Query         psy12781
Match_columns 266
No_of_seqs    191 out of 1134
Neff          8.4 
Searched_HMMs 29240
Date          Fri Aug 16 19:30:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12781.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/12781hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2lat_A Dolichyl-diphosphooligo  12.0 1.9E+02  0.0064   16.4   2.5   18   44-61     12-29  (37)
  2 1rkl_A Dolichyl-diphosphooligo  11.3   2E+02   0.007   16.2   2.5   18   43-60     11-28  (36)
  3 1xkm_B Distinctin chain B; por   6.8 3.1E+02   0.011   13.6   2.6   16  114-129     3-18  (26)
  4 3mp7_B Preprotein translocase    5.0 6.3E+02   0.021   15.8   3.0   37   24-60     12-48  (61)
  5 1sy9_B Cyclic-nucleotide-gated   3.9 4.4E+02   0.015   13.2   1.3    8  140-147     7-14  (26)
  6 1emz_A Envelope glycoprotein E   3.7 2.6E+02  0.0088   14.5   0.3   13   19-31     11-23  (26)
  7 1nkz_B Light-harvesting protei   3.6 7.4E+02   0.025   14.2   2.3   19   42-61     15-33  (41)
  8 1lgh_B LH II, B800/850, light    3.4 7.8E+02   0.027   14.4   2.3   19   42-61     20-38  (45)
  9 2jtw_A Transmembrane helix 7 o   3.3   5E+02   0.017   13.3   1.1    7  143-149     8-14  (26)
 10 1yod_A Water-solublized phosph   3.1 7.2E+02   0.025   13.0   3.3   24  134-157     6-29  (30)

No 1  
>2lat_A Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4; membrane protein, oligosaccharyltransferase, integral membra protein; NMR {Homo sapiens}
Probab=11.99  E-value=1.9e+02  Score=16.44  Aligned_cols=18  Identities=11%  Similarity=0.091  Sum_probs=13.5

Q ss_pred             hHHHHHHHHHHHHHhHhh
Q psy12781         44 HGIRTLNAFMLLLSHKSM   61 (266)
Q Consensus        44 dglR~laal~Vv~~H~~~   61 (266)
                      +.+=..+++.|+.+|...
T Consensus        12 n~lG~~~~~LIVlYH~v~   29 (37)
T 2lat_A           12 NMLGVSLFLLVVLYHYVA   29 (37)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHh
Confidence            456667888999999753


No 2  
>1rkl_A Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit; membrane protein; NMR {Synthetic} SCOP: f.23.30.1
Probab=11.27  E-value=2e+02  Score=16.16  Aligned_cols=18  Identities=6%  Similarity=0.110  Sum_probs=13.2

Q ss_pred             hhHHHHHHHHHHHHHhHh
Q psy12781         43 VHGIRTLNAFMLLLSHKS   60 (266)
Q Consensus        43 ldglR~laal~Vv~~H~~   60 (266)
                      -+.+=..+++.|+.+|..
T Consensus        11 an~lG~~~~~LIvlYH~v   28 (36)
T 1rkl_A           11 AITFGIVMMTLIVIYHAV   28 (36)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            345566788889999974


No 3  
>1xkm_B Distinctin chain B; pore-forming peptide, heterodimer, structure, homodimer, disulfide, four-helix bundle, antibiotic; NMR {Synthetic} SCOP: j.4.1.6
Probab=6.77  E-value=3.1e+02  Score=13.64  Aligned_cols=16  Identities=31%  Similarity=0.698  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHhh
Q psy12781        114 LSGLLTSYAFLRQFEK  129 (266)
Q Consensus       114 iSGFll~~~~~~~~~~  129 (266)
                      .||..-+..++.+..+
T Consensus         3 vsgliearkyleqlhr   18 (26)
T 1xkm_B            3 VSGLIEARKYLEQLHR   18 (26)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHH
Confidence            6898889888877654


No 4  
>3mp7_B Preprotein translocase subunit SECE; protein transport, membrane protein complex, preprotein TRAN membrane insertion,; 2.90A {Pyrococcus furiosus}
Probab=5.03  E-value=6.3e+02  Score=15.78  Aligned_cols=37  Identities=8%  Similarity=0.155  Sum_probs=27.5

Q ss_pred             HHHHHHhhccCCCCCCCcchhHHHHHHHHHHHHHhHh
Q psy12781         24 IKNTKKLISLDRSPDDIECVHGIRTLNAFMLLLSHKS   60 (266)
Q Consensus        24 ~~n~~~L~~~~~~~~~~~~ldglR~laal~Vv~~H~~   60 (266)
                      .++++++.+.-+++++=+.....|..++-.++.+-..
T Consensus        12 ~kd~~rvlk~~~KPd~~Ef~~iak~~~iG~~i~G~iG   48 (61)
T 3mp7_B           12 WKESRRAFLVTKKPNWATYKRAAKITGLGIILIGLIG   48 (61)
T ss_dssp             HHHHTHHHHHSCCCCTTHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            3677777777667777788888888887777776654


No 5  
>1sy9_B Cyclic-nucleotide-gated olfactory channel; helix-turn-helix, calcium-binding protein; NMR {Xenopus laevis}
Probab=3.91  E-value=4.4e+02  Score=13.16  Aligned_cols=8  Identities=38%  Similarity=0.488  Sum_probs=5.2

Q ss_pred             HHHHHHHh
Q psy12781        140 VSRCFRLL  147 (266)
Q Consensus       140 ~~R~~Rl~  147 (266)
                      .+|+.|+.
T Consensus         7 frri~rlv   14 (26)
T 1sy9_B            7 FRRIARLV   14 (26)
T ss_pred             HHHHHHHH
Confidence            46777764


No 6  
>1emz_A Envelope glycoprotein E1; peptide, transmembrane domain, envelope protein E1, hepatitis C virus, viral protein; NMR {Synthetic} SCOP: j.35.1.1
Probab=3.74  E-value=2.6e+02  Score=14.52  Aligned_cols=13  Identities=31%  Similarity=0.279  Sum_probs=8.6

Q ss_pred             hccchHHHHHHhh
Q psy12781         19 MGFSLIKNTKKLI   31 (266)
Q Consensus        19 ~~fS~~~n~~~L~   31 (266)
                      .=||+..||.|..
T Consensus        11 ayfsm~gnWaKVl   23 (26)
T 1emz_A           11 AYFSMVGNWAKXX   23 (26)
T ss_dssp             HHHHHHHHHHC--
T ss_pred             HHHHHhhHHhhhc
Confidence            4478889988753


No 7  
>1nkz_B Light-harvesting protein B-800/850, beta chain; light harvesting complex II, trans-membrane helices, rhodopi glucoside; HET: CXM RG1 BOG BCL; 2.00A {Rhodoblastus acidophilus} SCOP: f.3.1.1 PDB: 1kzu_B* 2fkw_B* 1ijd_B*
Probab=3.61  E-value=7.4e+02  Score=14.21  Aligned_cols=19  Identities=21%  Similarity=0.343  Sum_probs=14.6

Q ss_pred             chhHHHHHHHHHHHHHhHhh
Q psy12781         42 CVHGIRTLNAFMLLLSHKSM   61 (266)
Q Consensus        42 ~ldglR~laal~Vv~~H~~~   61 (266)
                      ..+|.|++.++.++- |...
T Consensus        15 ~~~~~~~F~~iA~vA-H~l~   33 (41)
T 1nkz_B           15 VIDGTRVFLGLALVA-HFLA   33 (41)
T ss_dssp             HHHHHHHHHHHHHHH-HHHH
T ss_pred             HHHHHHHHHHHHHHH-HHHH
Confidence            478999999998876 5543


No 8  
>1lgh_B LH II, B800/850, light harvesting complex II; bacteriochlorophyll, dexter energy transfer, foerster exciton transfer mechanism; HET: BCL LYC DET HTO; 2.40A {Phaeospirillum molischianum} SCOP: f.3.1.1
Probab=3.41  E-value=7.8e+02  Score=14.44  Aligned_cols=19  Identities=5%  Similarity=0.009  Sum_probs=14.7

Q ss_pred             chhHHHHHHHHHHHHHhHhh
Q psy12781         42 CVHGIRTLNAFMLLLSHKSM   61 (266)
Q Consensus        42 ~ldglR~laal~Vv~~H~~~   61 (266)
                      ..+|.|++.++.++- |...
T Consensus        20 ~~~~~~~F~~iA~vA-H~L~   38 (45)
T 1lgh_B           20 FKTTFSAFIILAAVA-HVLV   38 (45)
T ss_dssp             HHHHHHHHHHHHHHH-HHHH
T ss_pred             HHHHHHHHHHHHHHH-HHHH
Confidence            478999999998876 5543


No 9  
>2jtw_A Transmembrane helix 7 of yeast vATPase; peptide, micelle-bound, membrane protein; NMR {Synthetic} PDB: 2rpw_X
Probab=3.25  E-value=5e+02  Score=13.34  Aligned_cols=7  Identities=29%  Similarity=0.406  Sum_probs=4.3

Q ss_pred             HHHHhHH
Q psy12781        143 CFRLLPT  149 (266)
Q Consensus       143 ~~Rl~P~  149 (266)
                      ++|++|+
T Consensus         8 ylRlwaL   14 (26)
T 2jtw_A            8 YLRLWAL   14 (26)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHh
Confidence            4577665


No 10 
>1yod_A Water-solublized phospholamban; protein design, water-soluble, de novo protein; 1.80A {Synthetic}
Probab=3.14  E-value=7.2e+02  Score=13.01  Aligned_cols=24  Identities=21%  Similarity=0.195  Sum_probs=0.0

Q ss_pred             cchHHHHHHHHHHhHHHHHHHHHH
Q psy12781        134 NVMKEIVSRCFRLLPTLGALILFC  157 (266)
Q Consensus       134 ~~~~f~~~R~~Rl~P~y~~~~~~~  157 (266)
                      +.-+.+++|++|+....+..+.+.
T Consensus         6 NlQ~LfvNfcLilICllLi~Iivm   29 (30)
T 1yod_A            6 NLQNLYINRCLREICQELKEIRAM   29 (30)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHh


Done!