL~~  157 (343)
T TIGR02314       137 YPSNLSGGQKQRVAIARALAS  157 (343)
T ss_pred             ChhhCCHHHHHHHHHHHHHHh
Confidence            346899999999999988774


No 151
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.79  E-value=2.6  Score=35.73  Aligned_cols=21  Identities=29%  Similarity=0.409  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       147 ~~~~LSgG~~qrv~laral~~  167 (254)
T PRK14273        147 NALSLSGGQQQRLCIARTLAI  167 (254)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            456899999999999887763


No 152
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=72.70  E-value=2.6  Score=34.78  Aligned_cols=19  Identities=32%  Similarity=0.478  Sum_probs=16.8

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..||||||..+++|..++.
T Consensus       127 ~~LS~G~~qrl~laral~~  145 (213)
T TIGR01277       127 EQLSGGQRQRVALARCLVR  145 (213)
T ss_pred             ccCCHHHHHHHHHHHHHhc
Confidence            4899999999999988764


No 153
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=72.64  E-value=2.5  Score=37.90  Aligned_cols=21  Identities=29%  Similarity=0.279  Sum_probs=18.0

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...+||||||++++||--++.
T Consensus       150 ~p~~LSgGq~QRv~iArAL~~  170 (326)
T PRK11022        150 YPHQLSGGMSQRVMIAMAIAC  170 (326)
T ss_pred             CchhCCHHHHHHHHHHHHHHh
Confidence            346899999999999988875


No 154
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.64  E-value=2.6  Score=35.67  Aligned_cols=22  Identities=41%  Similarity=0.460  Sum_probs=18.5

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||.+++||-.++.
T Consensus       143 ~~~~~LS~Gq~qrv~laral~~  164 (251)
T PRK14249        143 KSGLALSGGQQQRLCIARVLAI  164 (251)
T ss_pred             CCcccCCHHHHHHHHHHHHHhc
Confidence            3556899999999999988864


No 155
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional
Probab=72.60  E-value=2.6  Score=37.85  Aligned_cols=20  Identities=25%  Similarity=0.421  Sum_probs=17.5

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ..+||||||++++||.-++.
T Consensus       152 p~~LSgGq~QRv~iArAL~~  171 (327)
T PRK11308        152 PHMFSGGQRQRIAIARALML  171 (327)
T ss_pred             CccCCHHHHHHHHHHHHHHc
Confidence            46899999999999988775


No 156
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=72.58  E-value=2.6  Score=34.94  Aligned_cols=20  Identities=30%  Similarity=0.318  Sum_probs=17.1

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.+++||-.++.
T Consensus       148 ~~~LSgG~~qrv~laral~~  167 (226)
T cd03248         148 GSQLSGGQKQRVAIARALIR  167 (226)
T ss_pred             CCcCCHHHHHHHHHHHHHhc
Confidence            56899999999999987763


No 157
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional
Probab=72.55  E-value=2.2  Score=38.83  Aligned_cols=20  Identities=20%  Similarity=0.285  Sum_probs=16.9

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||++++||--++.
T Consensus       132 ~~~LSgGq~QRvalARAL~~  151 (356)
T PRK11650        132 PRELSGGQRQRVAMGRAIVR  151 (356)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            35899999999999987763


No 158
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=72.53  E-value=2.4  Score=35.32  Aligned_cols=21  Identities=33%  Similarity=0.317  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.|+.
T Consensus       137 ~~~~LS~G~~qrv~la~al~~  157 (233)
T cd03258         137 YPAQLSGGQKQRVGIARALAN  157 (233)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999987763


No 159
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.51  E-value=2.6  Score=35.66  Aligned_cols=21  Identities=33%  Similarity=0.407  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.++.
T Consensus       143 ~~~~LS~G~~qrv~laral~~  163 (250)
T PRK14245        143 SAFALSGGQQQRLCIARAMAV  163 (250)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            446899999999999987763


No 160
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=72.43  E-value=2.6  Score=35.26  Aligned_cols=21  Identities=29%  Similarity=0.279  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|..++.
T Consensus       136 ~~~~LS~G~~qrv~la~al~~  156 (238)
T cd03249         136 RGSQLSGGQKQRIAIARALLR  156 (238)
T ss_pred             CCccCCHHHHHHHHHHHHHhc
Confidence            346899999999999988764


No 161
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=72.40  E-value=2.7  Score=35.20  Aligned_cols=19  Identities=32%  Similarity=0.433  Sum_probs=16.4

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..||||||..+++|..++.
T Consensus       128 ~~LS~G~~qrv~laral~~  146 (232)
T PRK10771        128 GQLSGGQRQRVALARCLVR  146 (232)
T ss_pred             ccCCHHHHHHHHHHHHHhc
Confidence            5899999999999987664


No 162
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=72.39  E-value=2.4  Score=37.27  Aligned_cols=21  Identities=19%  Similarity=0.294  Sum_probs=17.2

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||+++++|.-|+-
T Consensus       121 ~~~~LSgG~~qrv~la~al~~  141 (302)
T TIGR01188       121 PVGTYSGGMRRRLDIAASLIH  141 (302)
T ss_pred             chhhCCHHHHHHHHHHHHHhc
Confidence            446899999999999877653


No 163
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=72.37  E-value=2.6  Score=36.81  Aligned_cols=21  Identities=43%  Similarity=0.393  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       141 ~~~~LSgGq~qrv~iAraL~~  161 (287)
T PRK13637        141 SPFELSGGQKRRVAIAGVVAM  161 (287)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            446899999999999988765


No 164
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=72.37  E-value=2.4  Score=36.38  Aligned_cols=20  Identities=35%  Similarity=0.415  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+.+++|..++.
T Consensus       126 ~~~LSgGq~qrl~laral~~  145 (255)
T PRK11248        126 IWQLSGGQRQRVGIARALAA  145 (255)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            46899999999999988764


No 165
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional
Probab=72.23  E-value=2.5  Score=36.34  Aligned_cols=20  Identities=30%  Similarity=0.308  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+.++||..++.
T Consensus       147 ~~~LS~G~~qrv~laral~~  166 (267)
T PRK15112        147 PHMLAPGQKQRLGLARALIL  166 (267)
T ss_pred             chhcCHHHHHHHHHHHHHHh
Confidence            46899999999999988764


No 166
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional
Probab=72.22  E-value=2.5  Score=38.51  Aligned_cols=20  Identities=35%  Similarity=0.589  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+++|||--++.
T Consensus       134 ~~~LSgGq~QRVaLARaL~~  153 (351)
T PRK11432        134 VDQISGGQQQRVALARALIL  153 (351)
T ss_pred             hhhCCHHHHHHHHHHHHHHc
Confidence            46899999999999987764


No 167
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=72.22  E-value=2.7  Score=36.69  Aligned_cols=22  Identities=23%  Similarity=0.327  Sum_probs=18.7

Q ss_pred             ccccCCcchHHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      ....||||||.+++||-.++..
T Consensus       142 ~~~~LSgGq~qrv~laraL~~~  163 (286)
T PRK13646        142 SPFQMSGGQMRKIAIVSILAMN  163 (286)
T ss_pred             CcccCCHHHHHHHHHHHHHHhC
Confidence            4568999999999999888753


No 168
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=72.17  E-value=2.4  Score=38.21  Aligned_cols=21  Identities=33%  Similarity=0.343  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       137 ~~~~LSgGq~qRv~lAraL~~  157 (343)
T PRK11153        137 YPAQLSGGQKQRVAIARALAS  157 (343)
T ss_pred             ChhhCCHHHHHHHHHHHHHHc
Confidence            346899999999999987764


No 169
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=72.01  E-value=2.6  Score=38.12  Aligned_cols=20  Identities=30%  Similarity=0.393  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||++++||-.++.
T Consensus       126 ~~~LSgGq~qRvalaraL~~  145 (352)
T PRK11144        126 PGSLSGGEKQRVAIGRALLT  145 (352)
T ss_pred             cccCCHHHHHHHHHHHHHHc
Confidence            46899999999999987764


No 170
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.00  E-value=2.8  Score=35.94  Aligned_cols=21  Identities=33%  Similarity=0.363  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|..++.
T Consensus       147 ~~~~LSgGq~qrv~laral~~  167 (261)
T PRK14258        147 SALDLSGGQQQRLCIARALAV  167 (261)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            446899999999999988763


No 171
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional
Probab=72.00  E-value=2.6  Score=35.96  Aligned_cols=21  Identities=29%  Similarity=0.385  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.|+.
T Consensus       151 ~~~~LSgG~~qrv~laral~~  171 (258)
T PRK14268        151 PALSLSGGQQQRLCIARTLAV  171 (258)
T ss_pred             ChhhCCHHHHHHHHHHHHHHc
Confidence            456899999999999988765


No 172
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=71.98  E-value=2.7  Score=34.25  Aligned_cols=20  Identities=40%  Similarity=0.396  Sum_probs=16.9

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..+++|-.++.
T Consensus       132 ~~~lS~G~~qr~~laral~~  151 (206)
T TIGR03608       132 IYELSGGEQQRVALARAILK  151 (206)
T ss_pred             hhhCCHHHHHHHHHHHHHHc
Confidence            46799999999999887763


No 173
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional
Probab=71.97  E-value=2.7  Score=36.73  Aligned_cols=21  Identities=33%  Similarity=0.224  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       177 ~~~~LSgGe~qrv~LAraL~~  197 (285)
T PRK14254        177 SGLDLSGGQQQRLCIARAIAP  197 (285)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            346899999999999988763


No 174
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=71.94  E-value=2.7  Score=35.78  Aligned_cols=22  Identities=32%  Similarity=0.377  Sum_probs=18.0

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||..+++|-.++.
T Consensus       144 ~~~~~LS~G~~qrv~laral~~  165 (258)
T PRK14241        144 KPGGGLSGGQQQRLCIARAIAV  165 (258)
T ss_pred             CCcccCCHHHHHHHHHHHHHhc
Confidence            3456899999999999987764


No 175
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=71.77  E-value=2.7  Score=36.63  Aligned_cols=21  Identities=43%  Similarity=0.422  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       147 ~~~~LS~Gq~qrv~laral~~  167 (289)
T PRK13645        147 SPFELSGGQKRRVALAGIIAM  167 (289)
T ss_pred             ChhhCCHHHHHHHHHHHHHHh
Confidence            456899999999999987764


No 176
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=71.67  E-value=2.9  Score=35.28  Aligned_cols=21  Identities=38%  Similarity=0.406  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++.
T Consensus       145 ~~~~LS~G~~qrv~laral~~  165 (252)
T PRK14239        145 SALGLSGGQQQRVCIARVLAT  165 (252)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            446899999999999987763


No 177
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=71.66  E-value=2  Score=39.26  Aligned_cols=14  Identities=43%  Similarity=0.669  Sum_probs=12.5

Q ss_pred             ccCCcchHHHHHHH
Q psy12760        170 DCLSGGEKTLASLA  183 (199)
Q Consensus       170 ~~LSGGEKSlaaLa  183 (199)
                      ..||||||+.+|++
T Consensus       127 ~~LSGGEkQRVAIG  140 (352)
T COG4148         127 GTLSGGEKQRVAIG  140 (352)
T ss_pred             CccCcchhhHHHHH
Confidence            46999999999986


No 178
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=71.65  E-value=2.8  Score=35.70  Aligned_cols=21  Identities=29%  Similarity=0.335  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       152 ~~~~LS~Gq~qrv~laral~~  172 (259)
T PRK14274        152 QALSLSGGQQQRLCIARALAT  172 (259)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999988764


No 179
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein. This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter.
Probab=71.56  E-value=2.6  Score=38.12  Aligned_cols=20  Identities=30%  Similarity=0.341  Sum_probs=17.3

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||++++||-.++.
T Consensus       129 ~~~LSgGqkqRvalAraL~~  148 (354)
T TIGR02142       129 PGRLSGGEKQRVAIGRALLS  148 (354)
T ss_pred             hhhCCHHHHHHHHHHHHHHc
Confidence            46899999999999988764


No 180
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=71.56  E-value=2.8  Score=36.69  Aligned_cols=21  Identities=38%  Similarity=0.350  Sum_probs=18.1

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       142 ~~~~LSgGq~qrv~lAraL~~  162 (290)
T PRK13634        142 SPFELSGGQMRRVAIAGVLAM  162 (290)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            456899999999999988875


No 181
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=71.53  E-value=2.5  Score=35.61  Aligned_cols=21  Identities=29%  Similarity=0.305  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+.+++|-.++.
T Consensus       132 ~~~~LS~G~~qrv~laral~~  152 (242)
T cd03295         132 YPHELSGGQQQRVGVARALAA  152 (242)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999887663


No 182
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=71.49  E-value=2.5  Score=39.77  Aligned_cols=22  Identities=27%  Similarity=0.392  Sum_probs=18.8

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||+++++|-.++.
T Consensus       391 ~~~~~LSgGekqrv~lA~al~~  412 (501)
T PRK10762        391 QAIGLLSGGNQQKVAIARGLMT  412 (501)
T ss_pred             CchhhCCHHHHHHHHHHHHHhh
Confidence            4567899999999999988764


No 183
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional
Probab=71.39  E-value=2.9  Score=35.31  Aligned_cols=21  Identities=38%  Similarity=0.488  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||..++.
T Consensus       145 ~~~~LS~Gq~qrv~laral~~  165 (252)
T PRK14255        145 SALSLSGGQQQRVCIARVLAV  165 (252)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456999999999999987764


No 184
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=71.39  E-value=2.7  Score=35.52  Aligned_cols=21  Identities=14%  Similarity=0.139  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       150 ~~~~LS~G~~qrv~la~al~~  170 (255)
T PRK11300        150 QAGNLAYGQQRRLEIARCMVT  170 (255)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            446899999999999987764


No 185
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional
Probab=71.34  E-value=3  Score=35.34  Aligned_cols=21  Identities=33%  Similarity=0.352  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||..++.
T Consensus       144 ~~~~LS~G~~qrv~laral~~  164 (251)
T PRK14270        144 SALKLSGGQQQRLCIARTIAV  164 (251)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999988763


No 186
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed
Probab=71.27  E-value=2.5  Score=38.89  Aligned_cols=20  Identities=25%  Similarity=0.290  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+++|||--++.
T Consensus       142 p~~LSgGq~QRVaLARaL~~  161 (375)
T PRK09452        142 PHQLSGGQQQRVAIARAVVN  161 (375)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            36899999999999987764


No 187
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=71.20  E-value=2.7  Score=35.60  Aligned_cols=21  Identities=29%  Similarity=0.381  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+.++||-.++.
T Consensus       146 ~~~~LS~G~~qrv~laral~~  166 (253)
T PRK14267        146 YPSNLSGGQRQRLVIARALAM  166 (253)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            456899999999999987764


No 188
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=71.15  E-value=2.7  Score=40.94  Aligned_cols=22  Identities=27%  Similarity=0.395  Sum_probs=18.8

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||++++||-.++.
T Consensus       459 ~~~~~LSgGqrQRv~iAraL~~  480 (623)
T PRK10261        459 RYPHEFSGGQRQRICIARALAL  480 (623)
T ss_pred             CCcccCCHHHHHHHHHHHHHhc
Confidence            3557999999999999988874


No 189
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=71.10  E-value=3.1  Score=34.67  Aligned_cols=21  Identities=29%  Similarity=0.469  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++.
T Consensus       140 ~~~~LS~G~~qrl~laral~~  160 (226)
T cd03234         140 LVKGISGGERRRVSIAVQLLW  160 (226)
T ss_pred             cccCcCHHHHHHHHHHHHHHh
Confidence            456899999999999988775


No 190
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein. This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.
Probab=70.97  E-value=2.6  Score=38.32  Aligned_cols=21  Identities=33%  Similarity=0.354  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++|||--++.
T Consensus       131 ~~~~LSgGq~QRvaLARaL~~  151 (353)
T TIGR03265       131 YPGQLSGGQQQRVALARALAT  151 (353)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999987764


No 191
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=70.93  E-value=2.1  Score=37.93  Aligned_cols=25  Identities=24%  Similarity=0.473  Sum_probs=20.4

Q ss_pred             CCcccccccCCcchHHHHHHHHHHH
Q psy12760        163 RKSWKSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       163 gk~~~~l~~LSGGEKSlaaLalIfA  187 (199)
                      .+.++..+.|||||++++|+|=.++
T Consensus       139 ~~A~qra~~LSGGQQQRVaIARaL~  163 (258)
T COG3638         139 DKAYQRASTLSGGQQQRVAIARALV  163 (258)
T ss_pred             HHHHHHhccCCcchhHHHHHHHHHh
Confidence            3567788899999999999996543


No 192
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=70.88  E-value=2.8  Score=35.38  Aligned_cols=21  Identities=29%  Similarity=0.355  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..|+.
T Consensus       143 ~~~~LS~Gq~qr~~la~al~~  163 (250)
T PRK14262        143 PGTRLSGGQQQRLCIARALAV  163 (250)
T ss_pred             ChhhcCHHHHHHHHHHHHHhC
Confidence            456899999999999988764


No 193
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=70.81  E-value=2.8  Score=35.19  Aligned_cols=21  Identities=19%  Similarity=0.286  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++.
T Consensus       140 ~~~~LS~Ge~qrv~laral~~  160 (242)
T TIGR03411       140 LAGLLSHGQKQWLEIGMLLMQ  160 (242)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            446899999999999987764


No 194
>PRK14235 phosphate transporter ATP-binding protein; Provisional
Probab=70.79  E-value=3.1  Score=35.82  Aligned_cols=21  Identities=29%  Similarity=0.343  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       160 ~~~~LSgGq~qrv~laral~~  180 (267)
T PRK14235        160 PGTGLSGGQQQRLCIARAIAV  180 (267)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            456899999999999988764


No 195
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=70.71  E-value=3.2  Score=35.48  Aligned_cols=21  Identities=33%  Similarity=0.322  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       153 ~~~~LS~Gq~qrv~laral~~  173 (260)
T PRK10744        153 SGYSLSGGQQQRLCIARGIAI  173 (260)
T ss_pred             CCCCCCHHHHHHHHHHHHHHC
Confidence            446899999999999988764


No 196
>PRK09700 D-allose transporter ATP-binding protein; Provisional
Probab=70.56  E-value=2.6  Score=39.64  Aligned_cols=21  Identities=24%  Similarity=0.271  Sum_probs=18.0

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       142 ~~~~LSgG~~qrv~ia~al~~  162 (510)
T PRK09700        142 KVANLSISHKQMLEIAKTLML  162 (510)
T ss_pred             chhhCCHHHHHHHHHHHHHhc
Confidence            456899999999999988764


No 197
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=70.52  E-value=2.5  Score=41.16  Aligned_cols=21  Identities=38%  Similarity=0.555  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||++++||-.++.
T Consensus       437 ~~~~LSgGekqRl~la~al~~  457 (635)
T PRK11147        437 PVKALSGGERNRLLLARLFLK  457 (635)
T ss_pred             hhhhCCHHHHHHHHHHHHHhc
Confidence            345799999999999987764


No 198
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=70.51  E-value=2.9  Score=35.14  Aligned_cols=21  Identities=33%  Similarity=0.398  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++.
T Consensus       134 ~~~~LS~G~~qrv~laral~~  154 (241)
T PRK10895        134 MGQSLSGGERRRVEIARALAA  154 (241)
T ss_pred             chhhCCHHHHHHHHHHHHHhc
Confidence            446899999999999987753


No 199
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=70.49  E-value=3.1  Score=34.43  Aligned_cols=21  Identities=29%  Similarity=0.366  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.++.
T Consensus       146 ~~~~LS~G~~qrl~laral~~  166 (224)
T TIGR02324       146 PPATFSGGEQQRVNIARGFIA  166 (224)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            356899999999999987763


No 200
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional
Probab=70.48  E-value=2.8  Score=38.60  Aligned_cols=21  Identities=33%  Similarity=0.379  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++|||--++.
T Consensus       146 ~~~~LSgGq~QRVaLARAL~~  166 (377)
T PRK11607        146 KPHQLSGGQRQRVALARSLAK  166 (377)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            345899999999999988775


No 201
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=70.31  E-value=2.7  Score=39.69  Aligned_cols=22  Identities=41%  Similarity=0.375  Sum_probs=18.2

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||++++||-.++.
T Consensus       423 ~~~~~LSgGq~qrv~laral~~  444 (520)
T TIGR03269       423 KYPDELSEGERHRVALAQVLIK  444 (520)
T ss_pred             CChhhCCHHHHHHHHHHHHHhc
Confidence            3557899999999999987764


No 202
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA. This family consists of a single polypeptide chain transporter in the ATP-binding cassette (ABC) transporter family, MsbA, which exports lipid A. It may also act in multidrug resistance. Lipid A, a part of lipopolysaccharide, is found in the outer leaflet of the outer membrane of most Gram-negative bacteria. Members of this family are restricted to the Proteobacteria (although lipid A is more broadly distributed) and often are clustered with lipid A biosynthesis genes.
Probab=70.31  E-value=3.6  Score=38.95  Aligned_cols=27  Identities=22%  Similarity=0.348  Sum_probs=18.7

Q ss_pred             ceEEEEECCCCcccccccCCcchHHHHHHHHHH
Q psy12760        154 GIKYVVRPPRKSWKSIDCLSGGEKTLASLALVF  186 (199)
Q Consensus       154 GI~I~V~p~gk~~~~l~~LSGGEKSlaaLalIf  186 (199)
                      |++-.+...|      ..||||||++.+||=.+
T Consensus       458 gldt~i~~~g------~~LSgGqrQRiaLARal  484 (571)
T TIGR02203       458 GLDTPIGENG------VLLSGGQRQRLAIARAL  484 (571)
T ss_pred             cccceecCCC------CcCCHHHHHHHHHHHHH
Confidence            5555554333      46999999999988544


No 203
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=70.27  E-value=2.9  Score=34.98  Aligned_cols=23  Identities=48%  Similarity=0.878  Sum_probs=19.7

Q ss_pred             cccccCCcchHHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      .....||||||+.+++|..++++
T Consensus       154 ~~~~~lS~G~~~r~~la~~l~~~  176 (243)
T cd03272         154 QEMQQLSGGQKSLVALALIFAIQ  176 (243)
T ss_pred             ccccccCHHHHHHHHHHHHHHHh
Confidence            35568999999999999999874


No 204
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional
Probab=70.15  E-value=2.9  Score=37.60  Aligned_cols=21  Identities=19%  Similarity=0.238  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...+||||||++++||--++.
T Consensus       158 ~p~~LSgG~~QRv~IArAL~~  178 (330)
T PRK09473        158 YPHEFSGGMRQRVMIAMALLC  178 (330)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            346899999999999988775


No 205
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=70.13  E-value=2.9  Score=39.61  Aligned_cols=21  Identities=33%  Similarity=0.436  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||..++.
T Consensus       435 ~~~~LSgGq~qrv~la~al~~  455 (530)
T PRK15064        435 SVKVLSGGEKGRMLFGKLMMQ  455 (530)
T ss_pred             cccccCHHHHHHHHHHHHHhc
Confidence            456899999999999988764


No 206
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional
Probab=70.12  E-value=2.8  Score=39.30  Aligned_cols=21  Identities=19%  Similarity=0.311  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++++|-.|+.
T Consensus       131 ~~~~LSgGq~qrv~lA~al~~  151 (491)
T PRK10982        131 KVATLSVSQMQMIEIAKAFSY  151 (491)
T ss_pred             chhhCCHHHHHHHHHHHHHHh
Confidence            457899999999999988764


No 207
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=70.10  E-value=3.1  Score=36.21  Aligned_cols=21  Identities=38%  Similarity=0.494  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|..++.
T Consensus       142 ~~~~LSgG~~qrv~laral~~  162 (272)
T PRK13547        142 DVTTLSGGELARVQFARVLAQ  162 (272)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999988874


No 208
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=70.02  E-value=3  Score=34.98  Aligned_cols=20  Identities=30%  Similarity=0.431  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.++++|-.|+.
T Consensus       134 ~~~LS~G~~qrv~la~al~~  153 (240)
T PRK09493        134 PSELSGGQQQRVAIARALAV  153 (240)
T ss_pred             hhhcCHHHHHHHHHHHHHhc
Confidence            36899999999999988764


No 209
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=69.90  E-value=2.7  Score=39.57  Aligned_cols=21  Identities=19%  Similarity=0.298  Sum_probs=18.0

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||+++++|-.|+.
T Consensus       140 ~~~~LSgGqkqrv~la~al~~  160 (506)
T PRK13549        140 PVGNLGLGQQQLVEIAKALNK  160 (506)
T ss_pred             chhhCCHHHHHHHHHHHHHhc
Confidence            457899999999999988764


No 210
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional
Probab=69.85  E-value=3.1  Score=37.29  Aligned_cols=21  Identities=24%  Similarity=0.113  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...+||||||+.++||--++.
T Consensus       155 ~p~~LSgG~~QRv~iArAL~~  175 (330)
T PRK15093        155 FPYELTEGECQKVMIAIALAN  175 (330)
T ss_pred             CchhCCHHHHHHHHHHHHHHC
Confidence            346999999999999987765


No 211
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=69.85  E-value=2.9  Score=38.14  Aligned_cols=21  Identities=33%  Similarity=0.414  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      -..+||||+|+++.+|.-+|+
T Consensus       150 YPhelSGGMrQRV~IAmala~  170 (316)
T COG0444         150 YPHELSGGMRQRVMIAMALAL  170 (316)
T ss_pred             CCcccCCcHHHHHHHHHHHhC
Confidence            336999999999999988875


No 212
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=69.82  E-value=3.4  Score=34.91  Aligned_cols=21  Identities=33%  Similarity=0.382  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.++.
T Consensus       143 ~~~~LS~G~~qrv~laral~~  163 (250)
T PRK14240        143 SALGLSGGQQQRLCIARALAV  163 (250)
T ss_pred             CCCCCCHHHHHHHHHHHHHhc
Confidence            456899999999999987764


No 213
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=69.73  E-value=2.8  Score=40.09  Aligned_cols=21  Identities=29%  Similarity=0.430  Sum_probs=18.0

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||++++||-.|+.
T Consensus       160 ~~~~LSgGqkqrv~la~al~~  180 (556)
T PRK11819        160 KVTKLSGGERRRVALCRLLLE  180 (556)
T ss_pred             chhhcCHHHHHHHHHHHHHhC
Confidence            456899999999999988763


No 214
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=69.73  E-value=3.3  Score=34.52  Aligned_cols=20  Identities=35%  Similarity=0.247  Sum_probs=17.1

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..++||-.++.
T Consensus       135 ~~~LS~G~~~rl~la~aL~~  154 (236)
T cd03253         135 GLKLSGGEKQRVAIARAILK  154 (236)
T ss_pred             CCcCCHHHHHHHHHHHHHhc
Confidence            46899999999999987764


No 215
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=69.72  E-value=3  Score=35.79  Aligned_cols=21  Identities=33%  Similarity=0.351  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.++.
T Consensus       117 ~~~~LSgGq~qrv~laral~~  137 (251)
T PRK09544        117 PMQKLSGGETQRVLLARALLN  137 (251)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            356899999999999987764


No 216
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.
Probab=69.72  E-value=3.1  Score=35.69  Aligned_cols=21  Identities=29%  Similarity=0.300  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|-.++.
T Consensus       147 ~~~~LSgGe~qrv~laral~~  167 (265)
T TIGR02769       147 LPRQLSGGQLQRINIARALAV  167 (265)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            446899999999999887763


No 217
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional
Probab=69.63  E-value=2.9  Score=39.52  Aligned_cols=21  Identities=10%  Similarity=0.109  Sum_probs=18.2

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||..|+.
T Consensus       137 ~~~~LSgG~~qrv~la~aL~~  157 (510)
T PRK15439        137 SAGSLEVADRQIVEILRGLMR  157 (510)
T ss_pred             ChhhCCHHHHHHHHHHHHHHc
Confidence            456899999999999988874


No 218
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=69.59  E-value=2.5  Score=40.40  Aligned_cols=15  Identities=33%  Similarity=0.233  Sum_probs=12.9

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.|||=
T Consensus       484 ~~LSGGQrQRialAR  498 (588)
T PRK11174        484 AGLSVGQAQRLALAR  498 (588)
T ss_pred             CCCCHHHHHHHHHHH
Confidence            369999999999883


No 219
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=69.56  E-value=3.1  Score=33.91  Aligned_cols=21  Identities=24%  Similarity=0.316  Sum_probs=17.2

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++-
T Consensus       120 ~~~~LS~G~~~rl~la~al~~  140 (195)
T PRK13541        120 KCYSLSSGMQKIVAIARLIAC  140 (195)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999887764


No 220
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional
Probab=69.40  E-value=3.1  Score=35.18  Aligned_cols=21  Identities=33%  Similarity=0.343  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+.+++|..|+.
T Consensus       146 ~~~~LS~Gq~qrv~laral~~  166 (251)
T PRK14244        146 SAFELSGGQQQRLCIARAIAV  166 (251)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999987764


No 221
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=69.39  E-value=3.4  Score=35.17  Aligned_cols=21  Identities=43%  Similarity=0.449  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++++|..++.
T Consensus       123 ~~~~LS~G~~qrv~la~al~~  143 (248)
T PRK03695        123 SVNQLSGGEWQRVRLAAVVLQ  143 (248)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            446899999999999988774


No 222
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=69.37  E-value=3.2  Score=35.18  Aligned_cols=20  Identities=30%  Similarity=0.444  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.++++|..++.
T Consensus       144 ~~~LS~G~~qrv~laral~~  163 (252)
T TIGR03005       144 PAQLSGGQQQRVAIARALAM  163 (252)
T ss_pred             hhhcCHHHHHHHHHHHHHHc
Confidence            36899999999999987764


No 223
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional
Probab=69.35  E-value=3.5  Score=34.89  Aligned_cols=21  Identities=29%  Similarity=0.417  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|-.++.
T Consensus       139 ~~~~LS~G~~qrv~laral~~  159 (246)
T PRK14269        139 NALALSGGQQQRLCIARALAI  159 (246)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            345899999999999987764


No 224
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family. Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown.
Probab=69.35  E-value=2.9  Score=39.89  Aligned_cols=21  Identities=29%  Similarity=0.447  Sum_probs=18.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||++++||-.|+.
T Consensus       158 ~~~~LSgGqkqrv~la~al~~  178 (552)
T TIGR03719       158 DVTKLSGGERRRVALCRLLLS  178 (552)
T ss_pred             chhhcCHHHHHHHHHHHHHhc
Confidence            557999999999999988864


No 225
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional
Probab=69.30  E-value=3.6  Score=35.46  Aligned_cols=21  Identities=33%  Similarity=0.344  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||..++.
T Consensus       148 ~~~~LS~Ge~qrl~laral~~  168 (268)
T PRK10419        148 RPPQLSGGQLQRVCLARALAV  168 (268)
T ss_pred             CCccCChHHHHHHHHHHHHhc
Confidence            445899999999999988774


No 226
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=69.27  E-value=3.4  Score=35.64  Aligned_cols=21  Identities=43%  Similarity=0.428  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||..++.
T Consensus       139 ~~~~LSgG~~qrv~laraL~~  159 (272)
T PRK15056        139 QIGELSGGQKKRVFLARAIAQ  159 (272)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            345799999999999987764


No 227
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=69.24  E-value=3.5  Score=35.40  Aligned_cols=20  Identities=45%  Similarity=0.687  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..++||-.++.
T Consensus       145 ~~~LSgG~~qrv~laral~~  164 (265)
T PRK10575        145 VDSLSGGERQRAWIAMLVAQ  164 (265)
T ss_pred             cccCCHHHHHHHHHHHHHhc
Confidence            35899999999999987764


No 228
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=69.22  E-value=3.4  Score=32.35  Aligned_cols=18  Identities=39%  Similarity=0.613  Sum_probs=16.4

Q ss_pred             CCcchHHHHHHHHHHHHH
Q psy12760        172 LSGGEKTLASLALVFALH  189 (199)
Q Consensus       172 LSGGEKSlaaLalIfAL~  189 (199)
                      |||||+.++++|..++..
T Consensus        81 lS~G~~~r~~l~~~l~~~   98 (157)
T cd00267          81 LSGGQRQRVALARALLLN   98 (157)
T ss_pred             CCHHHHHHHHHHHHHhcC
Confidence            999999999999988864


No 229
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=69.19  E-value=3.5  Score=33.97  Aligned_cols=21  Identities=29%  Similarity=0.264  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+.+++|-.++.
T Consensus       136 ~~~~LS~G~~qr~~laral~~  156 (221)
T cd03244         136 GGENLSVGQRQLLCLARALLR  156 (221)
T ss_pred             CCCcCCHHHHHHHHHHHHHhc
Confidence            446899999999999988764


No 230
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]
Probab=69.08  E-value=2.9  Score=40.54  Aligned_cols=21  Identities=29%  Similarity=0.390  Sum_probs=18.1

Q ss_pred             ccccccCCcchHHHHHHHHHH
Q psy12760        166 WKSIDCLSGGEKTLASLALVF  186 (199)
Q Consensus       166 ~~~l~~LSGGEKSlaaLalIf  186 (199)
                      .+++..||||||..++||=.|
T Consensus       148 ~~~~~~LSGG~r~Rv~LA~aL  168 (530)
T COG0488         148 DRPVSSLSGGWRRRVALARAL  168 (530)
T ss_pred             cCchhhcCHHHHHHHHHHHHH
Confidence            467889999999999999664


No 231
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=69.06  E-value=3.5  Score=34.28  Aligned_cols=20  Identities=25%  Similarity=0.227  Sum_probs=17.5

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||+.++||-.++.
T Consensus       136 ~~~LS~G~~qrv~la~al~~  155 (234)
T cd03251         136 GVKLSGGQRQRIAIARALLK  155 (234)
T ss_pred             CCcCCHHHHHHHHHHHHHhc
Confidence            46899999999999988875


No 232
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family. Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown.
Probab=68.94  E-value=3  Score=39.79  Aligned_cols=21  Identities=33%  Similarity=0.455  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|..++.
T Consensus       440 ~~~~LSgGe~qrv~la~al~~  460 (552)
T TIGR03719       440 KVGQLSGGERNRVHLAKTLKS  460 (552)
T ss_pred             chhhCCHHHHHHHHHHHHHhh
Confidence            446899999999999987764


No 233
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional
Probab=68.90  E-value=3.6  Score=34.69  Aligned_cols=21  Identities=29%  Similarity=0.335  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       142 ~~~~LS~G~~qrv~laral~~  162 (249)
T PRK14253        142 HAFGLSGGQQQRLCIARTIAM  162 (249)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            446899999999999987764


No 234
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=68.74  E-value=3.5  Score=33.97  Aligned_cols=21  Identities=29%  Similarity=0.401  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++.
T Consensus       115 ~~~~LS~Ge~qrl~laral~~  135 (202)
T cd03233         115 FVRGISGGERKRVSIAEALVS  135 (202)
T ss_pred             chhhCCHHHHHHHHHHHHHhh
Confidence            446899999999999987765


No 235
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional
Probab=68.69  E-value=3.6  Score=35.29  Aligned_cols=21  Identities=33%  Similarity=0.430  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       161 ~~~~LSgGq~qrl~laral~~  181 (268)
T PRK14248        161 SALSLSGGQQQRLCIARTLAM  181 (268)
T ss_pred             CcccCCHHHHHHHHHHHHHhC
Confidence            456899999999999988764


No 236
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=68.66  E-value=3.7  Score=34.59  Aligned_cols=22  Identities=36%  Similarity=0.323  Sum_probs=18.5

Q ss_pred             ccccCCcchHHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      ....||||||+.+++|-.++..
T Consensus       134 ~~~~LSgG~~qrv~laral~~~  155 (226)
T cd03270         134 SAPTLSGGEAQRIRLATQIGSG  155 (226)
T ss_pred             ccCcCCHHHHHHHHHHHHHHhC
Confidence            4468999999999999888754


No 237
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit. This model describes the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits these transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L.lact
Probab=68.58  E-value=3.1  Score=38.18  Aligned_cols=21  Identities=38%  Similarity=0.349  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||--++.
T Consensus       126 ~p~~LSGGq~QRV~lARAL~~  146 (363)
T TIGR01186       126 YPDELSGGMQQRVGLARALAA  146 (363)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            345899999999999987763


No 238
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=68.42  E-value=3.6  Score=34.99  Aligned_cols=21  Identities=33%  Similarity=0.387  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||..++.
T Consensus       149 ~~~~LS~G~~qrv~laral~~  169 (257)
T PRK10619        149 YPVHLSGGQQQRVSIARALAM  169 (257)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999987764


No 239
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=68.38  E-value=3.2  Score=34.97  Aligned_cols=20  Identities=25%  Similarity=0.268  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.++++|..++.
T Consensus       151 ~~~LS~G~~qrl~la~al~~  170 (236)
T cd03267         151 VRQLSLGQRMRAEIAAALLH  170 (236)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            45799999999999988764


No 240
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).
Probab=68.33  E-value=3.1  Score=38.97  Aligned_cols=21  Identities=19%  Similarity=0.387  Sum_probs=18.0

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++++|-.|+.
T Consensus       138 ~~~~LSgG~~qrv~iA~al~~  158 (500)
T TIGR02633       138 PVGDYGGGQQQLVEIAKALNK  158 (500)
T ss_pred             chhhCCHHHHHHHHHHHHHhh
Confidence            456899999999999988775


No 241
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=68.18  E-value=3.8  Score=34.83  Aligned_cols=21  Identities=43%  Similarity=0.572  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|--++.
T Consensus       135 ~~~~LS~G~~qrv~laral~~  155 (255)
T PRK11231        135 RLTDLSGGQRQRAFLAMVLAQ  155 (255)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            346899999999999987765


No 242
>PRK11147 ABC transporter ATPase component; Reviewed
Probab=68.14  E-value=3.2  Score=40.46  Aligned_cols=22  Identities=27%  Similarity=0.315  Sum_probs=18.7

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +.+..||||||++++||-.|+.
T Consensus       152 ~~~~~LSgGekqRv~LAraL~~  173 (635)
T PRK11147        152 AALSSLSGGWLRKAALGRALVS  173 (635)
T ss_pred             CchhhcCHHHHHHHHHHHHHhc
Confidence            3567999999999999988764


No 243
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=68.06  E-value=3.5  Score=34.43  Aligned_cols=18  Identities=33%  Similarity=0.410  Sum_probs=15.7

Q ss_pred             cCCcchHHHHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALVFAL  188 (199)
Q Consensus       171 ~LSGGEKSlaaLalIfAL  188 (199)
                      .||||||+++++|-.++.
T Consensus       144 ~LS~G~~qrl~la~al~~  161 (243)
T TIGR01978       144 GFSGGEKKRNEILQMALL  161 (243)
T ss_pred             CcCHHHHHHHHHHHHHhc
Confidence            599999999999987764


No 244
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=67.94  E-value=3.1  Score=39.09  Aligned_cols=21  Identities=29%  Similarity=0.417  Sum_probs=18.0

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.|+.
T Consensus       138 ~~~~LSgG~~qrv~la~al~~  158 (501)
T PRK10762        138 LVGELSIGEQQMVEIAKVLSF  158 (501)
T ss_pred             chhhCCHHHHHHHHHHHHHhc
Confidence            456899999999999988764


No 245
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=67.88  E-value=3.7  Score=33.61  Aligned_cols=20  Identities=25%  Similarity=0.305  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..++||-.++.
T Consensus       125 ~~~LS~G~~~rv~laral~~  144 (200)
T PRK13540        125 CGLLSSGQKRQVALLRLWMS  144 (200)
T ss_pred             hhhcCHHHHHHHHHHHHHhc
Confidence            35799999999999988765


No 246
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=67.79  E-value=3.2  Score=38.78  Aligned_cols=22  Identities=23%  Similarity=0.280  Sum_probs=18.5

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||.++++|-.++.
T Consensus       397 ~~~~~LSgGq~qrv~la~al~~  418 (490)
T PRK10938        397 APFHSLSWGQQRLALIVRALVK  418 (490)
T ss_pred             CchhhCCHHHHHHHHHHHHHhc
Confidence            4567999999999999987764


No 247
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=67.79  E-value=3.1  Score=34.67  Aligned_cols=21  Identities=24%  Similarity=0.156  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||..+++|..|+.
T Consensus       101 ~~~~lS~G~~qrv~la~al~~  121 (213)
T PRK15177        101 RVSEYSVTMKTHLAFAINLLL  121 (213)
T ss_pred             hHhhcCHHHHHHHHHHHHHhc
Confidence            446799999999999988764


No 248
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=67.76  E-value=3.1  Score=34.47  Aligned_cols=21  Identities=19%  Similarity=0.128  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++.
T Consensus       121 ~~~~LS~G~~~rv~laral~~  141 (223)
T TIGR03740       121 KAKQFSLGMKQRLGIAIALLN  141 (223)
T ss_pred             hHhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999887764


No 249
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=67.75  E-value=3.9  Score=34.92  Aligned_cols=21  Identities=24%  Similarity=0.434  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       149 ~~~~LS~G~~qrv~laral~~  169 (262)
T PRK09984        149 RVSTLSGGQQQRVAIARALMQ  169 (262)
T ss_pred             CccccCHHHHHHHHHHHHHhc
Confidence            345899999999999987764


No 250
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=67.64  E-value=3.7  Score=33.02  Aligned_cols=17  Identities=41%  Similarity=0.649  Sum_probs=15.3

Q ss_pred             CCcchHHHHHHHHHHHH
Q psy12760        172 LSGGEKTLASLALVFAL  188 (199)
Q Consensus       172 LSGGEKSlaaLalIfAL  188 (199)
                      ||||||.++++|..++.
T Consensus       101 lS~G~~qr~~la~al~~  117 (178)
T cd03229         101 LSGGQQQRVALARALAM  117 (178)
T ss_pred             CCHHHHHHHHHHHHHHC
Confidence            99999999999988764


No 251
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]
Probab=67.60  E-value=3.9  Score=39.88  Aligned_cols=21  Identities=33%  Similarity=0.423  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ..++||||||+++.+|--+|.
T Consensus       151 yPheLSGG~rQRv~iAmALa~  171 (539)
T COG1123         151 YPHQLSGGMRQRVMIAMALAL  171 (539)
T ss_pred             CCcccCchHHHHHHHHHHHhC
Confidence            447999999999999876664


No 252
>PLN03073 ABC transporter F family; Provisional
Probab=67.44  E-value=3.5  Score=41.18  Aligned_cols=21  Identities=29%  Similarity=0.370  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||..++.
T Consensus       624 ~~~~LSgGqkqRvaLAraL~~  644 (718)
T PLN03073        624 PMYTLSGGQKSRVAFAKITFK  644 (718)
T ss_pred             CccccCHHHHHHHHHHHHHhc
Confidence            456899999999999987764


No 253
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional
Probab=67.39  E-value=3.7  Score=34.71  Aligned_cols=21  Identities=24%  Similarity=0.453  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       144 ~~~~LS~Gq~qr~~laral~~  164 (251)
T PRK14251        144 NAQAFSGGQQQRICIARALAV  164 (251)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            456999999999999877753


No 254
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional
Probab=67.37  E-value=4  Score=35.38  Aligned_cols=21  Identities=29%  Similarity=0.393  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||..|+.
T Consensus       158 ~~~~LSgGq~qrv~LAraL~~  178 (274)
T PRK14265        158 KGTALSGGQQQRLCIARAIAM  178 (274)
T ss_pred             CcccCCHHHHHHHHHHHHHhh
Confidence            456899999999999988764


No 255
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=67.28  E-value=3.9  Score=35.29  Aligned_cols=21  Identities=33%  Similarity=0.374  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.|+.
T Consensus       151 ~~~~LS~G~~qrl~laral~~  171 (269)
T PRK14259        151 SGYSLSGGQQQRLCIARTIAI  171 (269)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999887764


No 256
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=67.27  E-value=4  Score=35.44  Aligned_cols=20  Identities=35%  Similarity=0.512  Sum_probs=17.3

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.+++||-.|+.
T Consensus       142 ~~~LS~G~~qrv~laral~~  161 (280)
T PRK13633        142 PHLLSGGQKQRVAIAGILAM  161 (280)
T ss_pred             cccCCHHHHHHHHHHHHHHc
Confidence            46899999999999988764


No 257
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.
Probab=67.26  E-value=2.9  Score=39.35  Aligned_cols=15  Identities=47%  Similarity=0.558  Sum_probs=12.9

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.|+|=
T Consensus       469 ~~LSGGQrQRiaiAR  483 (529)
T TIGR02868       469 ARLSGGERQRLALAR  483 (529)
T ss_pred             CcCCHHHHHHHHHHH
Confidence            469999999999883


No 258
>cd03299 ABC_ModC_like Archeal protein closely related to ModC.  ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=67.19  E-value=4  Score=34.29  Aligned_cols=19  Identities=32%  Similarity=0.574  Sum_probs=16.3

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..||||||..++||..++.
T Consensus       128 ~~LS~G~~qrl~laral~~  146 (235)
T cd03299         128 ETLSGGEQQRVAIARALVV  146 (235)
T ss_pred             ccCCHHHHHHHHHHHHHHc
Confidence            5799999999999987664


No 259
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=67.08  E-value=4.1  Score=32.68  Aligned_cols=20  Identities=30%  Similarity=0.350  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.++++|-.++.
T Consensus        96 ~~~LS~G~~qrv~laral~~  115 (178)
T cd03247          96 GRRFSGGERQRLALARILLQ  115 (178)
T ss_pred             cccCCHHHHHHHHHHHHHhc
Confidence            56899999999999987764


No 260
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=67.07  E-value=4.1  Score=34.93  Aligned_cols=21  Identities=48%  Similarity=0.705  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       140 ~~~~LS~Gq~qrv~laral~~  160 (265)
T PRK10253        140 SVDTLSGGQRQRAWIAMVLAQ  160 (265)
T ss_pred             CcccCChHHHHHHHHHHHHhc
Confidence            446899999999999987764


No 261
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=66.95  E-value=4.1  Score=35.21  Aligned_cols=21  Identities=29%  Similarity=0.395  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|..++.
T Consensus       164 ~~~~LSgGe~qrv~laraL~~  184 (271)
T PRK14238        164 NAYGLSGGQQQRLCIARCLAI  184 (271)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            456899999999999988764


No 262
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=66.92  E-value=4.3  Score=32.46  Aligned_cols=20  Identities=35%  Similarity=0.411  Sum_probs=16.8

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ....||||||.++++|-.++
T Consensus        88 ~~~~LS~G~~~rv~laral~  107 (166)
T cd03223          88 WDDVLSGGEQQRLAFARLLL  107 (166)
T ss_pred             CCCCCCHHHHHHHHHHHHHH
Confidence            34689999999999987765


No 263
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein. This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Probab=66.92  E-value=4.2  Score=34.61  Aligned_cols=21  Identities=33%  Similarity=0.498  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|-.++.
T Consensus       134 ~~~~LS~G~~qrl~la~al~~  154 (256)
T TIGR03873       134 DMSTLSGGERQRVHVARALAQ  154 (256)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            346899999999999988775


No 264
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional
Probab=66.90  E-value=3.8  Score=38.13  Aligned_cols=21  Identities=38%  Similarity=0.431  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       161 ~~~~LSgGq~QRv~LArAL~~  181 (400)
T PRK10070        161 YPDELSGGMRQRVGLARALAI  181 (400)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            335899999999999987764


No 265
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional
Probab=66.88  E-value=3.5  Score=38.73  Aligned_cols=21  Identities=24%  Similarity=0.389  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||+++++|-.++.
T Consensus       137 ~~~~LSgGq~qrv~laral~~  157 (501)
T PRK11288        137 PLKYLSIGQRQMVEIAKALAR  157 (501)
T ss_pred             chhhCCHHHHHHHHHHHHHHh
Confidence            456899999999999987764


No 266
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=66.88  E-value=3.8  Score=39.94  Aligned_cols=22  Identities=23%  Similarity=0.342  Sum_probs=18.5

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||++++||-.|+.
T Consensus       164 ~~~~~LSgGq~QRv~iA~AL~~  185 (623)
T PRK10261        164 RYPHQLSGGMRQRVMIAMALSC  185 (623)
T ss_pred             CCCccCCHHHHHHHHHHHHHhC
Confidence            3557899999999999988774


No 267
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=66.81  E-value=3.9  Score=32.70  Aligned_cols=17  Identities=41%  Similarity=0.434  Sum_probs=15.5

Q ss_pred             CCcchHHHHHHHHHHHH
Q psy12760        172 LSGGEKTLASLALVFAL  188 (199)
Q Consensus       172 LSGGEKSlaaLalIfAL  188 (199)
                      ||||||.++++|..++.
T Consensus        96 LS~G~~qrv~laral~~  112 (173)
T cd03230          96 LSGGMKQRLALAQALLH  112 (173)
T ss_pred             cCHHHHHHHHHHHHHHc
Confidence            99999999999988874


No 268
>KOG0056|consensus
Probab=66.73  E-value=2.8  Score=41.19  Aligned_cols=14  Identities=50%  Similarity=0.605  Sum_probs=12.3

Q ss_pred             cCCcchHHHHHHHH
Q psy12760        171 CLSGGEKTLASLAL  184 (199)
Q Consensus       171 ~LSGGEKSlaaLal  184 (199)
                      -||||||+++|+|=
T Consensus       674 kLSGGEKQRVAiAR  687 (790)
T KOG0056|consen  674 KLSGGEKQRVAIAR  687 (790)
T ss_pred             ccCCcchhhHHHHH
Confidence            49999999999973


No 269
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=66.70  E-value=4.2  Score=34.41  Aligned_cols=21  Identities=29%  Similarity=0.344  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       145 ~~~~LS~G~~qrl~laral~~  165 (252)
T PRK14256        145 NAMELSGGQQQRLCIARTIAV  165 (252)
T ss_pred             CcCcCCHHHHHHHHHHHHHhc
Confidence            456899999999999987763


No 270
>PRK10636 putative ABC transporter ATP-binding protein; Provisional
Probab=66.64  E-value=3.2  Score=40.61  Aligned_cols=22  Identities=23%  Similarity=0.317  Sum_probs=18.7

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +.+..||||||.+++||-.|+.
T Consensus       145 ~~~~~LSgGerqRv~LA~aL~~  166 (638)
T PRK10636        145 RPVSDFSGGWRMRLNLAQALIC  166 (638)
T ss_pred             CchhhcCHHHHHHHHHHHHHcc
Confidence            3567899999999999988764


No 271
>PRK14243 phosphate transporter ATP-binding protein; Provisional
Probab=66.63  E-value=4.1  Score=34.97  Aligned_cols=21  Identities=33%  Similarity=0.341  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       148 ~~~~LSgGq~qrv~laral~~  168 (264)
T PRK14243        148 SGLSLSGGQQQRLCIARAIAV  168 (264)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999988764


No 272
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=66.45  E-value=3.8  Score=37.28  Aligned_cols=21  Identities=38%  Similarity=0.423  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||--++.
T Consensus       133 ~~~~LSgGq~QRvalArAL~~  153 (353)
T PRK10851        133 YPAQLSGGQKQRVALARALAV  153 (353)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346999999999999987753


No 273
>PRK15064 ABC transporter ATP-binding protein; Provisional
Probab=66.35  E-value=3.7  Score=38.86  Aligned_cols=21  Identities=19%  Similarity=0.029  Sum_probs=18.1

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||.+++||-.|+.
T Consensus       152 ~~~~LSgGq~qrv~lA~aL~~  172 (530)
T PRK15064        152 LMSEVAPGWKLRVLLAQALFS  172 (530)
T ss_pred             chhhcCHHHHHHHHHHHHHhc
Confidence            467999999999999988764


No 274
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional
Probab=66.30  E-value=4.4  Score=34.21  Aligned_cols=21  Identities=33%  Similarity=0.365  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|..++.
T Consensus       143 ~~~~LS~Gq~qrv~laral~~  163 (250)
T PRK14266        143 SALGLSGGQQQRLCIARTIAV  163 (250)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            346899999999999988774


No 275
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional
Probab=66.24  E-value=4.2  Score=34.59  Aligned_cols=21  Identities=24%  Similarity=0.104  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.++.
T Consensus       137 ~~~~LS~Gq~qrv~laral~~  157 (254)
T PRK10418        137 YPFEMSGGMLQRMMIALALLC  157 (254)
T ss_pred             CCcccCHHHHHHHHHHHHHhc
Confidence            446899999999999987764


No 276
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=66.23  E-value=4.2  Score=35.33  Aligned_cols=20  Identities=35%  Similarity=0.408  Sum_probs=17.3

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.+++||-.++.
T Consensus       138 ~~~LSgGq~qrv~lAral~~  157 (279)
T PRK13650        138 PARLSGGQKQRVAIAGAVAM  157 (279)
T ss_pred             cccCCHHHHHHHHHHHHHHc
Confidence            36899999999999988765


No 277
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=66.22  E-value=3.9  Score=33.70  Aligned_cols=20  Identities=30%  Similarity=0.395  Sum_probs=16.9

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..+++|..++.
T Consensus       125 ~~~LS~G~~qrl~la~al~~  144 (207)
T PRK13539        125 FGYLSAGQKRRVALARLLVS  144 (207)
T ss_pred             hhhcCHHHHHHHHHHHHHhc
Confidence            35899999999999887764


No 278
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=66.18  E-value=4.1  Score=35.33  Aligned_cols=21  Identities=33%  Similarity=0.286  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       135 ~~~~LSgG~~qrv~laraL~~  155 (274)
T PRK13647        135 PPYHLSYGQKKRVAIAGVLAM  155 (274)
T ss_pred             ChhhCCHHHHHHHHHHHHHHc
Confidence            345899999999999987764


No 279
>PRK13409 putative ATPase RIL; Provisional
Probab=66.10  E-value=3.7  Score=40.01  Aligned_cols=22  Identities=32%  Similarity=0.415  Sum_probs=18.5

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +.+..||||||++++||-.++.
T Consensus       208 ~~~~~LSgGe~qrv~ia~al~~  229 (590)
T PRK13409        208 RDISELSGGELQRVAIAAALLR  229 (590)
T ss_pred             CChhhCCHHHHHHHHHHHHHhc
Confidence            4567899999999999987763


No 280
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional
Probab=66.09  E-value=4  Score=35.66  Aligned_cols=21  Identities=29%  Similarity=0.344  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       179 ~~~~LSgGq~qrv~LAraL~~  199 (286)
T PRK14275        179 NALGLSGGQQQRLCVARTLAV  199 (286)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            456899999999999987764


No 281
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=65.91  E-value=5.9  Score=33.25  Aligned_cols=31  Identities=74%  Similarity=1.104  Sum_probs=23.3

Q ss_pred             ECCCCcccccccCCcchHHHHHHHHHHHHHH
Q psy12760        160 RPPRKSWKSIDCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       160 ~p~gk~~~~l~~LSGGEKSlaaLalIfAL~~  190 (199)
                      ..++...+....||||||.++++|..+++.+
T Consensus       116 ~L~~~~~~~~~~lS~G~~~r~~la~al~~~~  146 (212)
T cd03274         116 QMPKKSWKNISNLSGGEKTLSSLALVFALHH  146 (212)
T ss_pred             ccccccccchhhcCHHHHHHHHHHHHHHhcc
Confidence            3344444566789999999999999888753


No 282
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.
Probab=65.91  E-value=4.2  Score=34.00  Aligned_cols=21  Identities=29%  Similarity=0.404  Sum_probs=17.1

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.++.
T Consensus       110 ~~~~LS~G~~qrv~laral~~  130 (223)
T TIGR03771       110 PVGELSGGQRQRVLVARALAT  130 (223)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            345799999999999987664


No 283
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=65.90  E-value=4.6  Score=34.36  Aligned_cols=22  Identities=45%  Similarity=0.776  Sum_probs=18.8

Q ss_pred             ccccCCcchHHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      ....||||||+++++|..++..
T Consensus       163 ~~~~lS~G~~qr~~la~al~~~  184 (251)
T cd03273         163 SLTELSGGQRSLVALSLILALL  184 (251)
T ss_pred             cccccCHHHHHHHHHHHHHHHh
Confidence            4568999999999999988763


No 284
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=65.82  E-value=4.7  Score=33.17  Aligned_cols=21  Identities=33%  Similarity=0.347  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|-.++.
T Consensus        84 ~~~~LSgGq~qrl~laral~~  104 (176)
T cd03238          84 KLSTLSGGELQRVKLASELFS  104 (176)
T ss_pred             CcCcCCHHHHHHHHHHHHHhh
Confidence            456899999999999987765


No 285
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed
Probab=65.75  E-value=3.9  Score=39.15  Aligned_cols=20  Identities=35%  Similarity=0.531  Sum_probs=17.1

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ....||||||+.++||..++
T Consensus       442 ~~~~LSgG~~qrv~la~al~  461 (556)
T PRK11819        442 KVGVLSGGERNRLHLAKTLK  461 (556)
T ss_pred             chhhCCHHHHHHHHHHHHHh
Confidence            44689999999999998775


No 286
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=65.75  E-value=4.6  Score=35.01  Aligned_cols=20  Identities=45%  Similarity=0.537  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..++||-.++.
T Consensus       135 ~~~LS~Gq~qrl~laraL~~  154 (277)
T PRK13652        135 PHHLSGGEKKRVAIAGVIAM  154 (277)
T ss_pred             cccCCHHHHHHHHHHHHHHc
Confidence            45899999999999987765


No 287
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=65.56  E-value=4.2  Score=35.22  Aligned_cols=21  Identities=33%  Similarity=0.499  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....|||||+.++++|-.++.
T Consensus       134 ~~~~LS~Gq~qrv~laral~~  154 (275)
T PRK13639        134 PPHHLSGGQKKRVAIAGILAM  154 (275)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            346899999999999987764


No 288
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=65.55  E-value=4.4  Score=34.04  Aligned_cols=18  Identities=33%  Similarity=0.440  Sum_probs=15.6

Q ss_pred             cCCcchHHHHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALVFAL  188 (199)
Q Consensus       171 ~LSGGEKSlaaLalIfAL  188 (199)
                      .||||||..++||-.++-
T Consensus       145 ~LS~G~~qrv~laral~~  162 (248)
T PRK09580        145 GFSGGEKKRNDILQMAVL  162 (248)
T ss_pred             CCCHHHHHHHHHHHHHHc
Confidence            799999999999877654


No 289
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=65.55  E-value=4.4  Score=35.58  Aligned_cols=22  Identities=32%  Similarity=0.360  Sum_probs=18.4

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....|||||+++++||-.++-
T Consensus       165 ~~~~~LSgGe~QRl~LAraL~~  186 (261)
T cd03271         165 QPATTLSGGEAQRIKLAKELSK  186 (261)
T ss_pred             CccccCCHHHHHHHHHHHHHhc
Confidence            3456899999999999988775


No 290
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=65.36  E-value=4.6  Score=34.79  Aligned_cols=20  Identities=45%  Similarity=0.579  Sum_probs=16.8

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||++++||-.++.
T Consensus       140 ~~~LS~G~~qrl~laral~~  159 (271)
T PRK13632        140 PQNLSGGQKQRVAIASVLAL  159 (271)
T ss_pred             cccCCHHHHHHHHHHHHHHc
Confidence            36999999999999887764


No 291
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=65.31  E-value=4.2  Score=33.16  Aligned_cols=18  Identities=17%  Similarity=0.171  Sum_probs=15.8

Q ss_pred             cCCcchHHHHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALVFAL  188 (199)
Q Consensus       171 ~LSGGEKSlaaLalIfAL  188 (199)
                      .||||||.++++|-.++.
T Consensus       108 ~LSgGe~qrv~la~al~~  125 (192)
T cd03232         108 GLSVEQRKRLTIGVELAA  125 (192)
T ss_pred             cCCHHHhHHHHHHHHHhc
Confidence            799999999999887664


No 292
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=65.20  E-value=4.7  Score=34.96  Aligned_cols=21  Identities=38%  Similarity=0.457  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       137 ~~~~LS~G~~qrv~lAraL~~  157 (277)
T PRK13642        137 EPARLSGGQKQRVAVAGIIAL  157 (277)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            346899999999999988774


No 293
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=65.18  E-value=4.9  Score=32.90  Aligned_cols=21  Identities=29%  Similarity=0.196  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....|||||+..+++|-.++.
T Consensus       122 ~~~~LS~G~~qrv~laral~~  142 (207)
T cd03369         122 GGLNLSQGQRQLLCLARALLK  142 (207)
T ss_pred             CCCcCCHHHHHHHHHHHHHhh
Confidence            356899999999999988764


No 294
>KOG0055|consensus
Probab=65.12  E-value=3.5  Score=43.75  Aligned_cols=14  Identities=43%  Similarity=0.532  Sum_probs=13.0

Q ss_pred             ccCCcchHHHHHHH
Q psy12760        170 DCLSGGEKTLASLA  183 (199)
Q Consensus       170 ~~LSGGEKSlaaLa  183 (199)
                      .+||||||++.|+|
T Consensus      1125 ~QLSGGQKQRIAIA 1138 (1228)
T KOG0055|consen 1125 VQLSGGQKQRIAIA 1138 (1228)
T ss_pred             CcCCchHHHHHHHH
Confidence            58999999999997


No 295
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=65.04  E-value=4.3  Score=34.38  Aligned_cols=21  Identities=33%  Similarity=0.414  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       146 ~~~~LS~G~~qrv~laral~~  166 (253)
T PRK14261        146 SALSLSGGQQQRLCIARTLAV  166 (253)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            456899999999999887764


No 296
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed
Probab=64.99  E-value=4.2  Score=37.86  Aligned_cols=20  Identities=40%  Similarity=0.564  Sum_probs=17.3

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ....||||||++++||-.++
T Consensus       136 ~~~~LSgGerQRv~IArAL~  155 (402)
T PRK09536        136 PVTSLSGGERQRVLLARALA  155 (402)
T ss_pred             ChhhCCHHHHHHHHHHHHHH
Confidence            45689999999999998776


No 297
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=64.94  E-value=4.6  Score=34.97  Aligned_cols=20  Identities=30%  Similarity=0.461  Sum_probs=17.1

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||++++||-.++.
T Consensus       134 ~~~LS~G~~qrv~laral~~  153 (274)
T PRK13644        134 PKTLSGGQGQCVALAGILTM  153 (274)
T ss_pred             cccCCHHHHHHHHHHHHHHc
Confidence            46899999999999987764


No 298
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=64.91  E-value=5.4  Score=33.14  Aligned_cols=23  Identities=52%  Similarity=0.769  Sum_probs=19.4

Q ss_pred             cccccCCcchHHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      +....||||||..+++|..+|..
T Consensus       119 ~~~~~lS~G~~~r~~la~al~~~  141 (213)
T cd03279         119 RPVSTLSGGETFLASLSLALALS  141 (213)
T ss_pred             CCccccCHHHHHHHHHHHHHHhH
Confidence            34568999999999999999854


No 299
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=64.80  E-value=4.4  Score=32.40  Aligned_cols=17  Identities=35%  Similarity=0.403  Sum_probs=15.0

Q ss_pred             CCcchHHHHHHHHHHHH
Q psy12760        172 LSGGEKTLASLALVFAL  188 (199)
Q Consensus       172 LSGGEKSlaaLalIfAL  188 (199)
                      ||||||.++++|-.++.
T Consensus        97 LS~G~~qrv~la~al~~  113 (173)
T cd03246          97 LSGGQRQRLGLARALYG  113 (173)
T ss_pred             cCHHHHHHHHHHHHHhc
Confidence            99999999999987764


No 300
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=64.76  E-value=3.4  Score=39.38  Aligned_cols=16  Identities=31%  Similarity=0.416  Sum_probs=13.6

Q ss_pred             ccCCcchHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALV  185 (199)
Q Consensus       170 ~~LSGGEKSlaaLalI  185 (199)
                      ..||||||++.|+|=-
T Consensus       464 ~~LSgGQrQrlaiARa  479 (567)
T COG1132         464 VNLSGGQRQRLAIARA  479 (567)
T ss_pred             ccCCHHHHHHHHHHHH
Confidence            4799999999999843


No 301
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=64.40  E-value=5.3  Score=32.64  Aligned_cols=20  Identities=40%  Similarity=0.227  Sum_probs=17.1

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..+++|-.++.
T Consensus       125 ~~~lS~G~~qrv~laral~~  144 (204)
T cd03250         125 GINLSGGQKQRISLARAVYS  144 (204)
T ss_pred             CCcCCHHHHHHHHHHHHHhc
Confidence            45799999999999988764


No 302
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=64.17  E-value=4.9  Score=33.52  Aligned_cols=21  Identities=43%  Similarity=0.471  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       134 ~~~~LS~G~~qrv~laral~~  154 (225)
T PRK10247        134 NIAELSGGEKQRISLIRNLQF  154 (225)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            346899999999999887764


No 303
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=64.14  E-value=4.8  Score=33.04  Aligned_cols=19  Identities=32%  Similarity=0.515  Sum_probs=16.5

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..||||||..+++|-.++.
T Consensus       103 ~~LS~G~~qrv~laral~~  121 (200)
T cd03217         103 EGFSGGEKKRNEILQLLLL  121 (200)
T ss_pred             ccCCHHHHHHHHHHHHHhc
Confidence            5899999999999987764


No 304
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=64.11  E-value=5  Score=33.12  Aligned_cols=21  Identities=24%  Similarity=0.175  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       137 ~~~~LS~G~~qrv~laral~~  157 (218)
T cd03290         137 RGINLSGGQRQRICVARALYQ  157 (218)
T ss_pred             CCCcCCHHHHHHHHHHHHHhh
Confidence            356899999999999987764


No 305
>PRK14236 phosphate transporter ATP-binding protein; Provisional
Probab=64.06  E-value=5  Score=34.63  Aligned_cols=21  Identities=29%  Similarity=0.336  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||..++-
T Consensus       165 ~~~~LS~Gq~qrv~laral~~  185 (272)
T PRK14236        165 NAFGLSGGQQQRLVIARAIAI  185 (272)
T ss_pred             CcccCCHHHHHHHHHHHHHHC
Confidence            346899999999999987763


No 306
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional
Probab=63.57  E-value=5  Score=34.83  Aligned_cols=21  Identities=43%  Similarity=0.458  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.|+.
T Consensus       160 ~~~~LSgGq~qrl~LAral~~  180 (276)
T PRK14271        160 SPFRLSGGQQQLLCLARTLAV  180 (276)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999987764


No 307
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional
Probab=63.36  E-value=5.1  Score=34.77  Aligned_cols=21  Identities=10%  Similarity=0.254  Sum_probs=17.0

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||..++-
T Consensus       140 ~~~~LS~Gq~qrv~Laral~~  160 (264)
T PRK13546        140 PVKKYSSGMRAKLGFSINITV  160 (264)
T ss_pred             CcccCCHHHHHHHHHHHHHhh
Confidence            446899999999999876653


No 308
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=63.27  E-value=5.1  Score=32.79  Aligned_cols=18  Identities=44%  Similarity=0.578  Sum_probs=16.0

Q ss_pred             cCCcchHHHHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALVFAL  188 (199)
Q Consensus       171 ~LSGGEKSlaaLalIfAL  188 (199)
                      .||||||..++||-.++.
T Consensus       111 ~LS~G~~qrv~laral~~  128 (194)
T cd03213         111 GLSGGERKRVSIALELVS  128 (194)
T ss_pred             cCCHHHHHHHHHHHHHHc
Confidence            799999999999987764


No 309
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The DevBCA proteins are thought export of either heterocyst-specific glycolipids or an enzyme essential for formation of the laminated layer found in heterocysts.
Probab=62.88  E-value=4.7  Score=33.40  Aligned_cols=19  Identities=32%  Similarity=0.443  Sum_probs=16.3

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..||||||+.+++|-.++.
T Consensus       140 ~~lS~G~~qrv~laral~~  158 (220)
T TIGR02982       140 HNLSGGQKQRVAIARALVH  158 (220)
T ss_pred             hhCCHHHHHHHHHHHHHhc
Confidence            5899999999999987653


No 310
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional
Probab=62.79  E-value=5.3  Score=35.26  Aligned_cols=21  Identities=29%  Similarity=0.360  Sum_probs=17.8

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       197 ~~~~LSgGq~qrv~LAraL~~  217 (305)
T PRK14264        197 NALGLSGGQQQRLCIARCLAV  217 (305)
T ss_pred             ccccCCHHHHHHHHHHHHHhc
Confidence            346899999999999988774


No 311
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional
Probab=62.70  E-value=5.3  Score=34.08  Aligned_cols=21  Identities=33%  Similarity=0.398  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       147 ~~~~LS~G~~qrv~laral~~  167 (259)
T PRK14260        147 SALGLSGGQQQRLCIARALAI  167 (259)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            446899999999999987763


No 312
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=62.64  E-value=5  Score=38.21  Aligned_cols=15  Identities=33%  Similarity=0.457  Sum_probs=12.9

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.+||=
T Consensus       479 ~~LSGGqrQRi~LAR  493 (582)
T PRK11176        479 VLLSGGQRQRIAIAR  493 (582)
T ss_pred             CcCCHHHHHHHHHHH
Confidence            469999999999873


No 313
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=62.51  E-value=5.2  Score=32.95  Aligned_cols=17  Identities=35%  Similarity=0.444  Sum_probs=15.4

Q ss_pred             CCcchHHHHHHHHHHHH
Q psy12760        172 LSGGEKTLASLALVFAL  188 (199)
Q Consensus       172 LSGGEKSlaaLalIfAL  188 (199)
                      ||||||.++++|-.++.
T Consensus        72 LSgGq~qrv~laral~~   88 (177)
T cd03222          72 LSGGELQRVAIAAALLR   88 (177)
T ss_pred             CCHHHHHHHHHHHHHhc
Confidence            99999999999988764


No 314
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=62.22  E-value=5.5  Score=33.59  Aligned_cols=18  Identities=33%  Similarity=0.410  Sum_probs=15.8

Q ss_pred             cCCcchHHHHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALVFAL  188 (199)
Q Consensus       171 ~LSGGEKSlaaLalIfAL  188 (199)
                      .||||||..++||-.++.
T Consensus       151 ~LSgG~~qrv~la~al~~  168 (252)
T CHL00131        151 GFSGGEKKRNEILQMALL  168 (252)
T ss_pred             CCCHHHHHHHHHHHHHHc
Confidence            499999999999988764


No 315
>KOG0057|consensus
Probab=61.79  E-value=4.3  Score=39.81  Aligned_cols=14  Identities=64%  Similarity=0.662  Sum_probs=12.2

Q ss_pred             ccCCcchHHHHHHH
Q psy12760        170 DCLSGGEKTLASLA  183 (199)
Q Consensus       170 ~~LSGGEKSlaaLa  183 (199)
                      ..||||||++++++
T Consensus       486 ~~LSGGekQrvsla  499 (591)
T KOG0057|consen  486 LMLSGGEKQRVSLA  499 (591)
T ss_pred             cccccchHHHHHHH
Confidence            46999999999886


No 316
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=61.58  E-value=5.3  Score=31.87  Aligned_cols=17  Identities=29%  Similarity=0.464  Sum_probs=15.1

Q ss_pred             CCcchHHHHHHHHHHHH
Q psy12760        172 LSGGEKTLASLALVFAL  188 (199)
Q Consensus       172 LSGGEKSlaaLalIfAL  188 (199)
                      ||||||.++++|-.++.
T Consensus        97 LS~G~~~rl~la~al~~  113 (171)
T cd03228          97 LSGGQRQRIAIARALLR  113 (171)
T ss_pred             hCHHHHHHHHHHHHHhc
Confidence            99999999999987764


No 317
>PRK14237 phosphate transporter ATP-binding protein; Provisional
Probab=61.35  E-value=6.1  Score=33.97  Aligned_cols=21  Identities=33%  Similarity=0.390  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       160 ~~~~LS~G~~qrl~laral~~  180 (267)
T PRK14237        160 SALTLSGGQQQRLCIARAIAV  180 (267)
T ss_pred             CcccCCHHHHHHHHHHHHHhc
Confidence            456899999999999877764


No 318
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=61.33  E-value=5.1  Score=32.33  Aligned_cols=17  Identities=41%  Similarity=0.444  Sum_probs=15.1

Q ss_pred             CCcchHHHHHHHHHHHH
Q psy12760        172 LSGGEKTLASLALVFAL  188 (199)
Q Consensus       172 LSGGEKSlaaLalIfAL  188 (199)
                      ||||||..+++|..++.
T Consensus       105 LS~G~~qrl~la~al~~  121 (182)
T cd03215         105 LSGGNQQKVVLARWLAR  121 (182)
T ss_pred             cCHHHHHHHHHHHHHcc
Confidence            99999999999987764


No 319
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=61.30  E-value=5.8  Score=31.60  Aligned_cols=18  Identities=33%  Similarity=0.405  Sum_probs=15.3

Q ss_pred             cCCcchHHHHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALVFAL  188 (199)
Q Consensus       171 ~LSGGEKSlaaLalIfAL  188 (199)
                      +||||||..+++|-.++.
T Consensus        82 qLS~G~~qrl~laral~~   99 (163)
T cd03216          82 QLSVGERQMVEIARALAR   99 (163)
T ss_pred             ecCHHHHHHHHHHHHHhc
Confidence            399999999999987654


No 320
>COG5293 Predicted ATPase [General function prediction only]
Probab=60.96  E-value=85  Score=30.57  Aligned_cols=86  Identities=15%  Similarity=0.149  Sum_probs=43.1

Q ss_pred             CchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------------------HHHHHHHHH---HHHHHHHHHHHHhh
Q psy12760         77 PELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLS--------------------KRQKEFDTN---FVKIGKRVQECYQM  133 (199)
Q Consensus        77 N~~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~--------------------kr~~~F~~~---f~~In~~fs~iF~~  133 (199)
                      |..++++|.-+.+++-.+..+.+.+...|+.+++                    .....|+.-   |..+-+-|......
T Consensus       374 ~~g~~e~y~~l~ee~~~~~~elae~~~rie~l~k~~~~~~~i~~lkhe~l~~~~r~y~e~q~q~~~~~~~~~lF~~~~r~  453 (591)
T COG5293         374 NRGVFEKYQTLCEEIIALRGELAELEYRIEPLRKLHALDQYIGTLKHECLDLEERIYTEVQQQCSLFASIGRLFKEMIRE  453 (591)
T ss_pred             hCCcHHHHHHHHHHHHHHhhhHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5567788877776666555555544443333332                    223333322   33333333333333


Q ss_pred             hcCCceEEEEeccCCCC-CCcceEEEEECCC
Q psy12760        134 LTFGGKADLEYKEYSDP-YAQGIKYVVRPPR  163 (199)
Q Consensus       134 L~~gG~a~L~l~~~edp-~~~GI~I~V~p~g  163 (199)
                      +. +-.|.|.++-+... ++.|++|...-|.
T Consensus       454 ~y-d~~G~L~~~~~kng~~tfg~eI~~~~pd  483 (591)
T COG5293         454 VY-DCYGSLRVTTNKNGHLTFGAEITDAAPD  483 (591)
T ss_pred             Hh-cCCCeEEEEecCCCceeeeeeeeccCCC
Confidence            32 33445555443333 5668999876553


No 321
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones]
Probab=60.87  E-value=4.4  Score=38.79  Aligned_cols=14  Identities=50%  Similarity=0.605  Sum_probs=12.4

Q ss_pred             cCCcchHHHHHHHH
Q psy12760        171 CLSGGEKTLASLAL  184 (199)
Q Consensus       171 ~LSGGEKSlaaLal  184 (199)
                      -||||||+++|+|=
T Consensus       399 klSggekqrvaiar  412 (497)
T COG5265         399 KLSGGEKQRVAIAR  412 (497)
T ss_pred             eccCchHHHHHHHH
Confidence            58999999999984


No 322
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein. This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.
Probab=60.79  E-value=5.5  Score=37.81  Aligned_cols=16  Identities=31%  Similarity=0.451  Sum_probs=13.6

Q ss_pred             ccCCcchHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALV  185 (199)
Q Consensus       170 ~~LSGGEKSlaaLalI  185 (199)
                      ..||||||++.++|=.
T Consensus       475 ~~LSgGq~Qrl~laRa  490 (576)
T TIGR02204       475 VTLSGGQRQRIAIARA  490 (576)
T ss_pred             CcCCHHHHHHHHHHHH
Confidence            4699999999998854


No 323
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=60.63  E-value=6.2  Score=34.33  Aligned_cols=20  Identities=35%  Similarity=0.479  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.+++||-.++.
T Consensus       141 ~~~LS~G~~qrv~laral~~  160 (282)
T PRK13640        141 PANLSGGQKQRVAIAGILAV  160 (282)
T ss_pred             cccCCHHHHHHHHHHHHHHc
Confidence            36999999999999987765


No 324
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=60.59  E-value=6.2  Score=34.34  Aligned_cols=21  Identities=43%  Similarity=0.504  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..+++|-.++.
T Consensus       137 ~~~~LS~G~~qrv~laral~~  157 (279)
T PRK13635        137 EPHRLSGGQKQRVAIAGVLAL  157 (279)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            345899999999999987764


No 325
>PF02183 HALZ:  Homeobox associated leucine zipper;  InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox []. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=60.52  E-value=30  Score=22.61  Aligned_cols=28  Identities=7%  Similarity=0.058  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         83 DYAKRSKEMQAVLATLNTYCTGYEQCLS  110 (199)
Q Consensus        83 ey~e~~er~e~L~~e~~~l~~~I~~L~~  110 (199)
                      .|+.++.+++.|..+.+.+...+..+..
T Consensus        13 ~yd~Lk~~~~~L~~E~~~L~aev~~L~~   40 (45)
T PF02183_consen   13 SYDSLKAEYDSLKKENEKLRAEVQELKE   40 (45)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444444444555555555444443


No 326
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional
Probab=60.34  E-value=6.2  Score=35.51  Aligned_cols=20  Identities=30%  Similarity=0.419  Sum_probs=16.8

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ....||||||++++||-.++
T Consensus       222 ~~~~LSgGqkqRl~LARAl~  241 (329)
T PRK14257        222 AGNALSGGQQQRLCIARAIA  241 (329)
T ss_pred             CcccCCHHHHHHHHHHHHHH
Confidence            45689999999999987665


No 327
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional
Probab=60.22  E-value=6  Score=38.65  Aligned_cols=21  Identities=19%  Similarity=0.330  Sum_probs=18.0

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||++++||..|+.
T Consensus       140 ~~~~LSGGQrQRVaLArAL~~  160 (549)
T PRK13545        140 PVKTYSSGMKSRLGFAISVHI  160 (549)
T ss_pred             CcccCCHHHHHHHHHHHHHHh
Confidence            356899999999999988775


No 328
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=60.05  E-value=6.4  Score=34.27  Aligned_cols=22  Identities=36%  Similarity=0.540  Sum_probs=18.1

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||.+++||--++.
T Consensus       137 ~~~~~LS~G~~qrl~laraL~~  158 (283)
T PRK13636        137 KPTHCLSFGQKKRVAIAGVLVM  158 (283)
T ss_pred             CCcccCCHHHHHHHHHHHHHHc
Confidence            3567999999999999887654


No 329
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein.
Probab=60.04  E-value=6.2  Score=33.19  Aligned_cols=20  Identities=35%  Similarity=0.509  Sum_probs=17.2

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...|||||++.+++|..++.
T Consensus       128 ~~~lS~G~~qrl~laral~~  147 (237)
T TIGR00968       128 PNQLSGGQRQRVALARALAV  147 (237)
T ss_pred             hhhCCHHHHHHHHHHHHHhc
Confidence            35899999999999988775


No 330
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein. This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin.
Probab=59.21  E-value=5.1  Score=39.30  Aligned_cols=17  Identities=29%  Similarity=0.464  Sum_probs=14.0

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      ..||||||++.+||=.|
T Consensus       614 ~~LSGGQrQRiaLARal  630 (710)
T TIGR03796       614 ANLSGGQRQRLEIARAL  630 (710)
T ss_pred             CCCCHHHHHHHHHHHHH
Confidence            47999999999998443


No 331
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter. This model describes cyclic peptide transporter in bacteria. Bacteria have elaborate pathways for the production of toxins and secondary metabolites. Many such compounds, including syringomycin and pyoverdine are synthesized on non-ribosomal templates consisting of a multienzyme complex. On several occasions the proteins of the complex and transporter protein are present on the same operon. Often times these compounds cross the biological membrane by specific transporters. Syringomycin is an amphipathic, cylclic lipodepsipeptide when inserted into host causes formation of channels, permeable to variety of cations. On the other hand, pyoverdine is a cyclic octa-peptidyl dihydroxyquinoline, which is efficient in sequestering iron for uptake.
Probab=58.92  E-value=5.6  Score=37.98  Aligned_cols=17  Identities=24%  Similarity=0.366  Sum_probs=14.4

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      ..||||||++.++|=.+
T Consensus       469 ~~LSgGq~qRlalaRal  485 (555)
T TIGR01194       469 TALSTGQQKRLALICAW  485 (555)
T ss_pred             ccCCHHHHHHHHHHHHH
Confidence            68999999999998543


No 332
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=58.82  E-value=5  Score=33.90  Aligned_cols=17  Identities=29%  Similarity=0.487  Sum_probs=13.5

Q ss_pred             cccccCCcchHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLA  183 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLa  183 (199)
                      +....||||||+++||-
T Consensus       130 ~dP~tlSGGQrARvaL~  146 (213)
T COG4136         130 QDPATLSGGQRARVALL  146 (213)
T ss_pred             cChhhcCcchHHHHHHH
Confidence            34467999999998874


No 333
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=58.80  E-value=6.4  Score=34.04  Aligned_cols=21  Identities=43%  Similarity=0.531  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|..|+.
T Consensus       136 ~~~~LS~G~~qrv~laral~~  156 (255)
T cd03236         136 NIDQLSGGELQRVAIAAALAR  156 (255)
T ss_pred             ChhhCCHHHHHHHHHHHHHHh
Confidence            446899999999999998874


No 334
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=58.65  E-value=6.8  Score=32.78  Aligned_cols=19  Identities=26%  Similarity=0.385  Sum_probs=16.7

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..||||||..++||..++-
T Consensus       129 ~~lS~G~~qrl~laral~~  147 (232)
T cd03300         129 SQLSGGQQQRVAIARALVN  147 (232)
T ss_pred             hhCCHHHHHHHHHHHHHhc
Confidence            5899999999999988764


No 335
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=58.63  E-value=7.2  Score=33.52  Aligned_cols=20  Identities=45%  Similarity=0.600  Sum_probs=16.7

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.++++|--++.
T Consensus       140 ~~~LS~G~~qrl~laral~~  159 (269)
T PRK13648        140 PNALSGGQKQRVAIAGVLAL  159 (269)
T ss_pred             cccCCHHHHHHHHHHHHHHc
Confidence            45899999999999877664


No 336
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein.
Probab=58.31  E-value=5.2  Score=39.49  Aligned_cols=16  Identities=38%  Similarity=0.493  Sum_probs=13.5

Q ss_pred             ccCCcchHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALV  185 (199)
Q Consensus       170 ~~LSGGEKSlaaLalI  185 (199)
                      ..||||||++.|+|=.
T Consensus       616 ~~LSGGQkQRlalARA  631 (711)
T TIGR00958       616 SQLSGGQKQRIAIARA  631 (711)
T ss_pred             CcCCHHHHHHHHHHHH
Confidence            4799999999998843


No 337
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein. Members of this protein family are the ATP-binding subunit of a three-protein transporter. This family belongs, more broadly, to the family of proline and glycine-betaine transporters, but members have been identified by direct characterization and by bioinformatic means as choline transporters. Many species have several closely-related members of this family, probably with variable abilities to act additionally on related quaternary amines.
Probab=58.30  E-value=6.3  Score=36.53  Aligned_cols=21  Identities=38%  Similarity=0.450  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||++++||-.|+.
T Consensus       161 ~~~~LSgGq~QRV~LARALa~  181 (382)
T TIGR03415       161 KPGELSGGMQQRVGLARAFAM  181 (382)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            335899999999999988874


No 338
>PRK13536 nodulation factor exporter subunit NodI; Provisional
Probab=57.60  E-value=6.7  Score=35.51  Aligned_cols=21  Identities=33%  Similarity=0.338  Sum_probs=17.6

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||+.++||.-|+.
T Consensus       169 ~~~~LS~G~kqrv~lA~aL~~  189 (340)
T PRK13536        169 RVSDLSGGMKRRLTLARALIN  189 (340)
T ss_pred             ChhhCCHHHHHHHHHHHHHhc
Confidence            456899999999999987764


No 339
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=57.39  E-value=7.7  Score=34.13  Aligned_cols=20  Identities=35%  Similarity=0.250  Sum_probs=17.0

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..+++|-.++.
T Consensus       157 ~~~LSgGq~qrv~lAraL~~  176 (282)
T cd03291         157 GITLSGGQRARISLARAVYK  176 (282)
T ss_pred             CCcCCHHHHHHHHHHHHHhc
Confidence            46899999999999987764


No 340
>PRK13537 nodulation ABC transporter NodI; Provisional
Probab=57.32  E-value=6.7  Score=34.73  Aligned_cols=21  Identities=33%  Similarity=0.354  Sum_probs=17.2

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+..||||||+.++||--++.
T Consensus       135 ~~~~LS~G~~qrl~la~aL~~  155 (306)
T PRK13537        135 KVGELSGGMKRRLTLARALVN  155 (306)
T ss_pred             chhhCCHHHHHHHHHHHHHhC
Confidence            446899999999999877653


No 341
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein. Members of this protein family are ABC transporter ATP-binding subunits, part of a three-gene putative bacteriocin transport operon. The other subunits include another ATP-binding subunit (TIGR03796), which has an N-terminal propeptide cleavage domain, and an HlyD homolog (TIGR03794). In a number of genomes, a conserved propeptide sequence with a classic Gly-Gly motif
Probab=57.00  E-value=5.7  Score=38.81  Aligned_cols=16  Identities=31%  Similarity=0.439  Sum_probs=13.3

Q ss_pred             ccCCcchHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALV  185 (199)
Q Consensus       170 ~~LSGGEKSlaaLalI  185 (199)
                      ..||||||++.++|=-
T Consensus       587 ~~LSGGQrQRialARA  602 (686)
T TIGR03797       587 GTLSGGQRQRLLIARA  602 (686)
T ss_pred             CCCCHHHHHHHHHHHH
Confidence            4699999999998843


No 342
>KOG0055|consensus
Probab=56.68  E-value=5.8  Score=42.12  Aligned_cols=14  Identities=43%  Similarity=0.548  Sum_probs=12.6

Q ss_pred             cCCcchHHHHHHHH
Q psy12760        171 CLSGGEKTLASLAL  184 (199)
Q Consensus       171 ~LSGGEKSlaaLal  184 (199)
                      +||||||+++|+|=
T Consensus       489 qLSGGQKQRIAIAR  502 (1228)
T KOG0055|consen  489 QLSGGQKQRIAIAR  502 (1228)
T ss_pred             CCChHHHHHHHHHH
Confidence            59999999999984


No 343
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=56.58  E-value=10  Score=32.94  Aligned_cols=22  Identities=36%  Similarity=0.270  Sum_probs=17.9

Q ss_pred             ccccCCcchHHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      ....|||||++.+++|..+++.
T Consensus       167 ~~~~lS~G~~~r~~la~~~~~~  188 (276)
T cd03241         167 LAKIASGGELSRLMLALKAILA  188 (276)
T ss_pred             hhhhcChhHHHHHHHHHHHHHh
Confidence            4457999999999999876654


No 344
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional
Probab=56.40  E-value=8.3  Score=32.99  Aligned_cols=21  Identities=29%  Similarity=0.260  Sum_probs=17.4

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||..++||-.++.
T Consensus       158 ~~~~LS~G~~qrv~laral~~  178 (265)
T PRK14252        158 LAFNLSGGQQQRLCIARALAT  178 (265)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            346899999999999987764


No 345
>PF04949 Transcrip_act:  Transcriptional activator;  InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae []. This entry represents proteins annotated as RAB6-interacting golgins.
Probab=55.76  E-value=19  Score=29.70  Aligned_cols=69  Identities=7%  Similarity=0.073  Sum_probs=44.5

Q ss_pred             CCCCCCCccchh-hhhcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         58 SKWRSPVSGSDV-TAAVRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKR  126 (199)
Q Consensus        58 ~~lr~~~~~i~~-l~~~~~vN~~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~  126 (199)
                      .-+|+.+|..|. |..+|..=..+..+|++..+.|++..+++..|-..+-+|-.+-...=++-++.++++
T Consensus        87 ~~vRkkID~vNreLkpl~~~cqKKEkEykealea~nEknkeK~~Lv~~L~eLv~eSE~~rmKKLEELsk~  156 (159)
T PF04949_consen   87 EMVRKKIDSVNRELKPLGQSCQKKEKEYKEALEAFNEKNKEKAQLVTRLMELVSESERLRMKKLEELSKE  156 (159)
T ss_pred             HHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            557788888887 555776666788899999999998888877655544444333333223334444443


No 346
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=55.67  E-value=6.3  Score=39.54  Aligned_cols=17  Identities=35%  Similarity=0.505  Sum_probs=13.9

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      ..||||||++.|||=.+
T Consensus       608 ~~LSGGQrQrlalARaL  624 (709)
T COG2274         608 ANLSGGQRQRLALARAL  624 (709)
T ss_pred             CCCCHHHHHHHHHHHHh
Confidence            35999999999998543


No 347
>KOG0054|consensus
Probab=55.52  E-value=6.1  Score=42.52  Aligned_cols=13  Identities=62%  Similarity=0.721  Sum_probs=12.1

Q ss_pred             cCCcchHHHHHHH
Q psy12760        171 CLSGGEKTLASLA  183 (199)
Q Consensus       171 ~LSGGEKSlaaLa  183 (199)
                      .||||||++++||
T Consensus       643 nLSGGQKqRIsLA  655 (1381)
T KOG0054|consen  643 NLSGGQKQRISLA  655 (1381)
T ss_pred             CCcHhHHHHHHHH
Confidence            7999999999987


No 348
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD
Probab=55.38  E-value=6.5  Score=37.03  Aligned_cols=16  Identities=38%  Similarity=0.426  Sum_probs=13.6

Q ss_pred             ccCCcchHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALV  185 (199)
Q Consensus       170 ~~LSGGEKSlaaLalI  185 (199)
                      ..||||||++.++|=-
T Consensus       457 ~~LSgGq~qri~laRa  472 (529)
T TIGR02857       457 AGLSGGQAQRLALARA  472 (529)
T ss_pred             ccCCHHHHHHHHHHHH
Confidence            4799999999998843


No 349
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional
Probab=54.86  E-value=8.9  Score=32.94  Aligned_cols=20  Identities=35%  Similarity=0.328  Sum_probs=16.8

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ....|||||+..++||.-|+
T Consensus       146 ~~~~LS~G~~qrv~laral~  165 (261)
T PRK14263        146 SGLSLSGGQQQRLCIARAIA  165 (261)
T ss_pred             CcccCCHHHHHHHHHHHHHH
Confidence            44689999999999987775


No 350
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=54.53  E-value=8.1  Score=33.97  Aligned_cols=20  Identities=30%  Similarity=0.300  Sum_probs=16.7

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ....||||||..+++|.-++
T Consensus       130 ~~~~LS~G~~qrv~la~al~  149 (301)
T TIGR03522       130 KIGQLSKGYRQRVGLAQALI  149 (301)
T ss_pred             chhhCCHHHHHHHHHHHHHh
Confidence            35689999999999987765


No 351
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional
Probab=54.22  E-value=6.8  Score=37.49  Aligned_cols=15  Identities=40%  Similarity=0.527  Sum_probs=12.8

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.++|=
T Consensus       470 ~~LSgGq~QRialAR  484 (588)
T PRK13657        470 RQLSGGERQRLAIAR  484 (588)
T ss_pred             CCCCHHHHHHHHHHH
Confidence            369999999998874


No 352
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]
Probab=53.94  E-value=7.9  Score=37.19  Aligned_cols=20  Identities=30%  Similarity=0.429  Sum_probs=15.6

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      -.++||||||+.+-+|.-+|
T Consensus       154 yPHeLSGGqRQRVMIAMALa  173 (534)
T COG4172         154 YPHELSGGQRQRVMIAMALA  173 (534)
T ss_pred             CCcccCcchhhHHHHHHHHc
Confidence            34799999999988776544


No 353
>PTZ00265 multidrug resistance protein (mdr1); Provisional
Probab=53.85  E-value=7.2  Score=42.11  Aligned_cols=15  Identities=40%  Similarity=0.578  Sum_probs=13.0

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.|||=
T Consensus      1357 ~~LSGGQkQRIaIAR 1371 (1466)
T PTZ00265       1357 KSLSGGQKQRIAIAR 1371 (1466)
T ss_pred             CcCCHHHHHHHHHHH
Confidence            469999999999873


No 354
>PF05377 FlaC_arch:  Flagella accessory protein C (FlaC);  InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct []. In several archaea, the flagellin genes are followed immediately by the flagellar accessory genes flaCDEFGHIJ. The gene products may have a role in translocation, secretion, or assembly of the flagellum. FlaC is a protein whose exact role is unknown but it has been shown to be membrane-associated (by immuno-blotting fractionated cells) [].
Probab=53.67  E-value=50  Score=22.73  Aligned_cols=40  Identities=5%  Similarity=0.115  Sum_probs=23.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         88 SKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQ  128 (199)
Q Consensus        88 ~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs  128 (199)
                      ...++.++++.+.+.+.++++++..+ .++..|+.|+..++
T Consensus        13 ~~~i~tvk~en~~i~~~ve~i~envk-~ll~lYE~Vs~~iN   52 (55)
T PF05377_consen   13 ESSINTVKKENEEISESVEKIEENVK-DLLSLYEVVSNQIN   52 (55)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHccCC
Confidence            33445556666666666666666663 34447777666544


No 355
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]
Probab=53.22  E-value=7.7  Score=33.70  Aligned_cols=22  Identities=27%  Similarity=0.398  Sum_probs=19.0

Q ss_pred             ccccCCcchHHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      ....|||||++++|+|=-+|++
T Consensus       149 YP~~LSGGQQQR~aIARaLame  170 (256)
T COG4598         149 YPAHLSGGQQQRVAIARALAME  170 (256)
T ss_pred             CccccCchHHHHHHHHHHHhcC
Confidence            4458999999999999988875


No 356
>PF12532 DUF3732:  Protein of unknown function (DUF3732);  InterPro: IPR022205  This domain family is found in bacteria and eukaryotes, and is typically between 180 and 198 amino acids in length. There is a conserved DQP sequence motif. 
Probab=52.65  E-value=1.2e+02  Score=25.52  Aligned_cols=72  Identities=19%  Similarity=0.307  Sum_probs=42.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhcCCce---EEEEeccCCCCCCcceEEEEECCCCcccccccCCcchHH-HHHHHHHHHH
Q psy12760        113 QKEFDTNFVKIGKRVQECYQMLTFGGK---ADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEKT-LASLALVFAL  188 (199)
Q Consensus       113 ~~~F~~~f~~In~~fs~iF~~L~~gG~---a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEKS-laaLalIfAL  188 (199)
                      ..++..+...||..++.+...|-....   +.+.++-      ..+.+. ....+....+..+=+|+-= -.=||+.|||
T Consensus        16 ~~~~~~~l~~In~~~~~~~~~l~~e~~y~~~~~~f~~------~~ltl~-~~~~~~~~~L~~~GSgaNwl~~Hla~fLaL   88 (193)
T PF12532_consen   16 EERLESALSKINEYMSEYAKKLDFEHSYKDSPLRFDL------KELTLV-FDRKNRPIPLREMGSGANWLAYHLALFLAL   88 (193)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhCCccccCCCCcccccc------ccceEE-ecCCCCeEeHHhcCChHHHHHHHHHHHHHH
Confidence            344567889999999998888863222   3333321      234442 2333333455555444433 3468999999


Q ss_pred             HHh
Q psy12760        189 HYY  191 (199)
Q Consensus       189 ~~~  191 (199)
                      +++
T Consensus        89 H~~   91 (193)
T PF12532_consen   89 HEF   91 (193)
T ss_pred             HHH
Confidence            988


No 357
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=52.41  E-value=7.6  Score=37.15  Aligned_cols=15  Identities=47%  Similarity=0.510  Sum_probs=12.9

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.+||=
T Consensus       475 ~~LSGGqrQRialAR  489 (592)
T PRK10790        475 NNLSVGQKQLLALAR  489 (592)
T ss_pred             CCCCHHHHHHHHHHH
Confidence            469999999999873


No 358
>KOG4253|consensus
Probab=52.40  E-value=1.4e+02  Score=25.02  Aligned_cols=40  Identities=10%  Similarity=0.077  Sum_probs=27.0

Q ss_pred             cCCCCchhHHHHHHHHHHHHHHHHHHH------------HHHHHHHHHHHHH
Q psy12760         73 VRPTPELPVRDYAKRSKEMQAVLATLN------------TYCTGYEQCLSKR  112 (199)
Q Consensus        73 ~~~vN~~ai~ey~e~~er~e~L~~e~~------------~l~~~I~~L~~kr  112 (199)
                      +..+++...++|.+..+++.+++++.+            .+.+.|++++++.
T Consensus        35 ~s~~~nkdakk~~q~~~ei~dmKqelnavs~qD~fAkwaRlnRKi~kl~~el   86 (175)
T KOG4253|consen   35 MSRVGNKDAKKESQKVAEIQDMKQELNAVSMQDNFAKWARLNRKINKLDKEL   86 (175)
T ss_pred             hhcccchhHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHH
Confidence            445666677777777777777776654            4566677776666


No 359
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]
Probab=52.26  E-value=9.2  Score=37.22  Aligned_cols=20  Identities=35%  Similarity=0.539  Sum_probs=16.3

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ++..|||||-+.+|+|.-++
T Consensus       452 ~v~~LSGGELQRvaIaa~L~  471 (591)
T COG1245         452 PVDELSGGELQRVAIAAALS  471 (591)
T ss_pred             ccccCCchhHHHHHHHHHhc
Confidence            34579999999999997664


No 360
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only]
Probab=51.60  E-value=11  Score=32.96  Aligned_cols=20  Identities=35%  Similarity=0.441  Sum_probs=17.4

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      -.+||||||-.+-+|=-+|.
T Consensus       137 a~sLSGGERRR~EIARaLa~  156 (243)
T COG1137         137 AYSLSGGERRRVEIARALAA  156 (243)
T ss_pred             ccccccchHHHHHHHHHHhc
Confidence            35899999999999988876


No 361
>PHA00728 hypothetical protein
Probab=51.42  E-value=38  Score=27.18  Aligned_cols=21  Identities=33%  Similarity=0.363  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ++--|||.|-|+.-.||=||=
T Consensus        62 TMfYLsgnqisLILtAfEfar   82 (151)
T PHA00728         62 TMFYLSGNQISLILTAFEFAR   82 (151)
T ss_pred             ceEEecCCchhhHHHHHHHhh
Confidence            556799999999999998873


No 362
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=51.33  E-value=9.5  Score=34.53  Aligned_cols=21  Identities=29%  Similarity=0.305  Sum_probs=16.9

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ..++|||||++++.++=-+|.
T Consensus       132 yP~eLSGGQQQRVGv~RALAa  152 (309)
T COG1125         132 YPHELSGGQQQRVGVARALAA  152 (309)
T ss_pred             CchhcCcchhhHHHHHHHHhc
Confidence            346999999999999866653


No 363
>cd07591 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 161 and similar proteins. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of fungal proteins with similarity to Saccharomyces cerevisiae Reduced viability upon starvation protein 161 (Rvs161p) and Schizosaccharomyces pombe Hob3 (homolog of Bin3). S. cerevisiae Rvs161p plays a role in regulating cell polarity, actin cytoskeleton polarization, vesicle trafficking, endocytosis, bud formation, and the mating response. It forms a heterodimer with another BAR domain protein Rvs167p. Rvs161p and Rvs167p share common functions but are not interchangeable. Their BAR domains cannot be replaced with each other and the overexpression of one cannot suppress the mutant phenotypes of the other. S. pombe Hob3 is important in regulating filamentous actin localization an
Probab=51.17  E-value=94  Score=26.62  Aligned_cols=62  Identities=6%  Similarity=0.052  Sum_probs=45.4

Q ss_pred             cCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Q psy12760         73 VRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLT  135 (199)
Q Consensus        73 ~~~vN~~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~  135 (199)
                      .|.+....-++|++..+++..+++...+|.+.++.-...++.-.. +-..+...|..+|.-..
T Consensus         2 ~G~~e~T~D~~F~~~e~~f~~~e~~~~kL~k~~k~y~da~~~l~~-~q~~i~~~l~~lY~p~~   63 (224)
T cd07591           2 TGQVERTVDREFEFEERRYRTMEKASTKLQKEAKGYLDSLRALTS-SQARIAETISSFYGDAG   63 (224)
T ss_pred             CCcccccCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHhcCCCC
Confidence            477788888999999999999999999888888777776654333 55555566665554433


No 364
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export.
Probab=51.06  E-value=8.2  Score=37.80  Aligned_cols=17  Identities=35%  Similarity=0.587  Sum_probs=14.1

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      ..||||||++.++|=.|
T Consensus       600 ~~LSgGQrQRlalARal  616 (694)
T TIGR03375       600 RSLSGGQRQAVALARAL  616 (694)
T ss_pred             CCCCHHHHHHHHHHHHH
Confidence            46999999999998543


No 365
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc.
Probab=50.66  E-value=8.5  Score=37.80  Aligned_cols=16  Identities=38%  Similarity=0.544  Sum_probs=13.4

Q ss_pred             ccCCcchHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALV  185 (199)
Q Consensus       170 ~~LSGGEKSlaaLalI  185 (199)
                      ..||||||++.+||=.
T Consensus       610 ~~LSgGQrQRialARa  625 (708)
T TIGR01193       610 SSISGGQKQRIALARA  625 (708)
T ss_pred             CCCCHHHHHHHHHHHH
Confidence            4699999999998743


No 366
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=50.60  E-value=8.5  Score=36.95  Aligned_cols=17  Identities=35%  Similarity=0.466  Sum_probs=14.2

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      ..||||||++.++|=.+
T Consensus       474 ~~LSgGqrqRialARal  490 (574)
T PRK11160        474 RQLSGGEQRRLGIARAL  490 (574)
T ss_pred             CCCCHHHHHHHHHHHHH
Confidence            47999999999998544


No 367
>PLN03073 ABC transporter F family; Provisional
Probab=50.14  E-value=9.9  Score=38.08  Aligned_cols=22  Identities=27%  Similarity=0.362  Sum_probs=18.6

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||.+++||-.++.
T Consensus       340 ~~~~~LSgG~k~rv~LA~aL~~  361 (718)
T PLN03073        340 KATKTFSGGWRMRIALARALFI  361 (718)
T ss_pred             CchhhCCHHHHHHHHHHHHHhc
Confidence            3567899999999999988764


No 368
>PLN03232 ABC transporter C family member; Provisional
Probab=49.97  E-value=8.1  Score=41.71  Aligned_cols=13  Identities=46%  Similarity=0.682  Sum_probs=12.2

Q ss_pred             cCCcchHHHHHHH
Q psy12760        171 CLSGGEKTLASLA  183 (199)
Q Consensus       171 ~LSGGEKSlaaLa  183 (199)
                      .||||||+++|||
T Consensus       740 ~LSGGQkQRIaLA  752 (1495)
T PLN03232        740 NISGGQKQRVSMA  752 (1495)
T ss_pred             ccCHHHHHHHHHH
Confidence            6999999999998


No 369
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=49.92  E-value=12  Score=29.29  Aligned_cols=17  Identities=47%  Similarity=0.538  Sum_probs=14.9

Q ss_pred             CCcchHHHHHHHHHHHH
Q psy12760        172 LSGGEKTLASLALVFAL  188 (199)
Q Consensus       172 LSGGEKSlaaLalIfAL  188 (199)
                      |||||+.++++|--++.
T Consensus        71 lS~G~~~rv~laral~~   87 (144)
T cd03221          71 LSGGEKMRLALAKLLLE   87 (144)
T ss_pred             CCHHHHHHHHHHHHHhc
Confidence            99999999999877754


No 370
>TIGR01192 chvA glucan exporter ATP-binding protein. This model describes glucan exporter ATP binding protein in bacteria. It belongs to the larger ABC transporter superfamily with the characteristic ATP binding motif. The In general, this protein is in some ways implicated in osmoregulation and suggested to participate in the export of glucan from the cytoplasm to periplasm. The cyclic beta-1,2-glucan in the bactrerial periplasmic space is suggested to confer the property of high osmolority. It has also been demonstrated that mutants in this loci have lost functions of virulence and motility. It is unclear as to how virulence and osmoadaptaion are related.
Probab=49.92  E-value=12  Score=36.16  Aligned_cols=18  Identities=33%  Similarity=0.488  Sum_probs=15.0

Q ss_pred             ccCCcchHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFA  187 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfA  187 (199)
                      ..||||||++.++|-.+.
T Consensus       470 ~~LSgGq~qrl~lARall  487 (585)
T TIGR01192       470 NRLSGGERQRLAIARAIL  487 (585)
T ss_pred             CCCCHHHHHHHHHHHHHh
Confidence            469999999999986554


No 371
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion.
Probab=49.68  E-value=9.1  Score=36.34  Aligned_cols=17  Identities=35%  Similarity=0.538  Sum_probs=14.0

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      ..||||||++.++|=.+
T Consensus       453 ~~LSgGq~qrl~lARal  469 (544)
T TIGR01842       453 ATLSGGQRQRIALARAL  469 (544)
T ss_pred             CCCCHHHHHHHHHHHHH
Confidence            46999999999998543


No 372
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=49.36  E-value=12  Score=31.82  Aligned_cols=20  Identities=30%  Similarity=0.323  Sum_probs=16.7

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||..+++|-.++-
T Consensus       154 ~~~LS~G~~qrl~laral~~  173 (257)
T cd03288         154 GENFSVGQRQLFCLARAFVR  173 (257)
T ss_pred             CCcCCHHHHHHHHHHHHHhc
Confidence            45899999999999887753


No 373
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]
Probab=48.78  E-value=9.6  Score=37.29  Aligned_cols=14  Identities=43%  Similarity=0.655  Sum_probs=12.2

Q ss_pred             ccCCcchHHHHHHH
Q psy12760        170 DCLSGGEKTLASLA  183 (199)
Q Consensus       170 ~~LSGGEKSlaaLa  183 (199)
                      ..||||||++.+||
T Consensus       471 ~~LSgGQRQRIaLA  484 (580)
T COG4618         471 ATLSGGQRQRIALA  484 (580)
T ss_pred             CCCCchHHHHHHHH
Confidence            46999999999987


No 374
>PLN03130 ABC transporter C family member; Provisional
Probab=48.51  E-value=9.1  Score=41.77  Aligned_cols=14  Identities=43%  Similarity=0.565  Sum_probs=12.6

Q ss_pred             ccCCcchHHHHHHH
Q psy12760        170 DCLSGGEKTLASLA  183 (199)
Q Consensus       170 ~~LSGGEKSlaaLa  183 (199)
                      ..||||||+++|||
T Consensus       739 ~~LSGGQKQRIaLA  752 (1622)
T PLN03130        739 VNISGGQKQRVSMA  752 (1622)
T ss_pred             CCCCHHHHHHHHHH
Confidence            36999999999987


No 375
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]
Probab=48.39  E-value=12  Score=33.19  Aligned_cols=21  Identities=43%  Similarity=0.558  Sum_probs=17.3

Q ss_pred             cccccCCcchHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfA  187 (199)
                      +.+..||||+|..+++|.-|+
T Consensus       132 ~~~~~lS~G~kqrl~ia~aL~  152 (293)
T COG1131         132 KKVRTLSGGMKQRLSIALALL  152 (293)
T ss_pred             cchhhcCHHHHHHHHHHHHHh
Confidence            356789999999999987654


No 376
>PF13175 AAA_15:  AAA ATPase domain
Probab=47.81  E-value=1.9e+02  Score=25.52  Aligned_cols=26  Identities=15%  Similarity=0.218  Sum_probs=21.6

Q ss_pred             cccccccCCcchHHHHHHHHHHHHHH
Q psy12760        165 SWKSIDCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       165 ~~~~l~~LSGGEKSlaaLalIfAL~~  190 (199)
                      ..-++..+|.|++.++.++++++...
T Consensus       335 ~~~~l~~~g~G~~~l~~~~~~~~~~~  360 (415)
T PF13175_consen  335 ESIPLSQRGSGEQNLIYISLLINFLR  360 (415)
T ss_pred             CcCChhhcCcchHHHHHHHHHHHHHH
Confidence            35688999999999999999887653


No 377
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei.
Probab=47.78  E-value=12  Score=36.73  Aligned_cols=18  Identities=50%  Similarity=0.715  Sum_probs=15.5

Q ss_pred             ccCCcchHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFA  187 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfA  187 (199)
                      ..||||||+++++|-.++
T Consensus       581 ~~LSgGqkQRl~iARal~  598 (659)
T TIGR00954       581 DVLSGGEKQRIAMARLFY  598 (659)
T ss_pred             cCCCHHHHHHHHHHHHHH
Confidence            479999999999987765


No 378
>PF11014 DUF2852:  Protein of unknown function (DUF2852);  InterPro: IPR021273  This bacterial family of proteins has no known function. 
Probab=47.42  E-value=96  Score=24.41  Aligned_cols=42  Identities=14%  Similarity=0.286  Sum_probs=31.9

Q ss_pred             CCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHH
Q psy12760         74 RPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKR-QKEFD  117 (199)
Q Consensus        74 ~~vN~~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr-~~~F~  117 (199)
                      ..--+.|-++|.+  +.+..|+++..+.++.+++|++.+ ++.|.
T Consensus        65 ~~sGN~AFD~YR~--~tL~RLEeEq~eF~~Fl~rLR~AKDk~EFD  107 (115)
T PF11014_consen   65 RSSGNAAFDEYRE--DTLRRLEEEQREFEDFLERLRRAKDKEEFD  107 (115)
T ss_pred             CCCcchhHHHHHH--HHHHHHHHHHHHHHHHHHHHHHhhhHHHHH
Confidence            3334578999955  788888888889999999998887 33444


No 379
>PLN03211 ABC transporter G-25; Provisional
Probab=47.17  E-value=13  Score=36.80  Aligned_cols=20  Identities=35%  Similarity=0.518  Sum_probs=17.1

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.++++|.-++-
T Consensus       204 ~~~LSgGerqRv~ia~aL~~  223 (659)
T PLN03211        204 IRGISGGERKRVSIAHEMLI  223 (659)
T ss_pred             CCCcChhhhhHHHHHHHHHh
Confidence            46899999999999987764


No 380
>TIGR00630 uvra excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=47.11  E-value=13  Score=38.55  Aligned_cols=22  Identities=32%  Similarity=0.380  Sum_probs=18.9

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....|||||+++++||-.++.
T Consensus       483 r~~~tLSGGE~QRv~LA~aL~~  504 (924)
T TIGR00630       483 RAAGTLSGGEAQRIRLATQIGS  504 (924)
T ss_pred             CCcCcCCHHHHHHHHHHHHHhh
Confidence            4667999999999999988764


No 381
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional
Probab=46.69  E-value=14  Score=31.61  Aligned_cols=21  Identities=33%  Similarity=0.476  Sum_probs=17.1

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.+++||-.++.
T Consensus       150 ~~~~LS~G~~qrl~laral~~  170 (257)
T PRK14246        150 PASQLSGGQQQRLTIARALAL  170 (257)
T ss_pred             CcccCCHHHHHHHHHHHHHHc
Confidence            345799999999999987654


No 382
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=46.54  E-value=14  Score=32.70  Aligned_cols=19  Identities=32%  Similarity=0.398  Sum_probs=16.5

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..|||||+++..+|=-+|+
T Consensus       148 ~~LSGGQQQRLcIARalAv  166 (253)
T COG1117         148 LGLSGGQQQRLCIARALAV  166 (253)
T ss_pred             cCCChhHHHHHHHHHHHhc
Confidence            4699999999999987775


No 383
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=46.11  E-value=13  Score=35.50  Aligned_cols=18  Identities=39%  Similarity=0.438  Sum_probs=14.7

Q ss_pred             ccCCcchHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFA  187 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfA  187 (199)
                      ..||||||++.++|-.+.
T Consensus       450 ~~LSgGq~qRi~lARall  467 (569)
T PRK10789        450 VMLSGGQKQRISIARALL  467 (569)
T ss_pred             CcCCHHHHHHHHHHHHHh
Confidence            469999999999986543


No 384
>PLN03232 ABC transporter C family member; Provisional
Probab=46.05  E-value=13  Score=40.19  Aligned_cols=15  Identities=40%  Similarity=0.490  Sum_probs=12.9

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.+||=
T Consensus      1370 ~~LSgGQrQrlaLAR 1384 (1495)
T PLN03232       1370 ENFSVGQRQLLSLAR 1384 (1495)
T ss_pred             CCCCHHHHHHHHHHH
Confidence            469999999999874


No 385
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional
Probab=45.20  E-value=14  Score=35.05  Aligned_cols=17  Identities=35%  Similarity=0.325  Sum_probs=14.4

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      ..||||||++.++|=-+
T Consensus       448 ~~LSgGq~qRl~lARal  464 (547)
T PRK10522        448 LKLSKGQKKRLALLLAL  464 (547)
T ss_pred             CCCCHHHHHHHHHHHHH
Confidence            47999999999988654


No 386
>PF03961 DUF342:  Protein of unknown function (DUF342);  InterPro: IPR005646 This family of bacterial proteins has no known function. The proteins are in the region of 500-600 amino acid residues in length.
Probab=44.72  E-value=1.5e+02  Score=27.79  Aligned_cols=36  Identities=6%  Similarity=0.015  Sum_probs=28.2

Q ss_pred             CCC-chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         75 PTP-ELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLS  110 (199)
Q Consensus        75 ~vN-~~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~  110 (199)
                      .++ +...++++++.++++.+..+..+++..+..+++
T Consensus       326 g~~~~~l~~~~~~l~~~~~~~~~~l~~l~~~l~~l~~  362 (451)
T PF03961_consen  326 GVDRPELKEKLEELEEELEELKEELEKLKKNLKKLKK  362 (451)
T ss_pred             ecCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Confidence            345 667788888888888888888888888777766


No 387
>KOG0063|consensus
Probab=43.63  E-value=11  Score=36.64  Aligned_cols=20  Identities=40%  Similarity=0.584  Sum_probs=16.6

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      .+..|||||.+.+|+++.++
T Consensus       453 evq~lSggelQRval~KOGG  472 (592)
T KOG0063|consen  453 EVQGLSGGELQRVALALCLG  472 (592)
T ss_pred             HhhcCCchhhHHHHHHHhcC
Confidence            44579999999999998764


No 388
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=42.84  E-value=17  Score=31.86  Aligned_cols=20  Identities=35%  Similarity=0.180  Sum_probs=16.5

Q ss_pred             cccCCcchHHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfAL  188 (199)
                      ...||||||.+++||-.++.
T Consensus       136 g~~LS~G~~qrl~LaRall~  155 (275)
T cd03289         136 GCVLSHGHKQLMCLARSVLS  155 (275)
T ss_pred             CCCCCHHHHHHHHHHHHHhc
Confidence            35899999999999877653


No 389
>KOG0066|consensus
Probab=42.63  E-value=13  Score=36.39  Aligned_cols=18  Identities=44%  Similarity=0.569  Sum_probs=14.5

Q ss_pred             ccccCCcchHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALV  185 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalI  185 (199)
                      .+.-||||||+++|+|=+
T Consensus       701 kikdLSGGQKaRValaeL  718 (807)
T KOG0066|consen  701 KIKDLSGGQKARVALAEL  718 (807)
T ss_pred             eeeecCCcchHHHHHHHH
Confidence            345699999999999854


No 390
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion.
Probab=42.28  E-value=14  Score=36.34  Aligned_cols=17  Identities=29%  Similarity=0.489  Sum_probs=14.4

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      ..||||||++.++|=.+
T Consensus       592 ~~LSgGq~qri~lARal  608 (694)
T TIGR01846       592 ANLSGGQRQRIAIARAL  608 (694)
T ss_pred             CCCCHHHHHHHHHHHHH
Confidence            47999999999988654


No 391
>PF05384 DegS:  Sensor protein DegS;  InterPro: IPR008595 This is a group of Bacillus DegS proteins. The DegS-DegU two-component regulatory system of Bacillus subtilis controls various processes that characterise the transition from the exponential to the stationary growth phase, including the induction of extracellular degradative enzymes, expression of late competence genes and down-regulation of the sigma D regulon []. The entry also contains one sequence Q8R9D3 from SWISSPROT from Thermoanaerobacter tengcongensis which is described as a sensory transduction histidine kinase.; GO: 0016301 kinase activity, 0007165 signal transduction
Probab=41.88  E-value=1.4e+02  Score=24.64  Aligned_cols=49  Identities=8%  Similarity=0.236  Sum_probs=27.7

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         79 LPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQ  128 (199)
Q Consensus        79 ~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs  128 (199)
                      .+-.+|+.++.++++++.+....-+....|...-+. -..-+-.|+++|.
T Consensus        24 ~~R~E~~~l~~EL~evk~~v~~~I~evD~Le~~er~-aR~rL~eVS~~f~   72 (159)
T PF05384_consen   24 QARQEYERLRKELEEVKEEVSEVIEEVDKLEKRERQ-ARQRLAEVSRNFD   72 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHhhhc
Confidence            455666777777777766666555544444433221 1224566777775


No 392
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]
Probab=41.49  E-value=14  Score=31.67  Aligned_cols=15  Identities=33%  Similarity=0.521  Sum_probs=13.1

Q ss_pred             cCCcchHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALV  185 (199)
Q Consensus       171 ~LSGGEKSlaaLalI  185 (199)
                      .|||||++++|+|=-
T Consensus       141 hlsggqqqrvaiara  155 (242)
T COG4161         141 HLSGGQQQRVAIARA  155 (242)
T ss_pred             ecccchhhhHHHHHH
Confidence            799999999999743


No 393
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP). This model describes multi drug resistance-associated protein (MRP) in eukaryotes. The multidrug resistance-associated protein is an integral membrane protein that causes multidrug resistance when overexpressed in mammalian cells. It belongs to ABC transporter superfamily. The protein topology and function was experimentally demonstrated by epitope tagging and immunofluorescence. Insertion of tags in the critical regions associated with drug efflux, abrogated its function. The C-terminal domain seem to highly conserved.
Probab=41.44  E-value=17  Score=39.42  Aligned_cols=15  Identities=40%  Similarity=0.516  Sum_probs=13.1

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.+||=
T Consensus      1420 ~~LSgGQrQrl~LAR 1434 (1522)
T TIGR00957      1420 ENLSVGQRQLVCLAR 1434 (1522)
T ss_pred             CcCCHHHHHHHHHHH
Confidence            469999999999885


No 394
>PTZ00243 ABC transporter; Provisional
Probab=41.18  E-value=16  Score=39.84  Aligned_cols=15  Identities=27%  Similarity=0.335  Sum_probs=13.1

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.+||=
T Consensus      1444 ~nLSgGQrQrLaLAR 1458 (1560)
T PTZ00243       1444 SNYSVGQRQLMCMAR 1458 (1560)
T ss_pred             CcCCHHHHHHHHHHH
Confidence            469999999999885


No 395
>PF04201 TPD52:  Tumour protein D52 family;  InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma. Cloning of D52 homologues from other species has indicated that D52 may play roles in calcium-mediated signal transduction and cell proliferation. Two human homologues of hD52, hD53 and hD54, have also been identified, demonstrating the existence of a novel gene/protein family []. These proteins have an N-terminal coiled-coil that allows members to form homo- and heterodimers with each other [].
Probab=40.69  E-value=2.1e+02  Score=23.77  Aligned_cols=55  Identities=11%  Similarity=0.039  Sum_probs=31.5

Q ss_pred             CchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHH
Q psy12760         77 PELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKR----QKEFDTNFVKIGKRVQECY  131 (199)
Q Consensus        77 N~~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr----~~~F~~~f~~In~~fs~iF  131 (199)
                      +.+..+|.++++.++..++.++..|+..+..-.+..    ++.=...+..+..+++.-+
T Consensus        24 ~~LsEeE~eeLr~EL~KvEeEI~TLrqvL~aKer~~~eLKrkLGit~l~elkqnlskg~   82 (162)
T PF04201_consen   24 EGLSEEEREELRSELAKVEEEIQTLRQVLAAKERHCAELKRKLGITPLSELKQNLSKGW   82 (162)
T ss_pred             ccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHCCchHHHHHHHHHHHh
Confidence            445677778888888888777777666554333222    1111223556666666533


No 396
>KOG0927|consensus
Probab=40.21  E-value=14  Score=36.36  Aligned_cols=20  Identities=20%  Similarity=0.233  Sum_probs=16.7

Q ss_pred             cccccCCcchHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVF  186 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIf  186 (199)
                      .++.+||+|||+++.+|++.
T Consensus       505 ~p~~~LS~Gqr~rVlFa~l~  524 (614)
T KOG0927|consen  505 VPMSQLSDGQRRRVLFARLA  524 (614)
T ss_pred             cchhhcccccchhHHHHHHH
Confidence            46789999999999888753


No 397
>PF02183 HALZ:  Homeobox associated leucine zipper;  InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox []. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=40.19  E-value=1e+02  Score=20.02  Aligned_cols=32  Identities=16%  Similarity=0.175  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         81 VRDYAKRSKEMQAVLATLNTYCTGYEQCLSKR  112 (199)
Q Consensus        81 i~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr  112 (199)
                      ..+|+.++..|+.|..+.+.+...-+.|..+.
T Consensus         4 E~Dy~~LK~~yd~Lk~~~~~L~~E~~~L~aev   35 (45)
T PF02183_consen    4 ERDYDALKASYDSLKAEYDSLKKENEKLRAEV   35 (45)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35788888888888888888877777766655


No 398
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]
Probab=39.45  E-value=19  Score=34.75  Aligned_cols=24  Identities=21%  Similarity=0.279  Sum_probs=18.3

Q ss_pred             cccccccCCcchHHHHHHHHHHHH
Q psy12760        165 SWKSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       165 ~~~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ..+..+++|||||+..|+|=-+.|
T Consensus       420 r~RYPhEFSGGQRQRIAIARAliL  443 (534)
T COG4172         420 RNRYPHEFSGGQRQRIAIARALIL  443 (534)
T ss_pred             hhcCCcccCcchhhHHHHHHHHhc
Confidence            334557999999999999865543


No 399
>PRK09343 prefoldin subunit beta; Provisional
Probab=38.30  E-value=1.9e+02  Score=22.39  Aligned_cols=44  Identities=7%  Similarity=0.044  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCc
Q psy12760         94 VLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGG  138 (199)
Q Consensus        94 L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~~gG  138 (199)
                      +.+..+.+...|+.++++. ..+...+.....++..++....++|
T Consensus        76 l~~r~E~ie~~ik~lekq~-~~l~~~l~e~q~~l~~ll~~~~~~~  119 (121)
T PRK09343         76 LKERKELLELRSRTLEKQE-KKLREKLKELQAKINEMLSKYYPQG  119 (121)
T ss_pred             HHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHhcCCCC
Confidence            3344444455555555544 3445566777777777777777544


No 400
>KOG0064|consensus
Probab=38.13  E-value=19  Score=35.75  Aligned_cols=16  Identities=50%  Similarity=0.735  Sum_probs=13.9

Q ss_pred             cCCcchHHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALVF  186 (199)
Q Consensus       171 ~LSGGEKSlaaLalIf  186 (199)
                      .||||||++.++|=+|
T Consensus       612 ~LsgGekQR~~mARm~  627 (728)
T KOG0064|consen  612 VLSGGEKQRMGMARMF  627 (728)
T ss_pred             hccchHHHHHHHHHHH
Confidence            5999999999998765


No 401
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP). This model describes multi drug resistance-associated protein (MRP) in eukaryotes. The multidrug resistance-associated protein is an integral membrane protein that causes multidrug resistance when overexpressed in mammalian cells. It belongs to ABC transporter superfamily. The protein topology and function was experimentally demonstrated by epitope tagging and immunofluorescence. Insertion of tags in the critical regions associated with drug efflux, abrogated its function. The C-terminal domain seem to highly conserved.
Probab=37.98  E-value=18  Score=39.21  Aligned_cols=17  Identities=47%  Similarity=0.474  Sum_probs=14.3

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      ..||||||++++||=-+
T Consensus       759 ~~LSGGQkqRiaLARAl  775 (1522)
T TIGR00957       759 VNLSGGQKQRVSLARAV  775 (1522)
T ss_pred             CCCCHHHHHHHHHHHHH
Confidence            57999999999998543


No 402
>KOG2483|consensus
Probab=37.70  E-value=23  Score=30.96  Aligned_cols=78  Identities=15%  Similarity=0.152  Sum_probs=45.1

Q ss_pred             hhhhHHHHHhhhhhhhccccchhhHHHHHhHhhhccCCcccccCCCCCCCCC--CCCCCCCCccchhhhhcCCCCchhHH
Q psy12760          5 REHHEEIVEKKRRAIVTRPCSITSWMAVLSISDILSNSSIHTTPRSANTMAP--ASKWRSPVSGSDVTAAVRPTPELPVR   82 (199)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~p--~~~lr~~~~~i~~l~~~~~vN~~ai~   82 (199)
                      |+||-+. ||+|||=+-.||..                ....+|+..+...-  .+.|+..++-|.+++....       
T Consensus        60 R~~HN~L-Ek~RRahlk~~~~~----------------Lk~~vP~~~~~~~~t~lsiL~kA~~~i~~l~~~~~-------  115 (232)
T KOG2483|consen   60 RAHHNAL-EKRRRAHLKDCFES----------------LKDSVPLLNGETRSTTLSILDKALEHIQSLERKSA-------  115 (232)
T ss_pred             hhhhhhh-hHHHHHHHHHHHHH----------------HHHhCCCCCCcchhhhhHhhhhHHHHHHHHHhHHH-------
Confidence            6788775 69999999998853                34456776544433  3555555555555544331       


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         83 DYAKRSKEMQAVLATLNTYCTGYEQCL  109 (199)
Q Consensus        83 ey~e~~er~e~L~~e~~~l~~~I~~L~  109 (199)
                         +-...+++|..+...++..++++.
T Consensus       116 ---~~~~~~e~l~~e~~~l~~rl~ql~  139 (232)
T KOG2483|consen  116 ---TQQQDIEDLSRENRKLKARLEQLS  139 (232)
T ss_pred             ---HHHHHHHHHHHHHHHHHHHHHHhc
Confidence               112344455555555555555544


No 403
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]
Probab=37.05  E-value=2.5e+02  Score=25.02  Aligned_cols=23  Identities=9%  Similarity=0.221  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         82 RDYAKRSKEMQAVLATLNTYCTG  104 (199)
Q Consensus        82 ~ey~e~~er~e~L~~e~~~l~~~  104 (199)
                      +.|++++++++++.+++..+.+.
T Consensus       135 e~~ee~kekl~E~~~EkeeL~~e  157 (290)
T COG4026         135 EDYEELKEKLEELQKEKEELLKE  157 (290)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            35555666555555554444333


No 404
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed
Probab=36.81  E-value=21  Score=37.06  Aligned_cols=23  Identities=35%  Similarity=0.359  Sum_probs=19.5

Q ss_pred             cccccCCcchHHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFALH  189 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL~  189 (199)
                      +.+..||||||++++||-.++..
T Consensus       485 r~~~~LSgGE~QRv~LA~aL~~~  507 (943)
T PRK00349        485 RSAGTLSGGEAQRIRLATQIGSG  507 (943)
T ss_pred             CchhhCCHHHHHHHHHHHHHhhC
Confidence            46678999999999999888753


No 405
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein.
Probab=36.59  E-value=23  Score=34.53  Aligned_cols=19  Identities=32%  Similarity=0.462  Sum_probs=16.2

Q ss_pred             cccCCcchHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfA  187 (199)
                      ...||||||.++++|.-++
T Consensus       164 ~~~LSgGqrkRvsia~aL~  182 (617)
T TIGR00955       164 VKGLSGGERKRLAFASELL  182 (617)
T ss_pred             CCCcCcchhhHHHHHHHHH
Confidence            3579999999999998765


No 406
>PF06295 DUF1043:  Protein of unknown function (DUF1043);  InterPro: IPR009386 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=36.11  E-value=2.1e+02  Score=22.33  Aligned_cols=42  Identities=19%  Similarity=0.193  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHhhhc
Q psy12760         94 VLATLNTYCTGYEQCLSKRQKEFDT---NFVKIGKRVQECYQMLT  135 (199)
Q Consensus        94 L~~e~~~l~~~I~~L~~kr~~~F~~---~f~~In~~fs~iF~~L~  135 (199)
                      ++.++++.+..+++-+++..+.|..   .++++....+.+|..|.
T Consensus        30 l~~eL~~~k~el~~yk~~V~~HF~~ta~Ll~~l~~~Y~~l~~Hla   74 (128)
T PF06295_consen   30 LEQELEQAKQELEQYKQEVNDHFAQTAELLDNLTQDYQKLYQHLA   74 (128)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3333444444444444444444443   34444444445554443


No 407
>PF06013 WXG100:  Proteins of 100 residues with WXG;  InterPro: IPR010310  ESAT-6 is a small protein appears to be of fundamental importance in virulence and protective immunity in Mycobacterium tuberculosis. Homologues have been detected in other Gram-positive bacterial species. It may represent a novel secretion system potentially driven by the PF01580 from PFAM domains in the YukA-like proteins [].   Members of this protein family include secretion targets for type main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from PF06013 from PFAM. The best characterised member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have long C-terminal extension. ; PDB: 3FAV_A 1WA8_A 3Q4H_B 2KG7_A 2VRZ_B 2VS0_B 3OGI_A 3H6P_B 3GVM_B 3GWK_C ....
Probab=35.92  E-value=1.3e+02  Score=19.99  Aligned_cols=59  Identities=10%  Similarity=0.155  Sum_probs=29.6

Q ss_pred             CCchhHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHhhh
Q psy12760         76 TPELPVRDYA-KRSKEMQAVLATLNTYCTGYEQCLSKR----QKEFDTNFVKIGKRVQECYQML  134 (199)
Q Consensus        76 vN~~ai~ey~-e~~er~e~L~~e~~~l~~~I~~L~~kr----~~~F~~~f~~In~~fs~iF~~L  134 (199)
                      +|+..+.... .+....+.+......+...+..+...|    ...|...+.++...|..+-..|
T Consensus         4 vd~~~l~~~a~~~~~~~~~l~~~~~~l~~~~~~l~~~W~G~a~~af~~~~~~~~~~~~~~~~~L   67 (86)
T PF06013_consen    4 VDPEQLRAAAQQLQAQADELQSQLQQLESSIDSLQASWQGEAADAFQDKFEEWNQAFRQLNEAL   67 (86)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGBTSSTSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ecHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCchHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444443 223344455555666666666664433    4455555555555555444433


No 408
>PRK05771 V-type ATP synthase subunit I; Validated
Probab=35.81  E-value=2.4e+02  Score=27.75  Aligned_cols=48  Identities=8%  Similarity=0.059  Sum_probs=36.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         79 LPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKR  126 (199)
Q Consensus        79 ~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~  126 (199)
                      ...+..+++++++++++++++++++.++++.+.+........+.+...
T Consensus       212 ~p~~~l~~l~~~l~~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~  259 (646)
T PRK05771        212 TPSELIREIKEELEEIEKERESLLEELKELAKKYLEELLALYEYLEIE  259 (646)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            456777888888899999999999988888887766666555555544


No 409
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR). The model describes the cystis fibrosis transmembrane conductor regulator (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se.
Probab=35.33  E-value=23  Score=38.38  Aligned_cols=15  Identities=47%  Similarity=0.481  Sum_probs=12.5

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.+||=
T Consensus      1352 ~nLSgGQrQrL~LAR 1366 (1490)
T TIGR01271      1352 YVLSNGHKQLMCLAR 1366 (1490)
T ss_pred             CcCCHHHHHHHHHHH
Confidence            369999999988874


No 410
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport.  These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2).  No known transmembrane proteins or domains are associated with these proteins.
Probab=35.02  E-value=31  Score=27.31  Aligned_cols=21  Identities=57%  Similarity=0.716  Sum_probs=17.9

Q ss_pred             ccCCcchHHHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFALHY  190 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL~~  190 (199)
                      ..|||||+.+++++.+++...
T Consensus        76 ~~lS~G~~~~~~la~~L~~~~   96 (162)
T cd03227          76 LQLSGGEKELSALALILALAS   96 (162)
T ss_pred             eeccccHHHHHHHHHHHHhcC
Confidence            359999999999999998643


No 411
>PTZ00265 multidrug resistance protein (mdr1); Provisional
Probab=35.01  E-value=21  Score=38.68  Aligned_cols=20  Identities=35%  Similarity=0.411  Sum_probs=16.0

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ....||||||++++||=-+.
T Consensus       576 ~g~~LSGGQkQRiaIARAll  595 (1466)
T PTZ00265        576 NASKLSGGQKQRISIARAII  595 (1466)
T ss_pred             CCCcCCHHHHHHHHHHHHHh
Confidence            34689999999999986553


No 412
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein.
Probab=34.87  E-value=24  Score=38.01  Aligned_cols=21  Identities=29%  Similarity=0.253  Sum_probs=17.5

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      ....||||||.++++|-.++.
T Consensus       206 ~~~~LSGGerkRvsIA~aL~~  226 (1394)
T TIGR00956       206 FVRGVSGGERKRVSIAEASLG  226 (1394)
T ss_pred             cCCCCCcccchHHHHHHHHHh
Confidence            356899999999999987764


No 413
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed
Probab=34.45  E-value=26  Score=36.39  Aligned_cols=22  Identities=32%  Similarity=0.374  Sum_probs=18.4

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +....||||||++++||-.++-
T Consensus       826 ~~~~tLSgGEkQRl~LAraL~~  847 (943)
T PRK00349        826 QPATTLSGGEAQRVKLAKELSK  847 (943)
T ss_pred             CCcccCCHHHHHHHHHHHHHhc
Confidence            3556899999999999988864


No 414
>PF11172 DUF2959:  Protein of unknown function (DUF2959);  InterPro: IPR021342  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=34.13  E-value=2.8e+02  Score=23.93  Aligned_cols=42  Identities=5%  Similarity=-0.092  Sum_probs=28.4

Q ss_pred             CCCCchh-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         74 RPTPELP-VRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKE  115 (199)
Q Consensus        74 ~~vN~~a-i~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~  115 (199)
                      ...+... ...|+.+..+|+..+...+.+.+.|..++.....-
T Consensus        55 ~~~~ggdLe~~Y~~ln~~ye~s~~~A~~V~~RI~~vE~Va~AL   97 (201)
T PF11172_consen   55 VNFDGGDLEDKYNALNDEYESSEDAAEEVSDRIDAVEDVADAL   97 (201)
T ss_pred             hCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3344443 44888888888888877777777777776655443


No 415
>TIGR00630 uvra excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=34.07  E-value=27  Score=36.27  Aligned_cols=22  Identities=32%  Similarity=0.360  Sum_probs=18.5

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +.+..|||||++.++||-.|+.
T Consensus       824 ~~~~tLSgGe~QRl~LA~aL~~  845 (924)
T TIGR00630       824 QPATTLSGGEAQRIKLAKELSK  845 (924)
T ss_pred             CccccCCHHHHHHHHHHHHHhh
Confidence            4567899999999999988874


No 416
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]
Probab=33.84  E-value=28  Score=32.52  Aligned_cols=21  Identities=38%  Similarity=0.379  Sum_probs=17.7

Q ss_pred             cccccCCcchHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfA  187 (199)
                      +..++||||.|+++.||=-||
T Consensus       160 ~yp~eLSGGMqQRVGLARAla  180 (386)
T COG4175         160 KYPNELSGGMQQRVGLARALA  180 (386)
T ss_pred             cCcccccchHHHHHHHHHHHc
Confidence            455799999999999997665


No 417
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=33.80  E-value=22  Score=34.87  Aligned_cols=16  Identities=38%  Similarity=0.426  Sum_probs=13.5

Q ss_pred             ccCCcchHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALV  185 (199)
Q Consensus       170 ~~LSGGEKSlaaLalI  185 (199)
                      ..|||||++++|+|=-
T Consensus       455 ~~LSgGQ~QRlaLARA  470 (559)
T COG4988         455 AGLSGGQAQRLALARA  470 (559)
T ss_pred             CCCCHHHHHHHHHHHH
Confidence            4799999999999843


No 418
>PF08946 Osmo_CC:  Osmosensory transporter coiled coil;  InterPro: IPR015041 The osmosensory transporter coiled coil is a C-terminal domain found in various bacterial osmoprotective transporters, such as ProP, Proline/betaine transporter, Proline permease 2 and the citrate proton symporters. It adopts an antiparallel coiled-coil structure, and is essential for osmosensory and osmoprotectant transporter function []. ; PDB: 1R48_B.
Probab=33.74  E-value=1e+02  Score=20.43  Aligned_cols=28  Identities=11%  Similarity=0.121  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         87 RSKEMQAVLATLNTYCTGYEQCLSKRQK  114 (199)
Q Consensus        87 ~~er~e~L~~e~~~l~~~I~~L~~kr~~  114 (199)
                      +.+.++.++..++++...|++|.++|..
T Consensus        10 Lqe~~d~IEqkiedid~qIaeLe~KR~~   37 (46)
T PF08946_consen   10 LQEHYDNIEQKIEDIDEQIAELEAKRQR   37 (46)
T ss_dssp             -----THHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhHHHhHHHHHHHHHHHHHHHHH
Confidence            3456677777777778888888877654


No 419
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=33.65  E-value=26  Score=30.79  Aligned_cols=22  Identities=36%  Similarity=0.386  Sum_probs=17.7

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +.+-+||||+|+.+.+|=-+|.
T Consensus       128 ~~i~qLSGGmrQRvGiARALa~  149 (259)
T COG4525         128 KYIWQLSGGMRQRVGIARALAV  149 (259)
T ss_pred             cceEeecchHHHHHHHHHHhhc
Confidence            3456899999999999876664


No 420
>TIGR02680 conserved hypothetical protein TIGR02680. Members of this protein family belong to a conserved gene four-gene neighborhood found sporadically in a phylogenetically broad range of bacteria: Nocardia farcinica, Symbiobacterium thermophilum, and Streptomyces avermitilis (Actinobacteria), Geobacillus kaustophilus (Firmicutes), Azoarcus sp. EbN1 and Ralstonia solanacearum (Betaproteobacteria). Proteins in this family average over 1400 amino acids in length.
Probab=33.42  E-value=30  Score=37.23  Aligned_cols=20  Identities=40%  Similarity=0.537  Sum_probs=16.5

Q ss_pred             ccccCCcchHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfA  187 (199)
                      ....||||||.+++...+||
T Consensus      1244 ~~~~lSgGek~~~~~~~l~a 1263 (1353)
T TIGR02680      1244 RFGPASGGERALALYVPLFA 1263 (1353)
T ss_pred             cccCCCchHHHHHHHHHHHH
Confidence            45789999999998766666


No 421
>TIGR03642 cas_csx13 CRISPR-associated protein, Csx13 family. This model describes a protein N-terminal protein sequence domain strictly associated with CRISPR and CRISPR-associated protein systems. This model and TIGR02584 identify two separate clades from a larger homology domain family, both CRISPR-associated, while other homologs are found that may not be. Members are found in bacteria that include Pelotomaculum thermopropionicum SI, Thermoanaerobacter tengcongensis MB4, and Roseiflexus sp. RS-1, and in archaea that include Thermoplasma volcanium, Picrophilus torridus, and Methanospirillum hungatei. The molecular function is unknown.
Probab=33.41  E-value=31  Score=27.30  Aligned_cols=13  Identities=31%  Similarity=0.580  Sum_probs=10.8

Q ss_pred             cCCcchHHHHHHH
Q psy12760        171 CLSGGEKTLASLA  183 (199)
Q Consensus       171 ~LSGGEKSlaaLa  183 (199)
                      ++|||.|+|+..+
T Consensus        96 ~iaGGRK~Ms~~~  108 (124)
T TIGR03642        96 NISGGRKIMTIIL  108 (124)
T ss_pred             EecCCHHHHHHHH
Confidence            7999999987653


No 422
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=33.39  E-value=28  Score=34.24  Aligned_cols=17  Identities=41%  Similarity=0.530  Sum_probs=14.2

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      ..||||||.+.|||=++
T Consensus       473 ~~LSGGE~rRLAlAR~L  489 (573)
T COG4987         473 RRLSGGERRRLALARAL  489 (573)
T ss_pred             CcCCchHHHHHHHHHHH
Confidence            47999999999998543


No 423
>PF07526 POX:  Associated with HOX;  InterPro: IPR006563 This domain in found exclusively in plant proteins, associated with HOX domains which may suggest these proteins are homeodomain transcription factors.
Probab=33.36  E-value=1.9e+02  Score=23.23  Aligned_cols=46  Identities=11%  Similarity=0.113  Sum_probs=26.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCceE
Q psy12760         90 EMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKA  140 (199)
Q Consensus        90 r~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~~gG~a  140 (199)
                      +..+++..+.+|..++++++++.+.    +++++..-.+. |..+...|.|
T Consensus        71 ~~~e~q~kK~KLl~mL~eVd~RY~q----Y~~Qmq~Vvss-Fe~vaG~gaA  116 (140)
T PF07526_consen   71 ERQELQRKKAKLLSMLDEVDRRYRQ----YYDQMQAVVSS-FEAVAGLGAA  116 (140)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHH-HHHHhcCCcc
Confidence            3344555566667777777765544    55555555543 5555544554


No 424
>cd07599 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins. BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. This subfamily is composed of fungal proteins with similarity to Saccharomyces cerevisiae Reduced viability upon starvation protein 167 (Rvs167p) and Schizosaccharomyces pombe Hob1 (homolog of Bin1). S. cerevisiae Rvs167p plays a role in regulation of the actin cytoskeleton, endocytosis, and sporulation. It forms a heterodimer with another BAR domain protein Rvs161p. Rvs161p and Rvs167p share common functions but are not interchangeable. Their BAR domains cannot be replaced with each other and the overexpression of one cannot suppress the mutant phenotypes of the other. Rvs167p also interacts with the GTPase activating protein (GAP) Gyp5p, which is involved in ER to Golgi vesicle trafficking. BAR domains fo
Probab=33.24  E-value=2.7e+02  Score=23.21  Aligned_cols=52  Identities=12%  Similarity=0.208  Sum_probs=37.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12760         82 RDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQML  134 (199)
Q Consensus        82 ~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L  134 (199)
                      ++|++...++..+......|.+..+.....+.. ....+..+...|..+|.-.
T Consensus         2 ~~f~~~~~~f~~~e~~~~kL~k~~k~y~~a~~~-l~~~~~~~~~~~~~ly~p~   53 (216)
T cd07599           2 EQFEELEKDFKSLEKSLKKLIEQSKAFRDSWRS-ILTHQIAFAKEFAELYDPI   53 (216)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHhCCc
Confidence            467888888888888888888777777777655 3346666777777766633


No 425
>PLN03130 ABC transporter C family member; Provisional
Probab=33.18  E-value=22  Score=38.89  Aligned_cols=15  Identities=40%  Similarity=0.490  Sum_probs=12.9

Q ss_pred             ccCCcchHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLAL  184 (199)
Q Consensus       170 ~~LSGGEKSlaaLal  184 (199)
                      ..||||||++.+||=
T Consensus      1373 ~nLSgGQrQrlaLAR 1387 (1622)
T PLN03130       1373 ENFSVGQRQLLSLAR 1387 (1622)
T ss_pred             CCCCHHHHHHHHHHH
Confidence            379999999999874


No 426
>PF05377 FlaC_arch:  Flagella accessory protein C (FlaC);  InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct []. In several archaea, the flagellin genes are followed immediately by the flagellar accessory genes flaCDEFGHIJ. The gene products may have a role in translocation, secretion, or assembly of the flagellum. FlaC is a protein whose exact role is unknown but it has been shown to be membrane-associated (by immuno-blotting fractionated cells) [].
Probab=32.62  E-value=1.7e+02  Score=20.14  Aligned_cols=36  Identities=14%  Similarity=0.177  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         92 QAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQ  128 (199)
Q Consensus        92 e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs  128 (199)
                      ++++.+..++...+..++++-. .+....+.+++++.
T Consensus         3 ~elEn~~~~~~~~i~tvk~en~-~i~~~ve~i~envk   38 (55)
T PF05377_consen    3 DELENELPRIESSINTVKKENE-EISESVEKIEENVK   38 (55)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHH
Confidence            3444444444444444444332 23335566666665


No 427
>PF07673 DUF1602:  Protein of unknown function (DUF1602);  InterPro: IPR011633 These proteins have no known function.
Probab=32.56  E-value=16  Score=23.37  Aligned_cols=11  Identities=64%  Similarity=0.863  Sum_probs=9.3

Q ss_pred             hhhhhhccccc
Q psy12760         15 KRRAIVTRPCS   25 (199)
Q Consensus        15 ~~~~~~~~~~~   25 (199)
                      +-|||-||||+
T Consensus        13 ~arA~atrC~~   23 (39)
T PF07673_consen   13 SARAIATRCCS   23 (39)
T ss_pred             HHHHHHHHhcC
Confidence            45899999996


No 428
>PRK14127 cell division protein GpsB; Provisional
Probab=32.56  E-value=1.3e+02  Score=23.33  Aligned_cols=38  Identities=8%  Similarity=0.024  Sum_probs=18.1

Q ss_pred             CCCchhHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         75 PTPELPVRDYA-KRSKEMQAVLATLNTYCTGYEQCLSKR  112 (199)
Q Consensus        75 ~vN~~ai~ey~-e~~er~e~L~~e~~~l~~~I~~L~~kr  112 (199)
                      .-++.-+++|. ++-+.|+.+.++...+++.+..++++.
T Consensus        22 GYd~~EVD~FLd~V~~dye~l~~e~~~Lk~e~~~l~~~l   60 (109)
T PRK14127         22 GYDQDEVDKFLDDVIKDYEAFQKEIEELQQENARLKAQV   60 (109)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33444455553 333455555555555555555444433


No 429
>PF04977 DivIC:  Septum formation initiator;  InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation []. These proteins are mainly composed of an N-terminal coiled-coil. DivIB, DivIC and FtsL inter-depend on each other for stabilisation and localisation. The latter two form a heterodimer. DivIC is always centre cell but the other two associate with it during septation [].; GO: 0007049 cell cycle
Probab=31.68  E-value=1.7e+02  Score=19.91  Aligned_cols=32  Identities=9%  Similarity=0.143  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         82 RDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQ  113 (199)
Q Consensus        82 ~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~  113 (199)
                      ..+..+..++.+++++.+.+++..++++++..
T Consensus        17 ~~~~~~~~ei~~l~~~i~~l~~e~~~L~~ei~   48 (80)
T PF04977_consen   17 SRYYQLNQEIAELQKEIEELKKENEELKEEIE   48 (80)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34445555566666666655555555555443


No 430
>PHA03041 virion core protein; Provisional
Probab=31.54  E-value=2.2e+02  Score=23.38  Aligned_cols=47  Identities=4%  Similarity=0.129  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         81 VRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRV  127 (199)
Q Consensus        81 i~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~f  127 (199)
                      ..||+..+.+--.|+.+-++|-+-|.-.+..-..+++...+.+.++|
T Consensus        99 ~kE~esIKdeT~sLQ~es~~LV~DIs~AkdtTfdAiNaiM~dL~kkf  145 (153)
T PHA03041         99 IKELESIKDETSSLQNESDSLVDDISTAKDTTFDAINAIMKDLKKKF  145 (153)
T ss_pred             HHHHHHHhHHHHHHHHHHHHHHHHHHHhhhchHHHHHHHHHHHHHHh
Confidence            44555555555555555555555554444443444444444444444


No 431
>PTZ00243 ABC transporter; Provisional
Probab=31.52  E-value=32  Score=37.56  Aligned_cols=19  Identities=42%  Similarity=0.317  Sum_probs=15.8

Q ss_pred             cccCCcchHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfA  187 (199)
                      ...||||||++++||--+.
T Consensus       780 g~~LSGGQkqRvaLARAl~  798 (1560)
T PTZ00243        780 GVNLSGGQKARVSLARAVY  798 (1560)
T ss_pred             CCCCCHHHHHHHHHHHHHh
Confidence            4579999999999987654


No 432
>PF06193 Orthopox_A5L:  Orthopoxvirus A5L protein-like;  InterPro: IPR010396 This family consists of several Orthopoxvirus A5L proteins. The vaccinia virus WR A5L open reading frame (corresponding to open reading frame A4L in vaccinia virus Copenhagen) encodes an immunodominant late protein found in the core of the vaccinia virion. The A5 protein appears to be required for the immature virion to form the brick-shaped intracellular mature virion [].
Probab=31.35  E-value=3.1e+02  Score=22.91  Aligned_cols=49  Identities=14%  Similarity=0.218  Sum_probs=35.3

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         80 PVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQ  128 (199)
Q Consensus        80 ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs  128 (199)
                      .+.||+..+.+.-.|..+.+.|..-|...++.-..+.....+.+.+.|+
T Consensus       112 IikEl~dik~~t~~LQ~es~~Lv~DIs~AKe~T~~AIn~IM~~L~k~fq  160 (166)
T PF06193_consen  112 IIKELNDIKDETSSLQAESNSLVTDISDAKESTQDAINDIMKDLSKKFQ  160 (166)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            4667778888888888888888877777666666666666666666654


No 433
>TIGR01257 rim_protein retinal-specific rim ABC transporter. This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease.
Probab=30.92  E-value=28  Score=39.51  Aligned_cols=23  Identities=30%  Similarity=0.322  Sum_probs=18.8

Q ss_pred             ccccccCCcchHHHHHHHHHHHH
Q psy12760        166 WKSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       166 ~~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      .+....||||||.++++|--|+.
T Consensus      1056 ~~~~~~LSGGqKQRLsLArALi~ 1078 (2272)
T TIGR01257      1056 NEEAQDLSGGMQRKLSVAIAFVG 1078 (2272)
T ss_pred             cCChhhCCHHHHHHHHHHHHHHc
Confidence            34567899999999999987764


No 434
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]
Probab=30.79  E-value=30  Score=33.79  Aligned_cols=20  Identities=30%  Similarity=0.497  Sum_probs=17.0

Q ss_pred             cccccCCcchHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVF  186 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIf  186 (199)
                      +.++.|||||-+.+|+|--+
T Consensus       209 r~v~~LSGGELQr~aIaa~l  228 (591)
T COG1245         209 RDVSELSGGELQRVAIAAAL  228 (591)
T ss_pred             hhhhhcCchHHHHHHHHHHH
Confidence            57789999999999998654


No 435
>PF10073 DUF2312:  Uncharacterized protein conserved in bacteria (DUF2312);  InterPro: IPR018753 This entry is represented by Azospirillum phage Cd, Gp10. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  Members of this family of hypothetical bacterial proteins have no known function. 
Probab=30.69  E-value=1.9e+02  Score=21.07  Aligned_cols=33  Identities=0%  Similarity=0.039  Sum_probs=22.3

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         80 PVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKR  112 (199)
Q Consensus        80 ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr  112 (199)
                      |.++....-++++.|+.+++.+.+.|+++-.+.
T Consensus         2 a~~~Lr~~ieRiErLEeEk~~i~~dikdVyaEA   34 (74)
T PF10073_consen    2 AAEQLRQFIERIERLEEEKKAISDDIKDVYAEA   34 (74)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345666777788888888877766666654443


No 436
>KOG3856|consensus
Probab=30.69  E-value=1.2e+02  Score=24.34  Aligned_cols=37  Identities=5%  Similarity=0.057  Sum_probs=30.6

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         78 ELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQK  114 (199)
Q Consensus        78 ~~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~  114 (199)
                      ...+..|+.++.++.++-+.+..+.+.+..|+++...
T Consensus         6 ~~~~~~ye~~kaEL~elikkrqe~eetl~nLe~qIY~   42 (135)
T KOG3856|consen    6 TDELKSYEDTKAELAELIKKRQELEETLANLERQIYA   42 (135)
T ss_pred             cccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3456789999999999999998888888888887754


No 437
>PF04111 APG6:  Autophagy protein Apg6;  InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells. In yeast, 15 Apg proteins coordinate the formation of autophagosomes. No molecule involved in autophagy has yet been identified in higher eukaryotes []. The pre-autophagosomal structure contains at least five Apg proteins: Apg1p, Apg2p, Apg5p, Aut7p/Apg8p and Apg16p. It is found in the vacuole []. The C-terminal glycine of Apg12p is conjugated to a lysine residue of Apg5p via an isopeptide bond. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. Auotphagy protein 16 (Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate []. Autophagy protein 5 (Apg5) is directly required for the import of aminopeptidase I via the cytoplasm-to-vacuole targeting pathway []. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway [].; GO: 0006914 autophagy; PDB: 3Q8T_A 3VP7_A 4DDP_A.
Probab=30.15  E-value=3.7e+02  Score=24.21  Aligned_cols=17  Identities=18%  Similarity=0.182  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHhcHhhh
Q psy12760        180 ASLALVFALHYYWLWLQ  196 (199)
Q Consensus       180 aaLalIfAL~~~~~~~~  196 (199)
                      +-.||+..++.+.-++.
T Consensus       241 am~~~L~~~~q~~~~~~  257 (314)
T PF04111_consen  241 AMVAFLDCLQQLAEFVE  257 (314)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            66777777777776664


No 438
>PRK13694 hypothetical protein; Provisional
Probab=29.78  E-value=2e+02  Score=21.37  Aligned_cols=35  Identities=3%  Similarity=0.019  Sum_probs=26.7

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         78 ELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKR  112 (199)
Q Consensus        78 ~~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr  112 (199)
                      ..+.++....-+|++.|+.+++.+.+.|+++-.+.
T Consensus         8 ~va~~~Lr~fIERIERLEeEkk~i~~dikdVyaEA   42 (83)
T PRK13694          8 VVAKEQLRAFIERIERLEEEKKTISDDIKDVYAEA   42 (83)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34777888888999999999888777777665444


No 439
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR). The model describes the cystis fibrosis transmembrane conductor regulator (CFTR) in eukaryotes. The principal role of this protein is chloride ion conductance. The protein is predicted to consist of 12 transmembrane domains. Mutations or lesions in the genetic loci have been linked to the aetiology of asthma, bronchiectasis, chronic obstructive pulmonary disease etc. Disease-causing mutations have been studied by 36Cl efflux assays in vitro cell cultures and electrophysiology, all of which point to the impairment of chloride channel stability and not the biosynthetic processing per se.
Probab=29.33  E-value=36  Score=36.90  Aligned_cols=18  Identities=39%  Similarity=0.399  Sum_probs=15.2

Q ss_pred             ccCCcchHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFA  187 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfA  187 (199)
                      ..||||||++++||--+.
T Consensus       547 ~~LSgGqkqRi~lARAl~  564 (1490)
T TIGR01271       547 ITLSGGQRARISLARAVY  564 (1490)
T ss_pred             CCcCHHHHHHHHHHHHHH
Confidence            579999999999986554


No 440
>PF10079 DUF2317:  Uncharacterized protein conserved in bacteria (DUF2317);  InterPro: IPR011199  Members of this protein family include BshC, which is an enzyme required for bacillithiol biosynthesis and described as a cysteine-adding enzyme. Bacillithiol is a low-molecular-weight thiol, an analog of glutathione and mycothiol, and is found largely in the Firmicutes. 
Probab=29.19  E-value=3.4e+02  Score=26.55  Aligned_cols=42  Identities=10%  Similarity=-0.060  Sum_probs=33.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCce
Q psy12760         98 LNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGK  139 (199)
Q Consensus        98 ~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~~gG~  139 (199)
                      ...+...++.|+++..+....-.+..-++|..+-..|+|+|.
T Consensus       461 ~~~~~~ql~~Le~k~~~a~~rk~~~~l~q~~~l~~~L~P~g~  502 (542)
T PF10079_consen  461 ESKILKQLDYLEKKLLKAEKRKHETALRQLDRLENSLFPNGS  502 (542)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhcCCCCC
Confidence            345666788888888888888888888888888889998875


No 441
>cd08327 CARD_RAIDD Caspase activation and recruitment domain of RIP-associated ICH-1 homologous protein with a death domain. Caspase activation and recruitment domain (CARD) of RAIDD (RIP-associated ICH-1 homologous protein with a death domain), also known as CRADD (Caspase and RIP adaptor). RAIDD is an adaptor protein that together with the p53-inducible protein PIDD and caspase-2, forms the PIDDosome complex, which is required for caspase-2 activation and plays a role in mediating stress-induced apoptosis. RAIDD contains an N-terminal CARD, which interacts with the caspase-2 CARD, and a C-terminal Death domain (DD), which interacts with the DD of PIDD. In general, CARDs are DDs associated with caspases. They are known to be important in the signaling pathways for apoptosis, inflammation and host-defense mechanisms. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodime
Probab=29.11  E-value=2.5e+02  Score=21.01  Aligned_cols=28  Identities=11%  Similarity=0.141  Sum_probs=22.1

Q ss_pred             hhhHHHHHhhhhhhhccccchhhHHHHH
Q psy12760          6 EHHEEIVEKKRRAIVTRPCSITSWMAVL   33 (199)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~   33 (199)
                      +.|.++..+.|.++|.+.|..-.|+..|
T Consensus         3 e~hr~~Lr~~R~~Lv~dl~~~~~v~~~L   30 (94)
T cd08327           3 PKHKQLLRSQRLELSAELLVDGLVIQYL   30 (94)
T ss_pred             HHHHHHHHHHHHHHHHHccchHHHHHHH
Confidence            6789999999999998877665566643


No 442
>KOG0060|consensus
Probab=28.98  E-value=32  Score=34.32  Aligned_cols=16  Identities=38%  Similarity=0.521  Sum_probs=13.7

Q ss_pred             cCCcchHHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALVF  186 (199)
Q Consensus       171 ~LSGGEKSlaaLalIf  186 (199)
                      .|||||+++.|+|=+|
T Consensus       570 vLS~GEqQRLa~ARLf  585 (659)
T KOG0060|consen  570 VLSPGEQQRLAFARLF  585 (659)
T ss_pred             hcCHHHHHHHHHHHHH
Confidence            5999999999988765


No 443
>smart00574 POX domain associated with HOX domains.
Probab=27.12  E-value=2.9e+02  Score=22.52  Aligned_cols=44  Identities=11%  Similarity=0.084  Sum_probs=23.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCceE
Q psy12760         92 QAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQECYQMLTFGGKA  140 (199)
Q Consensus        92 e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~iF~~L~~gG~a  140 (199)
                      .+++..+.+|..++++++++.+.    +++++..-.+. |..+...|.|
T Consensus        73 ~e~q~kk~kLl~mL~eVd~RY~q----Y~~qmq~v~ss-Fe~vaG~g~a  116 (140)
T smart00574       73 QELQRKKAKLLSMLEEVDRRYKH----YYEQMQTVVSS-FDQAAGLGAA  116 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHH-HHHHhcCCch
Confidence            34455555666777777655433    45555444443 4445544443


No 444
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]
Probab=27.10  E-value=1.3e+02  Score=31.46  Aligned_cols=61  Identities=26%  Similarity=0.202  Sum_probs=34.2

Q ss_pred             HHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHhhhcCCceEEEEeccCCCCCCcceEEEEECCCCcccccccCCcchH
Q psy12760        100 TYCTGYEQCL--SKRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGIKYVVRPPRKSWKSIDCLSGGEK  177 (199)
Q Consensus       100 ~l~~~I~~L~--~kr~~~F~~~f~~In~~fs~iF~~L~~gG~a~L~l~~~edp~~~GI~I~V~p~gk~~~~l~~LSGGEK  177 (199)
                      +..+.++.++  .+....-...++.|.+.+..    |..-|=.+|.|+                     +....|||||-
T Consensus       433 ~~~~f~~~l~l~~~~~~ia~~ilkei~~RL~f----L~~VGL~YLtL~---------------------R~a~TLSGGEa  487 (935)
T COG0178         433 DALEFFENLKLSEKEKKIAEPILKEIKERLGF----LVDVGLGYLTLS---------------------RSAGTLSGGEA  487 (935)
T ss_pred             HHHHHHHhCCCchhhHHHHHHHHHHHHHHHHH----HHHcCcCccccc---------------------ccCCCcChhHH
Confidence            4444555554  33334445556666666654    222233344432                     23458999999


Q ss_pred             HHHHHHHH
Q psy12760        178 TLASLALV  185 (199)
Q Consensus       178 SlaaLalI  185 (199)
                      ++..||=-
T Consensus       488 QRIRLAtq  495 (935)
T COG0178         488 QRIRLATQ  495 (935)
T ss_pred             HHHHHHHH
Confidence            99988743


No 445
>PRK12765 flagellar capping protein; Provisional
Probab=26.52  E-value=2.9e+02  Score=27.28  Aligned_cols=46  Identities=4%  Similarity=0.067  Sum_probs=33.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHH
Q psy12760         85 AKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFD---TNFVKIGKRVQEC  130 (199)
Q Consensus        85 ~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~---~~f~~In~~fs~i  130 (199)
                      +-+.++++.|.++++.+.+.|+...++++.+|.   ..+.+++..++.+
T Consensus       535 ~~l~~~~~~l~~~~~~~~~rl~~~~~r~~~qf~alD~~i~~l~~t~s~l  583 (595)
T PRK12765        535 ESLTNEIKSLTTSKESTQELIDTKYETMANKWLQYDSIIAKLEQQFSTL  583 (595)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHH
Confidence            345678888889999999999999888887776   4455555555433


No 446
>PHA01750 hypothetical protein
Probab=26.46  E-value=1.9e+02  Score=20.83  Aligned_cols=11  Identities=18%  Similarity=0.081  Sum_probs=4.2

Q ss_pred             HHHHHHHHHHH
Q psy12760         99 NTYCTGYEQCL  109 (199)
Q Consensus        99 ~~l~~~I~~L~  109 (199)
                      +.+...|++++
T Consensus        45 dNL~~ei~~~k   55 (75)
T PHA01750         45 DNLKTEIEELK   55 (75)
T ss_pred             HHHHHHHHHHH
Confidence            33333333333


No 447
>COG3750 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.42  E-value=2.6e+02  Score=20.82  Aligned_cols=32  Identities=3%  Similarity=0.042  Sum_probs=21.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         79 LPVRDYAKRSKEMQAVLATLNTYCTGYEQCLS  110 (199)
Q Consensus        79 ~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~  110 (199)
                      -|..|....-++++.|+.+++.|.+.|+++-.
T Consensus        11 va~~QLrafIerIERlEeEk~~i~~dikdvy~   42 (85)
T COG3750          11 VAAGQLRAFIERIERLEEEKKTIADDIKDVYA   42 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35667777777888888877766665555533


No 448
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=26.34  E-value=23  Score=30.54  Aligned_cols=18  Identities=33%  Similarity=0.490  Sum_probs=15.2

Q ss_pred             ccCCcchHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFA  187 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfA  187 (199)
                      ..+||||++.+.+|=-|.
T Consensus       151 aTFSGGEqQRVNIaRgfi  168 (235)
T COG4778         151 ATFSGGEQQRVNIARGFI  168 (235)
T ss_pred             cccCCchheehhhhhhhh
Confidence            579999999999986654


No 449
>PLN03140 ABC transporter G family member; Provisional
Probab=25.97  E-value=44  Score=36.42  Aligned_cols=19  Identities=16%  Similarity=0.193  Sum_probs=16.5

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..||||||.++++|--++.
T Consensus      1018 ~~LSgGerkRvsIa~aL~~ 1036 (1470)
T PLN03140       1018 TGLSTEQRKRLTIAVELVA 1036 (1470)
T ss_pred             CCcCHHHHHHHHHHHHHhh
Confidence            5799999999999987764


No 450
>PF06005 DUF904:  Protein of unknown function (DUF904);  InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation. It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA.; GO: 0000917 barrier septum formation, 0043093 cytokinesis by binary fission, 0005737 cytoplasm; PDB: 2JEE_A.
Probab=24.87  E-value=2.6e+02  Score=19.91  Aligned_cols=19  Identities=16%  Similarity=0.031  Sum_probs=9.4

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q psy12760         79 LPVRDYAKRSKEMQAVLAT   97 (199)
Q Consensus        79 ~ai~ey~e~~er~e~L~~e   97 (199)
                      .|++.+..++.+.++|+.+
T Consensus        15 ~aveti~~Lq~e~eeLke~   33 (72)
T PF06005_consen   15 QAVETIALLQMENEELKEK   33 (72)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3455555555555555444


No 451
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional
Probab=24.76  E-value=49  Score=32.49  Aligned_cols=19  Identities=32%  Similarity=0.391  Sum_probs=16.5

Q ss_pred             ccCCcchHHHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIfAL  188 (199)
                      ..|||||+..++||--|+.
T Consensus       143 ~~LS~Gq~qrv~LAraL~~  161 (648)
T PRK10535        143 SQLSGGQQQRVSIARALMN  161 (648)
T ss_pred             ccCCHHHHHHHHHHHHHhc
Confidence            4899999999999987764


No 452
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]
Probab=24.61  E-value=45  Score=33.11  Aligned_cols=16  Identities=38%  Similarity=0.588  Sum_probs=13.5

Q ss_pred             cCCcchHHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALVF  186 (199)
Q Consensus       171 ~LSGGEKSlaaLalIf  186 (199)
                      .||||||+++|+|=++
T Consensus       515 vLS~GEqQRlafARil  530 (604)
T COG4178         515 VLSGGEQQRLAFARLL  530 (604)
T ss_pred             hcChhHHHHHHHHHHH
Confidence            4999999999998553


No 453
>TIGR02584 cas_NE0113 CRISPR-associated protein, NE0113 family. Members of this minor CRISPR-associated (Cas) protein family are found in cas gene clusters in Vibrio vulnificus YJ016, Nitrosomonas europaea ATCC 19718, Mannheimia succiniciproducens MBEL55E, and Verrucomicrobium spinosum.
Probab=24.51  E-value=57  Score=28.20  Aligned_cols=14  Identities=29%  Similarity=0.434  Sum_probs=11.7

Q ss_pred             cCCcchHHHHHHHH
Q psy12760        171 CLSGGEKTLASLAL  184 (199)
Q Consensus       171 ~LSGGEKSlaaLal  184 (199)
                      ++|||.|+|+..+-
T Consensus       124 sIAGGRKtMg~~~g  137 (209)
T TIGR02584       124 SIAGGRKTMGFYLG  137 (209)
T ss_pred             EecCcHHHHHHHHH
Confidence            79999999987653


No 454
>KOG4010|consensus
Probab=24.00  E-value=3.1e+02  Score=23.58  Aligned_cols=100  Identities=12%  Similarity=0.080  Sum_probs=48.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHhhhcCCceEEEEeccCCCCCCcce
Q psy12760         80 PVRDYAKRSKEMQAVLATLNTYCTGYEQCLS----KRQKEFDTNFVKIGKRVQECYQMLTFGGKADLEYKEYSDPYAQGI  155 (199)
Q Consensus        80 ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~----kr~~~F~~~f~~In~~fs~iF~~L~~gG~a~L~l~~~edp~~~GI  155 (199)
                      ..+|-++++.++..+++++..|+..+..-.+    -+++-=...|..+..+++.-++.+. ...++......--.|...+
T Consensus        42 Se~Ekeelr~EL~kvEeEI~TLrqVLaAKerH~~ELKRKLGlt~~~EL~qnisksw~d~q-~st~y~kt~~~~g~~~~~v  120 (208)
T KOG4010|consen   42 SEEEKEELRTELAKVEEEIVTLRQVLAAKERHAAELKRKLGLTVLKELKQNISKSWKDVQ-ASTAYVKTSQSVGTFTKTV  120 (208)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcchHHHHHHHHHHHHhhhh-hHHHHHHhhhhhcccccee
Confidence            3555566666666666666666554432211    1122223467777777776555443 1222322211111122222


Q ss_pred             EEEEECCCCcccccccCCcchHHHHHHHHHH
Q psy12760        156 KYVVRPPRKSWKSIDCLSGGEKTLASLALVF  186 (199)
Q Consensus       156 ~I~V~p~gk~~~~l~~LSGGEKSlaaLalIf  186 (199)
                      .+  .|   .++.+ .=+-|||+-++++-+=
T Consensus       121 y~--~~---~tqet-lSqagQKtsaa~ssvg  145 (208)
T KOG4010|consen  121 YE--AP---LTQET-LSQAGQKTSAAFSSVG  145 (208)
T ss_pred             ee--cc---cchhh-HHhhhHHHHHHHHHHh
Confidence            22  12   12222 1278999988887653


No 455
>PF09623 Cas_NE0113:  CRISPR-associated protein NE0113 (Cas_NE0113);  InterPro: IPR019092 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.   This entry represents a Cas protein family found in both bacteria and arachaea. The function of these proteins is unknown. 
Probab=23.39  E-value=57  Score=28.28  Aligned_cols=15  Identities=33%  Similarity=0.474  Sum_probs=12.7

Q ss_pred             cCCcchHHHHHHHHH
Q psy12760        171 CLSGGEKTLASLALV  185 (199)
Q Consensus       171 ~LSGGEKSlaaLalI  185 (199)
                      ++|||.|+|+..+..
T Consensus       118 sIAGGRKtMs~~~~~  132 (224)
T PF09623_consen  118 SIAGGRKTMSFYAGY  132 (224)
T ss_pred             EecCChHHHHHHHHH
Confidence            799999999877655


No 456
>PHA02109 hypothetical protein
Probab=23.35  E-value=2.6e+02  Score=23.95  Aligned_cols=58  Identities=5%  Similarity=0.042  Sum_probs=30.7

Q ss_pred             CCCCCccchhhhhcCCCCch-----hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         60 WRSPVSGSDVTAAVRPTPEL-----PVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKEFD  117 (199)
Q Consensus        60 lr~~~~~i~~l~~~~~vN~~-----ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~  117 (199)
                      +--.-++|+-++.--.+.++     .++|--++.-+++.|..+...++..|..+++..+..+.
T Consensus       166 ~~AsTE~ID~~~~~~t~~~L~~~~~~L~~I~~L~~ki~~LS~E~~Q~~~Ki~N~R~~Vk~~LS  228 (233)
T PHA02109        166 IHASTERIDQVERSHTGENLEGLTDKLKQISELTIKLEALSDEACQVKHKILNLRAEVKRRLS  228 (233)
T ss_pred             ccccHHHHHHHHhccchhhhhhhhHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33444556555543333222     34455555556666666666666666666655555443


No 457
>PRK00888 ftsB cell division protein FtsB; Reviewed
Probab=23.20  E-value=3.4e+02  Score=20.55  Aligned_cols=31  Identities=16%  Similarity=0.126  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         82 RDYAKRSKEMQAVLATLNTYCTGYEQCLSKR  112 (199)
Q Consensus        82 ~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr  112 (199)
                      -.|.++++++++++.+.++++..-+.|+++.
T Consensus        27 ~~~~~l~~q~~~~~~e~~~l~~~n~~L~~eI   57 (105)
T PRK00888         27 LDYWRVNDQVAAQQQTNAKLKARNDQLFAEI   57 (105)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3455555555555555554444444444443


No 458
>PF03904 DUF334:  Domain of unknown function (DUF334);  InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function.
Probab=23.18  E-value=3.4e+02  Score=23.85  Aligned_cols=74  Identities=12%  Similarity=0.118  Sum_probs=33.5

Q ss_pred             HhHhhhccCCcccccC-CCCCCCCCCCCCCCCCccchhhhhcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         33 LSISDILSNSSIHTTP-RSANTMAPASKWRSPVSGSDVTAAVRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQ  107 (199)
Q Consensus        33 ~~~~~~~~~~~~~~~p-~~~~~~~p~~~lr~~~~~i~~l~~~~~vN~~ai~ey~e~~er~e~L~~e~~~l~~~I~~  107 (199)
                      -|.+|+.+|..-.++- ++-++--|-+...+.+.-- .+..+..-|...+....+..++.+..+++.++|...+++
T Consensus         8 ~~~~~~k~n~~~~n~q~~skstgt~s~~~q~~l~ne-e~~eLk~qnkli~K~l~ei~~~qd~reK~~~~I~ssL~e   82 (230)
T PF03904_consen    8 NSMEEEKNNKETNNTQTNSKSTGTQSQKTQMSLENE-EIQELKRQNKLIIKYLSEIEEKQDIREKNLKEIKSSLEE   82 (230)
T ss_pred             hhhHHHhccccccchhhhhhccCCCcHHHHHHHhHH-HHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3677888887433332 3333333333332221100 112233334445566666666555555555544443333


No 459
>PF08663 HalX:  HalX domain;  InterPro: IPR013971  HalX is a protein of unknown function, previously mis-annotated as HoxA-like transcriptional regulator. It is C-terminal to a CheY-like superfamily domain and suggests a role as a response regulator. 
Probab=22.64  E-value=1.3e+02  Score=21.47  Aligned_cols=25  Identities=12%  Similarity=0.308  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         81 VRDYAKRSKEMQAVLATLNTYCTGY  105 (199)
Q Consensus        81 i~ey~e~~er~e~L~~e~~~l~~~I  105 (199)
                      -++|.++..++++++.+.+.....+
T Consensus        35 seeY~eL~~ri~~lr~~ld~~~~~~   59 (71)
T PF08663_consen   35 SEEYQELEDRIEELRAELDDTLDEF   59 (71)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            4567777777777766665544433


No 460
>PF10046 BLOC1_2:  Biogenesis of lysosome-related organelles complex-1 subunit 2 ;  InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system []. 
Probab=22.55  E-value=3.3e+02  Score=20.20  Aligned_cols=27  Identities=11%  Similarity=0.096  Sum_probs=16.0

Q ss_pred             cCCCCchhHHHHHHHHHHHHHHHHHHH
Q psy12760         73 VRPTPELPVRDYAKRSKEMQAVLATLN   99 (199)
Q Consensus        73 ~~~vN~~ai~ey~e~~er~e~L~~e~~   99 (199)
                      +..+|..+...|.++.+....+....+
T Consensus        26 Le~mN~~~~~kY~~~~~~~~~l~~~~~   52 (99)
T PF10046_consen   26 LENMNKATSLKYKKMKDIAAGLEKNLE   52 (99)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            455666777777766655555444443


No 461
>PF10234 Cluap1:  Clusterin-associated protein-1;  InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin. Cluap1 expression is highest in the nucleus and gradually increases during late S to G2/M phases of the cell cycle and returns to the basal level in the G0/G1 phases. In addition, it is upregulated in colon cancer tissues compared to corresponding non-cancerous mucosa. It thus plays a crucial role in the life of the cell []. 
Probab=22.52  E-value=5.6e+02  Score=22.89  Aligned_cols=23  Identities=17%  Similarity=0.465  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhc
Q psy12760        113 QKEFDTNFVKIGKRVQECYQMLT  135 (199)
Q Consensus       113 ~~~F~~~f~~In~~fs~iF~~L~  135 (199)
                      ++.|++=|+++...++..|..-+
T Consensus       220 RPAfmdEyEklE~EL~~lY~~Y~  242 (267)
T PF10234_consen  220 RPAFMDEYEKLEEELQKLYEIYV  242 (267)
T ss_pred             ChHHHHHHHHHHHHHHHHHHHHH
Confidence            68899999999988887776543


No 462
>PRK00635 excinuclease ABC subunit A; Provisional
Probab=22.12  E-value=53  Score=36.68  Aligned_cols=22  Identities=32%  Similarity=0.505  Sum_probs=18.4

Q ss_pred             cccccCCcchHHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfAL  188 (199)
                      +.+..|||||+++++||-.++.
T Consensus       472 R~~~tLSGGE~QRV~LAraL~~  493 (1809)
T PRK00635        472 RALATLSGGEQERTALAKHLGA  493 (1809)
T ss_pred             CchhhCCHHHHHHHHHHHHHhc
Confidence            3557899999999999988764


No 463
>PRK10803 tol-pal system protein YbgF; Provisional
Probab=21.86  E-value=1.9e+02  Score=25.30  Aligned_cols=51  Identities=2%  Similarity=0.090  Sum_probs=25.4

Q ss_pred             ccchhhhhcCCCCchhH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         65 SGSDVTAAVRPTPELPV----RDYAKRSKEMQAVLATLNTYCTGYEQCLSKRQKE  115 (199)
Q Consensus        65 ~~i~~l~~~~~vN~~ai----~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr~~~  115 (199)
                      +.+..++++-.......    .+.+.++.++..|+.+++...-.++++.++-++.
T Consensus        40 ~r~~~le~~~~~~~~~~~~l~~ql~~lq~ev~~LrG~~E~~~~~l~~~~~rq~~~   94 (263)
T PRK10803         40 DRVTQLERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQI   94 (263)
T ss_pred             HHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHH
Confidence            55555665443333222    2334445555555555555555555555554443


No 464
>TIGR01257 rim_protein retinal-specific rim ABC transporter. This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease.
Probab=21.79  E-value=54  Score=37.43  Aligned_cols=19  Identities=32%  Similarity=0.391  Sum_probs=15.3

Q ss_pred             cccCCcchHHHHHHHHHHH
Q psy12760        169 IDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       169 l~~LSGGEKSlaaLalIfA  187 (199)
                      ...||||||..+++|.-++
T Consensus      2068 ~~~LSGGqKqRLslA~ALi 2086 (2272)
T TIGR01257      2068 AGTYSGGNKRKLSTAIALI 2086 (2272)
T ss_pred             hhhCCHHHHHHHHHHHHHh
Confidence            4579999999988887664


No 465
>PF08580 KAR9:  Yeast cortical protein KAR9;  InterPro: IPR013889  The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules []. KAR9 localises at the shmoo tip in mating cells and at the tip of the growing bud in anaphase []. 
Probab=21.77  E-value=4.1e+02  Score=26.86  Aligned_cols=48  Identities=8%  Similarity=0.153  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHhhh
Q psy12760         87 RSKEMQAVLATLNTYCTGYEQCLSKR-QKEFDTNFVKIGKRVQECYQML  134 (199)
Q Consensus        87 ~~er~e~L~~e~~~l~~~I~~L~~kr-~~~F~~~f~~In~~fs~iF~~L  134 (199)
                      +..+|+.|.++-+.++..++.|+++. .++-...|..++...+.+|..+
T Consensus       240 L~~r~~~L~~k~~~L~~e~~~LK~ELiedRW~~vFr~l~~q~~~m~esv  288 (683)
T PF08580_consen  240 LEDRYERLEKKWKKLEKEAESLKKELIEDRWNIVFRNLGRQAQKMCESV  288 (683)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHH
Confidence            34455555555555555555554433 3334444444444444444444


No 466
>PRK15326 type III secretion system needle complex protein PrgI; Provisional
Probab=21.62  E-value=3.4e+02  Score=20.01  Aligned_cols=40  Identities=8%  Similarity=0.098  Sum_probs=30.6

Q ss_pred             cCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         73 VRPTPELPVRDYAKRSKEMQAVLATLNTYCTGYEQCLSKR  112 (199)
Q Consensus        73 ~~~vN~~ai~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr  112 (199)
                      ..|-||.++.+|+.+..+|.-.+.--...-+.++++....
T Consensus        36 ~~pdnP~~LA~~Qa~l~eyn~~RNaQSn~iKa~KD~~~aI   75 (80)
T PRK15326         36 AKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAI   75 (80)
T ss_pred             cCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5688999999999999998877766666666666666544


No 467
>PRK00635 excinuclease ABC subunit A; Provisional
Probab=21.42  E-value=59  Score=36.31  Aligned_cols=21  Identities=33%  Similarity=0.468  Sum_probs=17.8

Q ss_pred             cccccCCcchHHHHHHHHHHH
Q psy12760        167 KSIDCLSGGEKTLASLALVFA  187 (199)
Q Consensus       167 ~~l~~LSGGEKSlaaLalIfA  187 (199)
                      +....||||||++++||-.++
T Consensus       805 q~~~tLSGGE~QRV~LAraL~  825 (1809)
T PRK00635        805 RPLSSLSGGEIQRLKLAYELL  825 (1809)
T ss_pred             CccccCCHHHHHHHHHHHHHh
Confidence            355689999999999998876


No 468
>KOG4025|consensus
Probab=21.32  E-value=1.9e+02  Score=24.53  Aligned_cols=28  Identities=25%  Similarity=0.325  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHHHhhhcCCceEEEEe
Q psy12760        117 DTNFVKIGKRVQECYQMLTFGGKADLEY  144 (199)
Q Consensus       117 ~~~f~~In~~fs~iF~~L~~gG~a~L~l  144 (199)
                      .+-|-+.++.|+...+.-+..|.+-.++
T Consensus       159 KkEFVkYSK~FS~TLKtYFKdGk~~~~~  186 (207)
T KOG4025|consen  159 KKEFVKYSKRFSNTLKTYFKDGKKCIRV  186 (207)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCCceeEE
Confidence            3456666777776666666556554443


No 469
>KOG0061|consensus
Probab=21.27  E-value=53  Score=32.30  Aligned_cols=17  Identities=47%  Similarity=0.645  Sum_probs=14.5

Q ss_pred             ccCCcchHHHHHHHHHH
Q psy12760        170 DCLSGGEKTLASLALVF  186 (199)
Q Consensus       170 ~~LSGGEKSlaaLalIf  186 (199)
                      +.+|||||.++++|.=+
T Consensus       169 rgiSGGErkRvsia~El  185 (613)
T KOG0061|consen  169 RGLSGGERKRVSIALEL  185 (613)
T ss_pred             CccccchhhHHHHHHHH
Confidence            67999999999998643


No 470
>PF06705 SF-assemblin:  SF-assemblin/beta giardin
Probab=21.25  E-value=5.2e+02  Score=22.04  Aligned_cols=44  Identities=5%  Similarity=0.132  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         86 KRSKEMQAVLATLNTYCTGYEQCLSKRQKEFDTNFVKIGKRVQE  129 (199)
Q Consensus        86 e~~er~e~L~~e~~~l~~~I~~L~~kr~~~F~~~f~~In~~fs~  129 (199)
                      .+...++.|......+...+.+-...+...+......+.+.+..
T Consensus        89 ~~~~~l~~L~~ri~~L~~~i~ee~~~r~~~ie~~~~~l~~~l~~  132 (247)
T PF06705_consen   89 QLQSRLDSLNDRIEALEEEIQEEKEERPQDIEELNQELVRELNE  132 (247)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHH
Confidence            33344444555555555555555555555444444444444443


No 471
>PF09178 DUF1945:  Domain of unknown function (DUF1945);  InterPro: IPR015261 Members of this entry, which are predominantly found in prokaryotic 4-alpha-glucanotransferase, adopt a structure composed of six antiparallel beta-strands, four of which form a beta-sheet and another two form a type I, beta-hairpin. The role of this family of domains, has not, as yet, been defined []. ; PDB: 1LWH_B 1LWJ_B.
Probab=20.93  E-value=47  Score=22.26  Aligned_cols=16  Identities=44%  Similarity=0.464  Sum_probs=9.2

Q ss_pred             CCCCcccccccCCcch
Q psy12760        161 PPRKSWKSIDCLSGGE  176 (199)
Q Consensus       161 p~gk~~~~l~~LSGGE  176 (199)
                      -.++.++-.+.|||||
T Consensus        20 ~~~~SLkv~HNlSg~E   35 (51)
T PF09178_consen   20 DDQKSLKVFHNLSGEE   35 (51)
T ss_dssp             ETTEEEEEEEE-SSS-
T ss_pred             CCCEEEEEEEecCCCE
Confidence            3345566667888887


No 472
>PF04568 IATP:  Mitochondrial ATPase inhibitor, IATP;  InterPro: IPR007648  ATP synthase inhibitor prevents the enzyme from switching to ATP hydrolysis during collapse of the electrochemical gradient, for example during oxygen deprivation [] ATP synthase inhibitor forms a one to one complex with the F1 ATPase, possibly by binding at the alpha-beta interface. It is thought to inhibit ATP synthesis by preventing the release of ATP []. The minimum inhibitory region for bovine inhibitor (P01096 from SWISSPROT) is from residues 39 to 72 []. The inhibitor has two oligomeric states, dimer (the active state) and tetramer. At low pH , the inhibitor forms a dimer via antiparallel coiled coil interactions between the C-terminal regions of two monomers. At high pH, the inhibitor forms tetramers and higher oligomers by coiled coil interactions involving the N terminus and inhibitory region, thus preventing the inhibitory activity []. ; GO: 0004857 enzyme inhibitor activity, 0045980 negative regulation of nucleotide metabolic process, 0005739 mitochondrion; PDB: 1GMJ_B 1OHH_H 1HF9_B 2V7Q_J.
Probab=20.84  E-value=2.9e+02  Score=21.10  Aligned_cols=23  Identities=4%  Similarity=0.094  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHH----HHHHHHHHHHH
Q psy12760         89 KEMQAVLATLNT----YCTGYEQCLSK  111 (199)
Q Consensus        89 er~e~L~~e~~~----l~~~I~~L~~k  111 (199)
                      ++++.|+++.++    -++.|+++++.
T Consensus        72 EqL~~Lk~kl~~e~~~~~k~i~~le~~   98 (100)
T PF04568_consen   72 EQLKKLKEKLKEEIEHHRKEIDELEKH   98 (100)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            455555544444    45555555543


No 473
>PF15079 DUF4546:  Domain of unknown function (DUF4546)
Probab=20.54  E-value=3.6e+02  Score=22.88  Aligned_cols=21  Identities=24%  Similarity=0.327  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHHHHHHHhhh
Q psy12760        114 KEFDTNFVKIGKRVQECYQML  134 (199)
Q Consensus       114 ~~F~~~f~~In~~fs~iF~~L  134 (199)
                      ..|.+..........+-...|
T Consensus        85 ~EFVEIMKeMQkDMDEKMDvL  105 (205)
T PF15079_consen   85 HEFVEIMKEMQKDMDEKMDVL  105 (205)
T ss_pred             HHHHHHHHHHHHhHHHhhhHH
Confidence            344444444455555444444


No 474
>PRK03947 prefoldin subunit alpha; Reviewed
Probab=20.36  E-value=3.7e+02  Score=20.75  Aligned_cols=31  Identities=13%  Similarity=0.195  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760         82 RDYAKRSKEMQAVLATLNTYCTGYEQCLSKR  112 (199)
Q Consensus        82 ~ey~e~~er~e~L~~e~~~l~~~I~~L~~kr  112 (199)
                      .+.+++.++++.++.+...+...+..++...
T Consensus         6 ~~l~~l~~~~~~l~~~~~~l~~~~~~l~~~~   36 (140)
T PRK03947          6 QELEELAAQLQALQAQIEALQQQLEELQASI   36 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3445555555555555555555555555444


No 475
>COG1422 Predicted membrane protein [Function unknown]
Probab=20.27  E-value=5.6e+02  Score=22.05  Aligned_cols=28  Identities=7%  Similarity=0.040  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12760        102 CTGYEQCLSKRQKEFDTNFVKIGKRVQE  129 (199)
Q Consensus       102 ~~~I~~L~~kr~~~F~~~f~~In~~fs~  129 (199)
                      ...++++++++.+-..+-.+-....|..
T Consensus        97 ~~~lkkLq~~qmem~~~Q~elmk~qfkP  124 (201)
T COG1422          97 MKKLKKLQEKQMEMMDDQRELMKMQFKP  124 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhh
Confidence            3467888888877777777766677763


No 476
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=20.02  E-value=67  Score=28.70  Aligned_cols=21  Identities=38%  Similarity=0.381  Sum_probs=17.7

Q ss_pred             ccccCCcchHHHHHHHHHHHH
Q psy12760        168 SIDCLSGGEKTLASLALVFAL  188 (199)
Q Consensus       168 ~l~~LSGGEKSlaaLalIfAL  188 (199)
                      -.++||||-+-++|||=-+|+
T Consensus       142 ~PsELSGGM~KRvaLARAial  162 (263)
T COG1127         142 YPSELSGGMRKRVALARAIAL  162 (263)
T ss_pred             CchhhcchHHHHHHHHHHHhc
Confidence            346999999999999977765


Done!