Diaphorina citri psyllid: psy12771


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MYSFLGLPPLSFENQHNFPAVPPQLATFFGVKKVVEEEEEEEKKKERGFTKVFFWKILENNLTHLGRHEHVPGIGSGIAKCPYDPNDNSTAIWVEKGNPGNLPALYSGTNAEFTKADTVIFRTDLLNFTTGKKEYTFKRTIKYDSKWLDSFKSLIAKIIL
ccccccccccccccccccccccccHHHHccEEcEEcHHHHHHHHccccccccccEEEccccccccccccccccccccEEEcccccccccEEEEEEccccccccccEEEEccccccccEEEEEcccccccccccccccccccccccccccccccEEEEEcc
*YSFLGLPPLSFENQHNFPAVPPQLATFFGVK****************FTKVFFWKILENNLTHLGRHEHVPGIGSGIAKCPYDPNDNSTAIWVEKGNPGNLPALYSGTNAEFTKADTVIFRTDLLNFTTGKKEYTFKRTIKYDSKWLDSFKSLIAKIIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSFLGLPPLSFENQHNFPAVPPQLATFFGVKKVVEEEEEEEKKKERGFTKVFFWKILENNLTHLGRHEHVPGIGSGIAKCPYDPNDNSTAIWVEKGNPGNLPALYSGTNAEFTKADTVIFRTDLLNFTTGKKEYTFKRTIKYDSKWLDSFKSLIAKIIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Semaphorin-2A Plays a role in growth cones guidance. Required for both proper adult behavior and survival. Can function in vivo as a selective target-derived signal that inhibits the formation of specific synaptic terminal arbors.confidentQ24323

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0016200 [BP]synaptic target attractionprobableGO:0008037, GO:0030154, GO:0048468, GO:0050918, GO:0007275, GO:0044699, GO:0042330, GO:0048869, GO:0048666, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0008039, GO:0008038, GO:0044767, GO:0044763, GO:0048731, GO:0042221, GO:0022008, GO:0040011, GO:0048699, GO:0044707, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0032502, GO:0008150
GO:0042756 [BP]drinking behaviorprobableGO:0007631, GO:0050896, GO:0008150, GO:0007610
GO:2001020 [BP]regulation of response to DNA damage stimulusprobableGO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0070983 [BP]dendrite guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0006928, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048813, GO:0048812, GO:0008150
GO:0007632 [BP]visual behaviorprobableGO:0009628, GO:0044702, GO:0044704, GO:0044707, GO:0019098, GO:0009314, GO:0050896, GO:0007610, GO:0022414, GO:0032501, GO:0009416, GO:0044708, GO:0008150, GO:0044699, GO:0000003
GO:0007431 [BP]salivary gland developmentprobableGO:0032502, GO:0035272, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0048732, GO:0007275, GO:0044699
GO:0007629 [BP]flight behaviorprobableGO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0008344, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OKY, chain B
Confidence level:very confident
Coverage over the Query: 35-159
View the alignment between query and template
View the model in PyMOL
Template: 3OL2, chain B
Confidence level:confident
Coverage over the Query: 1-158
View the alignment between query and template
View the model in PyMOL