Query         psy12782
Match_columns 203
No_of_seqs    112 out of 1168
Neff          9.7 
Searched_HMMs 46136
Date          Fri Aug 16 19:31:49 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12782.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12782hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3627|consensus              100.0 1.7E-33 3.6E-38  220.3  19.3  186    9-199    64-255 (256)
  2 cd00190 Tryp_SPc Trypsin-like  100.0 5.4E-33 1.2E-37  213.3  19.2  183    7-197    49-232 (232)
  3 smart00020 Tryp_SPc Trypsin-li 100.0 8.8E-30 1.9E-34  195.5  18.5  179    7-194    50-229 (229)
  4 PF00089 Trypsin:  Trypsin;  In 100.0 4.7E-28   1E-32  184.5  16.6  173    7-194    47-220 (220)
  5 COG5640 Secreted trypsin-like   99.8 3.2E-20   7E-25  145.4  14.7  185    9-200    87-280 (413)
  6 PF03761 DUF316:  Domain of unk  99.0 1.1E-08 2.3E-13   81.3  12.7  140   29-198   137-279 (282)
  7 PF09342 DUF1986:  Domain of un  97.1  0.0022 4.8E-08   49.1   6.6   76    8-92     55-131 (267)
  8 TIGR02037 degP_htrA_DO peripla  96.7   0.034 7.4E-07   47.0  11.6  123   50-199   104-227 (428)
  9 PRK10898 serine endoprotease;   96.2    0.17 3.7E-06   41.7  12.5   27  144-173   193-219 (353)
 10 PRK10139 serine endoprotease;   96.0    0.17 3.7E-06   43.1  11.7  123   50-199   137-260 (455)
 11 COG3591 V8-like Glu-specific e  95.8    0.12 2.7E-06   40.1   9.4   54  143-199   197-251 (251)
 12 TIGR02038 protease_degS peripl  95.5    0.26 5.5E-06   40.6  10.8   37   50-91    124-160 (351)
 13 PRK10942 serine endoprotease;   95.1    0.35 7.6E-06   41.5  10.6   37   50-90    158-194 (473)
 14 PF02395 Peptidase_S6:  Immunog  92.9   0.079 1.7E-06   47.8   2.7   32  144-175   211-244 (769)
 15 PF00947 Pico_P2A:  Picornaviru  90.6    0.34 7.3E-06   33.5   3.1   35  147-190    88-122 (127)
 16 PF05580 Peptidase_S55:  SpoIVB  78.1     2.3 4.9E-05   32.3   2.7   26  144-173   175-200 (218)
 17 PF00863 Peptidase_C4:  Peptida  77.2     9.7 0.00021   29.5   6.0   47  145-198   147-193 (235)
 18 PF13365 Trypsin_2:  Trypsin-li  69.7     4.3 9.3E-05   27.0   2.3   21  145-168   100-120 (120)
 19 TIGR02860 spore_IV_B stage IV   64.8     5.7 0.00012   33.3   2.5   45  144-198   355-399 (402)
 20 PF05579 Peptidase_S32:  Equine  62.8       6 0.00013   31.2   2.1   22  148-172   207-228 (297)
 21 PF02907 Peptidase_S29:  Hepati  59.3     8.7 0.00019   27.0   2.2   25  145-172   104-128 (148)
 22 PF00548 Peptidase_C3:  3C cyst  58.0     7.2 0.00016   28.6   1.8   28  145-172   143-170 (172)
 23 PF14903 WG_beta_rep:  WG conta  41.7      40 0.00087   16.8   2.7   25   35-60      9-33  (35)
 24 KOG3939|consensus               40.7      77  0.0017   24.9   4.9   39  135-173   239-294 (312)
 25 PF00944 Peptidase_S3:  Alphavi  40.5     8.8 0.00019   27.0  -0.1   26  146-174   103-128 (158)
 26 PF05416 Peptidase_C37:  Southa  39.7      53  0.0012   27.9   4.2   31  145-175   499-529 (535)
 27 PF10459 Peptidase_S46:  Peptid  36.0      33 0.00072   31.2   2.7   63  132-201   619-689 (698)
 28 PF00949 Peptidase_S7:  Peptida  24.9      71  0.0015   22.4   2.3   27  145-174    93-119 (132)
 29 KOG1421|consensus               20.4 4.3E+02  0.0093   24.4   6.5   48  144-194   211-258 (955)
 30 PRK08572 rps17p 30S ribosomal   20.1 2.9E+02  0.0063   18.7   4.6   30   11-43     30-59  (108)

No 1  
>KOG3627|consensus
Probab=100.00  E-value=1.7e-33  Score=220.25  Aligned_cols=186  Identities=45%  Similarity=0.783  Sum_probs=152.8

Q ss_pred             eeEEEeeeeeecccCCCCC-ceEEeeEEEEeCCCCCCCCCCCC-CCeEEEEECCCcCCCCCccceecCCCCC---CccCc
Q psy12782          9 QVQVTLGDYVINSAVEPLP-AYTFGVRKINVHPYFKFTPQADR-YDVAVLRLDRPVQYMPHIAPICLPEKGE---DFLGQ   83 (203)
Q Consensus         9 ~~~V~~G~~~~~~~~~~~~-~~~~~v~~i~~hp~y~~~~~~~~-~DiALl~L~~~~~~~~~i~picl~~~~~---~~~~~   83 (203)
                      .+.|++|++......+... .+...|.++++||+|+  ..... ||||||+|.+++.|++.|+|+|||....   .....
T Consensus        64 ~~~V~~G~~~~~~~~~~~~~~~~~~v~~~i~H~~y~--~~~~~~nDiall~l~~~v~~~~~i~piclp~~~~~~~~~~~~  141 (256)
T KOG3627|consen   64 LYTVRLGEHDINLSVSEGEEQLVGDVEKIIVHPNYN--PRTLENNDIALLRLSEPVTFSSHIQPICLPSSADPYFPPGGT  141 (256)
T ss_pred             ceEEEECccccccccccCchhhhceeeEEEECCCCC--CCCCCCCCEEEEEECCCcccCCcccccCCCCCcccCCCCCCC
Confidence            7889999887666533211 2555588999999997  45555 9999999999999999999999986554   23458


Q ss_pred             eeEEeecccccCCCCCCccCceEEEEeeeChhhHhhHhhhCCCcccccCCeEEeeeeCCCCCCCcCCCCCeeEEeeCCcE
Q psy12782         84 FGWAAGWGALQAGSRLRPKTLQAVDVPIIDNRQCERWHKSNGINVVIYDEMMCAGYRGGAKDSCQGDSGGPLMMERTGRW  163 (203)
Q Consensus        84 ~~~~~Gwg~~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~C~~~~~~~~~~c~~d~G~pl~~~~~~~~  163 (203)
                      .|.++|||.........+..|+..++.+++.+.|...+....   .+.+.++|++......+.|+||+||||++..++++
T Consensus       142 ~~~v~GWG~~~~~~~~~~~~L~~~~v~i~~~~~C~~~~~~~~---~~~~~~~Ca~~~~~~~~~C~GDSGGPLv~~~~~~~  218 (256)
T KOG3627|consen  142 TCLVSGWGRTESGGGPLPDTLQEVDVPIISNSECRRAYGGLG---TITDTMLCAGGPEGGKDACQGDSGGPLVCEDNGRW  218 (256)
T ss_pred             EEEEEeCCCcCCCCCCCCceeEEEEEeEcChhHhcccccCcc---ccCCCEEeeCccCCCCccccCCCCCeEEEeeCCcE
Confidence            899999998876633347789999999999999998876421   25567899997555677899999999999987789


Q ss_pred             EEEEEEEecCC-CCCCCCCeEEEeCCCCHHHHHHhhc
Q psy12782        164 FLIGIVSAGYS-CAQQGQPGIYHRVAYTVDWISYIMN  199 (203)
Q Consensus       164 ~lvGv~s~~~~-c~~~~~~~v~t~v~~~~~WI~~~i~  199 (203)
                      +++||+||+.. |.....|++||+|+.|.+||++.+.
T Consensus       219 ~~~GivS~G~~~C~~~~~P~vyt~V~~y~~WI~~~~~  255 (256)
T KOG3627|consen  219 VLVGIVSWGSGGCGQPNYPGVYTRVSSYLDWIKENIG  255 (256)
T ss_pred             EEEEEEEecCCCCCCCCCCeEEeEhHHhHHHHHHHhc
Confidence            99999999988 9888899999999999999999875


No 2  
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.
Probab=100.00  E-value=5.4e-33  Score=213.25  Aligned_cols=183  Identities=40%  Similarity=0.714  Sum_probs=155.2

Q ss_pred             CceeEEEeeeeeecccCCCCCceEEeeEEEEeCCCCCCCCCCCCCCeEEEEECCCcCCCCCccceecCCCCC-CccCcee
Q psy12782          7 ARQVQVTLGDYVINSAVEPLPAYTFGVRKINVHPYFKFTPQADRYDVAVLRLDRPVQYMPHIAPICLPEKGE-DFLGQFG   85 (203)
Q Consensus         7 ~~~~~V~~G~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~~~DiALl~L~~~~~~~~~i~picl~~~~~-~~~~~~~   85 (203)
                      +..+.|++|.........  ..+.+.|.++++||+|+  .....+|||||+|++|+.++..++|+|||.... ...+..+
T Consensus        49 ~~~~~v~~g~~~~~~~~~--~~~~~~v~~~~~hp~y~--~~~~~~DiAll~L~~~~~~~~~v~picl~~~~~~~~~~~~~  124 (232)
T cd00190          49 PSNYTVRLGSHDLSSNEG--GGQVIKVKKVIVHPNYN--PSTYDNDIALLKLKRPVTLSDNVRPICLPSSGYNLPAGTTC  124 (232)
T ss_pred             CccEEEEeCcccccCCCC--ceEEEEEEEEEECCCCC--CCCCcCCEEEEEECCcccCCCcccceECCCccccCCCCCEE
Confidence            467999999988876443  37889999999999997  456889999999999999999999999998852 2357899


Q ss_pred             EEeecccccCCCCCCccCceEEEEeeeChhhHhhHhhhCCCcccccCCeEEeeeeCCCCCCCcCCCCCeeEEeeCCcEEE
Q psy12782         86 WAAGWGALQAGSRLRPKTLQAVDVPIIDNRQCERWHKSNGINVVIYDEMMCAGYRGGAKDSCQGDSGGPLMMERTGRWFL  165 (203)
Q Consensus        86 ~~~Gwg~~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~C~~~~~~~~~~c~~d~G~pl~~~~~~~~~l  165 (203)
                      .++|||....... ....++...+.+++...|...+..   ...+.+.++|+.........|.||+||||++..+++++|
T Consensus       125 ~~~G~g~~~~~~~-~~~~~~~~~~~~~~~~~C~~~~~~---~~~~~~~~~C~~~~~~~~~~c~gdsGgpl~~~~~~~~~l  200 (232)
T cd00190         125 TVSGWGRTSEGGP-LPDVLQEVNVPIVSNAECKRAYSY---GGTITDNMLCAGGLEGGKDACQGDSGGPLVCNDNGRGVL  200 (232)
T ss_pred             EEEeCCcCCCCCC-CCceeeEEEeeeECHHHhhhhccC---cccCCCceEeeCCCCCCCccccCCCCCcEEEEeCCEEEE
Confidence            9999998765522 367899999999999999987763   124789999998664457899999999999998899999


Q ss_pred             EEEEEecCCCCCCCCCeEEEeCCCCHHHHHHh
Q psy12782        166 IGIVSAGYSCAQQGQPGIYHRVAYTVDWISYI  197 (203)
Q Consensus       166 vGv~s~~~~c~~~~~~~v~t~v~~~~~WI~~~  197 (203)
                      +||+|++..|...+.|.+|++|+.|++||+++
T Consensus       201 vGI~s~g~~c~~~~~~~~~t~v~~~~~WI~~~  232 (232)
T cd00190         201 VGIVSWGSGCARPNYPGVYTRVSSYLDWIQKT  232 (232)
T ss_pred             EEEEehhhccCCCCCCCEEEEcHHhhHHhhcC
Confidence            99999998887667799999999999999864


No 3  
>smart00020 Tryp_SPc Trypsin-like serine protease. Many of these are synthesised as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. A few, however, are active as single chain molecules, and others are inactive due to substitutions of the catalytic triad residues.
Probab=99.97  E-value=8.8e-30  Score=195.51  Aligned_cols=179  Identities=41%  Similarity=0.781  Sum_probs=150.3

Q ss_pred             CceeEEEeeeeeecccCCCCCceEEeeEEEEeCCCCCCCCCCCCCCeEEEEECCCcCCCCCccceecCCCCCC-ccCcee
Q psy12782          7 ARQVQVTLGDYVINSAVEPLPAYTFGVRKINVHPYFKFTPQADRYDVAVLRLDRPVQYMPHIAPICLPEKGED-FLGQFG   85 (203)
Q Consensus         7 ~~~~~V~~G~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~~~DiALl~L~~~~~~~~~i~picl~~~~~~-~~~~~~   85 (203)
                      +..+.|++|........+   .+.+.|.++++||+|+  .....+|||||+|++|+.++..++|+||+..... ..+..+
T Consensus        50 ~~~~~v~~g~~~~~~~~~---~~~~~v~~~~~~p~~~--~~~~~~DiAll~L~~~i~~~~~~~pi~l~~~~~~~~~~~~~  124 (229)
T smart00020       50 PSNIRVRLGSHDLSSGEE---GQVIKVSKVIIHPNYN--PSTYDNDIALLKLKSPVTLSDNVRPICLPSSNYNVPAGTTC  124 (229)
T ss_pred             CcceEEEeCcccCCCCCC---ceEEeeEEEEECCCCC--CCCCcCCEEEEEECcccCCCCceeeccCCCcccccCCCCEE
Confidence            468999999988776432   3789999999999997  4678899999999999999999999999987322 357899


Q ss_pred             EEeecccccCCCCCCccCceEEEEeeeChhhHhhHhhhCCCcccccCCeEEeeeeCCCCCCCcCCCCCeeEEeeCCcEEE
Q psy12782         86 WAAGWGALQAGSRLRPKTLQAVDVPIIDNRQCERWHKSNGINVVIYDEMMCAGYRGGAKDSCQGDSGGPLMMERTGRWFL  165 (203)
Q Consensus        86 ~~~Gwg~~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~C~~~~~~~~~~c~~d~G~pl~~~~~~~~~l  165 (203)
                      .++|||............++...+.+++.+.|...+...   ..+.+.++|++........|.+|+||||++..+ +|+|
T Consensus       125 ~~~g~g~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~~~~---~~~~~~~~C~~~~~~~~~~c~gdsG~pl~~~~~-~~~l  200 (229)
T smart00020      125 TVSGWGRTSEGAGSLPDTLQEVNVPIVSNATCRRAYSGG---GAITDNMLCAGGLEGGKDACQGDSGGPLVCNDG-RWVL  200 (229)
T ss_pred             EEEeCCCCCCCCCcCCCEeeEEEEEEeCHHHhhhhhccc---cccCCCcEeecCCCCCCcccCCCCCCeeEEECC-CEEE
Confidence            999999876432233567899999999999999876541   237889999986654578999999999999877 9999


Q ss_pred             EEEEEecCCCCCCCCCeEEEeCCCCHHHH
Q psy12782        166 IGIVSAGYSCAQQGQPGIYHRVAYTVDWI  194 (203)
Q Consensus       166 vGv~s~~~~c~~~~~~~v~t~v~~~~~WI  194 (203)
                      +||++++..|...+.|.+|++|++|.+||
T Consensus       201 ~Gi~s~g~~C~~~~~~~~~~~i~~~~~WI  229 (229)
T smart00020      201 VGIVSWGSGCARPGKPGVYTRVSSYLDWI  229 (229)
T ss_pred             EEEEEECCCCCCCCCCCEEEEeccccccC
Confidence            99999999898667899999999999998


No 4  
>PF00089 Trypsin:  Trypsin;  InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine proteases belong to the MEROPS peptidase family S1 (chymotrypsin family, clan PA(S))and to peptidase family S6 (Hap serine peptidases). The chymotrypsin family is almost totally confined to animals, although trypsin-like enzymes are found in actinomycetes of the genera Streptomyces and Saccharopolyspora, and in the fungus Fusarium oxysporum []. The enzymes are inherently secreted, being synthesised with a signal peptide that targets them to the secretory pathway. Animal enzymes are either secreted directly, packaged into vesicles for regulated secretion, or are retained in leukocyte granules []. The Hap family, 'Haemophilus adhesion and penetration', are proteins that play a role in the interaction with human epithelial cells. The serine protease activity is localized at the N-terminal domain, whereas the binding domain is in the C-terminal region. ; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 1SPJ_A 1A5I_A 2ZGH_A 2ZKS_A 2ZGJ_A 2ZGC_A 2ODP_A 2I6Q_A 2I6S_A 2ODQ_A ....
Probab=99.96  E-value=4.7e-28  Score=184.49  Aligned_cols=173  Identities=39%  Similarity=0.770  Sum_probs=144.4

Q ss_pred             CceeEEEeeeeeecccCCCCCceEEeeEEEEeCCCCCCCCCCCCCCeEEEEECCCcCCCCCccceecCCCCCC-ccCcee
Q psy12782          7 ARQVQVTLGDYVINSAVEPLPAYTFGVRKINVHPYFKFTPQADRYDVAVLRLDRPVQYMPHIAPICLPEKGED-FLGQFG   85 (203)
Q Consensus         7 ~~~~~V~~G~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~~~DiALl~L~~~~~~~~~i~picl~~~~~~-~~~~~~   85 (203)
                      .+++.|++|...+.....  ..+.+.|++++.||+|+.  ....+|||||+|++++.+.+.+.|+|++..... ..+..+
T Consensus        47 ~~~~~v~~g~~~~~~~~~--~~~~~~v~~~~~h~~~~~--~~~~~DiAll~L~~~~~~~~~~~~~~l~~~~~~~~~~~~~  122 (220)
T PF00089_consen   47 ASDIKVRLGTYSIRNSDG--SEQTIKVSKIIIHPKYDP--STYDNDIALLKLDRPITFGDNIQPICLPSAGSDPNVGTSC  122 (220)
T ss_dssp             GGSEEEEESESBTTSTTT--TSEEEEEEEEEEETTSBT--TTTTTSEEEEEESSSSEHBSSBEESBBTSTTHTTTTTSEE
T ss_pred             cccccccccccccccccc--cccccccccccccccccc--cccccccccccccccccccccccccccccccccccccccc
Confidence            357889999844444333  268999999999999983  446899999999999999999999999995432 357899


Q ss_pred             EEeecccccCCCCCCccCceEEEEeeeChhhHhhHhhhCCCcccccCCeEEeeeeCCCCCCCcCCCCCeeEEeeCCcEEE
Q psy12782         86 WAAGWGALQAGSRLRPKTLQAVDVPIIDNRQCERWHKSNGINVVIYDEMMCAGYRGGAKDSCQGDSGGPLMMERTGRWFL  165 (203)
Q Consensus        86 ~~~Gwg~~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~C~~~~~~~~~~c~~d~G~pl~~~~~~~~~l  165 (203)
                      .+.||+......  ....++...+.+++.+.|...++.     .+.+.++|++.. .....|.||+||||++.+.   +|
T Consensus       123 ~~~G~~~~~~~~--~~~~~~~~~~~~~~~~~c~~~~~~-----~~~~~~~c~~~~-~~~~~~~g~sG~pl~~~~~---~l  191 (220)
T PF00089_consen  123 IVVGWGRTSDNG--YSSNLQSVTVPVVSRKTCRSSYND-----NLTPNMICAGSS-GSGDACQGDSGGPLICNNN---YL  191 (220)
T ss_dssp             EEEESSBSSTTS--BTSBEEEEEEEEEEHHHHHHHTTT-----TSTTTEEEEETT-SSSBGGTTTTTSEEEETTE---EE
T ss_pred             cccccccccccc--cccccccccccccccccccccccc-----cccccccccccc-cccccccccccccccccee---ee
Confidence            999999865554  256799999999999999987543     278999999865 4578999999999999865   89


Q ss_pred             EEEEEecCCCCCCCCCeEEEeCCCCHHHH
Q psy12782        166 IGIVSAGYSCAQQGQPGIYHRVAYTVDWI  194 (203)
Q Consensus       166 vGv~s~~~~c~~~~~~~v~t~v~~~~~WI  194 (203)
                      +||.+++..|...+.|.+|++|+.|++||
T Consensus       192 vGI~s~~~~c~~~~~~~v~~~v~~~~~WI  220 (220)
T PF00089_consen  192 VGIVSFGENCGSPNYPGVYTRVSSYLDWI  220 (220)
T ss_dssp             EEEEEEESSSSBTTSEEEEEEGGGGHHHH
T ss_pred             cceeeecCCCCCCCcCEEEEEHHHhhccC
Confidence            99999998898877899999999999998


No 5  
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=99.85  E-value=3.2e-20  Score=145.42  Aligned_cols=185  Identities=26%  Similarity=0.356  Sum_probs=131.7

Q ss_pred             eeEEEeeeeeecccCCCCCceEEeeEEEEeCCCCCCCCCCCCCCeEEEEECCCcCCCC-CccceecCC--CCCCccCcee
Q psy12782          9 QVQVTLGDYVINSAVEPLPAYTFGVRKINVHPYFKFTPQADRYDVAVLRLDRPVQYMP-HIAPICLPE--KGEDFLGQFG   85 (203)
Q Consensus         9 ~~~V~~G~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~~~DiALl~L~~~~~~~~-~i~picl~~--~~~~~~~~~~   85 (203)
                      +..+..+...++....   .+-.+|++++.|..|.  ..++.||||+++|+++..... .+....-+.  ..........
T Consensus        87 s~d~~~vv~~l~d~Sq---~~rg~vr~i~~~efY~--~~n~~ND~Av~~l~~~a~~pr~ki~~~~~sdt~l~sv~~~s~~  161 (413)
T COG5640          87 SSDVNRVVVDLNDSSQ---AERGHVRTIYVHEFYS--PGNLGNDIAVLELARAASLPRVKITSFDASDTFLNSVTTVSPM  161 (413)
T ss_pred             cccceEEEeccccccc---ccCcceEEEeeecccc--cccccCcceeeccccccccchhheeeccCcccceecccccccc
Confidence            3445555555555433   6778999999999996  789999999999999765431 122211111  1111124555


Q ss_pred             EEeecccccCCCCC--Cc--cCceEEEEeeeChhhHhhHhhhC-CCcccccCCeEEeeeeCCCCCCCcCCCCCeeEEeeC
Q psy12782         86 WAAGWGALQAGSRL--RP--KTLQAVDVPIIDNRQCERWHKSN-GINVVIYDEMMCAGYRGGAKDSCQGDSGGPLMMERT  160 (203)
Q Consensus        86 ~~~Gwg~~~~~~~~--~~--~~l~~~~~~~~~~~~C~~~~~~~-~~~~~~~~~~~C~~~~~~~~~~c~~d~G~pl~~~~~  160 (203)
                      ...+|+........  .+  ..+++..+...+...|..+.... .......-.-+|++...  ++.|+||+|||++....
T Consensus       162 ~n~t~~~~~~~~v~~~~p~gt~l~e~~v~fv~~stc~~~~g~an~~dg~~~lT~~cag~~~--~daCqGDSGGPi~~~g~  239 (413)
T COG5640         162 TNGTFGVTTPSDVPRSSPKGTILHEVAVLFVPLSTCAQYKGCANASDGATGLTGFCAGRPP--KDACQGDSGGPIFHKGE  239 (413)
T ss_pred             cceeeeeeeecCCCCCCCccceeeeeeeeeechHHhhhhccccccCCCCCCccceecCCCC--cccccCCCCCceEEeCC
Confidence            66677654422211  12  47899999999999999987511 11122333449998664  79999999999999987


Q ss_pred             CcEEEEEEEEecCC-CCCCCCCeEEEeCCCCHHHHHHhhcc
Q psy12782        161 GRWFLIGIVSAGYS-CAQQGQPGIYHRVAYTVDWISYIMNT  200 (203)
Q Consensus       161 ~~~~lvGv~s~~~~-c~~~~~~~v~t~v~~~~~WI~~~i~~  200 (203)
                      ....++||+|||++ |+.+..|.|||+|+.|.+||...++.
T Consensus       240 ~G~vQ~GVvSwG~~~Cg~t~~~gVyT~vsny~~WI~a~~~~  280 (413)
T COG5640         240 EGRVQRGVVSWGDGGCGGTLIPGVYTNVSNYQDWIAAMTNG  280 (413)
T ss_pred             CccEEEeEEEecCCCCCCCCcceeEEehhHHHHHHHHHhcC
Confidence            77899999999997 99999999999999999999998764


No 6  
>PF03761 DUF316:  Domain of unknown function (DUF316) ;  InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans.
Probab=98.99  E-value=1.1e-08  Score=81.32  Aligned_cols=140  Identities=23%  Similarity=0.416  Sum_probs=93.6

Q ss_pred             eEEeeEEEEeCCCC--CCCCCCCCCCeEEEEECCCcCCCCCccceecCCCCCCc-cCceeEEeecccccCCCCCCccCce
Q psy12782         29 YTFGVRKINVHPYF--KFTPQADRYDVAVLRLDRPVQYMPHIAPICLPEKGEDF-LGQFGWAAGWGALQAGSRLRPKTLQ  105 (203)
Q Consensus        29 ~~~~v~~i~~hp~y--~~~~~~~~~DiALl~L~~~~~~~~~i~picl~~~~~~~-~~~~~~~~Gwg~~~~~~~~~~~~l~  105 (203)
                      ...+|.++++--.-  .........+++||+|+++  ++....|+|||+..... .++...+.|+.        ....+.
T Consensus       137 ~~~~v~ka~il~~C~~~~~~~~~~~~~mIlEl~~~--~~~~~~~~Cl~~~~~~~~~~~~~~~yg~~--------~~~~~~  206 (282)
T PF03761_consen  137 FSIKVKKAYILNGCKKIKKNFNRPYSPMILELEED--FSKNVSPPCLADSSTNWEKGDEVDVYGFN--------STGKLK  206 (282)
T ss_pred             ccceeEEEEEEecCCCcccccccccceEEEEEccc--ccccCCCEEeCCCccccccCceEEEeecC--------CCCeEE
Confidence            34566666553222  1113455679999999999  77889999999887644 45666677761        133455


Q ss_pred             EEEEeeeChhhHhhHhhhCCCcccccCCeEEeeeeCCCCCCCcCCCCCeeEEeeCCcEEEEEEEEecCCCCCCCCCeEEE
Q psy12782        106 AVDVPIIDNRQCERWHKSNGINVVIYDEMMCAGYRGGAKDSCQGDSGGPLMMERTGRWFLIGIVSAGYSCAQQGQPGIYH  185 (203)
Q Consensus       106 ~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~C~~~~~~~~~~c~~d~G~pl~~~~~~~~~lvGv~s~~~~c~~~~~~~v~t  185 (203)
                      ...+.+.....                   |..........|.+|+||||+...+|+|+|+||.+.+...+..+ ...|.
T Consensus       207 ~~~~~i~~~~~-------------------~~~~~~~~~~~~~~d~Gg~lv~~~~gr~tlIGv~~~~~~~~~~~-~~~f~  266 (282)
T PF03761_consen  207 HRKLKITNCTK-------------------CAYSICTKQYSCKGDRGGPLVKNINGRWTLIGVGASGNYECNKN-NSYFF  266 (282)
T ss_pred             EEEEEEEEeec-------------------cceeEecccccCCCCccCeEEEEECCCEEEEEEEccCCCccccc-ccEEE
Confidence            55555544322                   22222233678999999999999999999999999876322212 57899


Q ss_pred             eCCCCHHHHHHhh
Q psy12782        186 RVAYTVDWISYIM  198 (203)
Q Consensus       186 ~v~~~~~WI~~~i  198 (203)
                      +|..|.+=|.+.+
T Consensus       267 ~v~~~~~~IC~lt  279 (282)
T PF03761_consen  267 NVSWYQDEICELT  279 (282)
T ss_pred             EHHHhhhhhccce
Confidence            9999888776554


No 7  
>PF09342 DUF1986:  Domain of unknown function (DUF1986);  InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain is found in serine endopeptidases belonging to MEROPS peptidase family S1A (clan PA). It is found in unusual mosaic proteins, which are encoded by the Drosophila nudel gene (see P98159 from SWISSPROT). Nudel is involved in defining embryonic dorsoventral polarity. Three proteases; ndl, gd and snk process easter to create active easter. Active easter defines cell identities along the dorsal-ventral continuum by activating the spz ligand for the Tl receptor in the ventral region of the embryo. Nudel, pipe and windbeutel together trigger the protease cascade within the extraembryonic perivitelline compartment which induces dorsoventral polarity of the Drosophila embryo [].
Probab=97.08  E-value=0.0022  Score=49.06  Aligned_cols=76  Identities=21%  Similarity=0.235  Sum_probs=53.7

Q ss_pred             ceeEEEeeeeeecccCCCCCceEEeeEEEEeCCCCCCCCCCCCCCeEEEEECCCcCCCCCccceecCCCCCCc-cCceeE
Q psy12782          8 RQVQVTLGDYVINSAVEPLPAYTFGVRKINVHPYFKFTPQADRYDVAVLRLDRPVQYMPHIAPICLPEKGEDF-LGQFGW   86 (203)
Q Consensus         8 ~~~~V~~G~~~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~~~DiALl~L~~~~~~~~~i~picl~~~~~~~-~~~~~~   86 (203)
                      .=+.|.+|..-.....+.+-+|.++|..+..=|         +.+++||.|++|+.|+.+|+|..||....+. ....|.
T Consensus        55 ~YvsallG~~Kt~~~v~Gp~EQI~rVD~~~~V~---------~S~v~LLHL~~~~~fTr~VlP~flp~~~~~~~~~~~CV  125 (267)
T PF09342_consen   55 HYVSALLGGGKTYLSVDGPHEQISRVDCFKDVP---------ESNVLLLHLEQPANFTRYVLPTFLPETSNENESDDECV  125 (267)
T ss_pred             ceEEEEecCcceecccCCChheEEEeeeeeecc---------ccceeeeeecCcccceeeecccccccccCCCCCCCceE
Confidence            346677776553333344457777777763333         5589999999999999999999999743333 466899


Q ss_pred             Eeeccc
Q psy12782         87 AAGWGA   92 (203)
Q Consensus        87 ~~Gwg~   92 (203)
                      .+|-..
T Consensus       126 AVg~d~  131 (267)
T PF09342_consen  126 AVGHDD  131 (267)
T ss_pred             EEEccc
Confidence            998653


No 8  
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures.
Probab=96.70  E-value=0.034  Score=46.95  Aligned_cols=123  Identities=24%  Similarity=0.295  Sum_probs=61.9

Q ss_pred             CCCeEEEEECCCcCCCCCccceecCCCCCCccCceeEEeecccccCCCCCCccCceEEEEeeeChhhHhhHhhhCCCccc
Q psy12782         50 RYDVAVLRLDRPVQYMPHIAPICLPEKGEDFLGQFGWAAGWGALQAGSRLRPKTLQAVDVPIIDNRQCERWHKSNGINVV  129 (203)
Q Consensus        50 ~~DiALl~L~~~~~~~~~i~picl~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~  129 (203)
                      ..|||||+++.+    ..+.++.|........++.+.+.|+-....      ..+..-.+.-..+.   . ....     
T Consensus       104 ~~DlAllkv~~~----~~~~~~~l~~~~~~~~G~~v~aiG~p~g~~------~~~t~G~vs~~~~~---~-~~~~-----  164 (428)
T TIGR02037       104 RTDIAVLKIDAK----KNLPVIKLGDSDKLRVGDWVLAIGNPFGLG------QTVTSGIVSALGRS---G-LGIG-----  164 (428)
T ss_pred             CCCEEEEEecCC----CCceEEEccCCCCCCCCCEEEEEECCCcCC------CcEEEEEEEecccC---c-cCCC-----
Confidence            359999999865    345577776554434789999999753211      11111111111110   0 0000     


Q ss_pred             ccCCeEEeeeeCCCCCCCcCCCCCeeEEeeCCcEEEEEEEEecCC-CCCCCCCeEEEeCCCCHHHHHHhhc
Q psy12782        130 IYDEMMCAGYRGGAKDSCQGDSGGPLMMERTGRWFLIGIVSAGYS-CAQQGQPGIYHRVAYTVDWISYIMN  199 (203)
Q Consensus       130 ~~~~~~C~~~~~~~~~~c~~d~G~pl~~~~~~~~~lvGv~s~~~~-c~~~~~~~v~t~v~~~~~WI~~~i~  199 (203)
                      ....++=     .......|.+||||+... |+  ++||.+.... ...........-+......+++.++
T Consensus       165 ~~~~~i~-----tda~i~~GnSGGpl~n~~-G~--viGI~~~~~~~~g~~~g~~faiP~~~~~~~~~~l~~  227 (428)
T TIGR02037       165 DYENFIQ-----TDAAINPGNSGGPLVNLR-GE--VIGINTAIYSPSGGNVGIGFAIPSNMAKNVVDQLIE  227 (428)
T ss_pred             CccceEE-----ECCCCCCCCCCCceECCC-Ce--EEEEEeEEEcCCCCccceEEEEEhHHHHHHHHHHHh
Confidence            0111111     123556789999998653 43  9999876432 1111112334444445555555443


No 9  
>PRK10898 serine endoprotease; Provisional
Probab=96.20  E-value=0.17  Score=41.67  Aligned_cols=27  Identities=33%  Similarity=0.634  Sum_probs=20.2

Q ss_pred             CCCCcCCCCCeeEEeeCCcEEEEEEEEecC
Q psy12782        144 KDSCQGDSGGPLMMERTGRWFLIGIVSAGY  173 (203)
Q Consensus       144 ~~~c~~d~G~pl~~~~~~~~~lvGv~s~~~  173 (203)
                      .....|.+||||+..+ |+  ++||.+...
T Consensus       193 a~i~~GnSGGPl~n~~-G~--vvGI~~~~~  219 (353)
T PRK10898        193 ASINHGNSGGALVNSL-GE--LMGINTLSF  219 (353)
T ss_pred             cccCCCCCcceEECCC-Ce--EEEEEEEEe
Confidence            4567789999999753 32  999998653


No 10 
>PRK10139 serine endoprotease; Provisional
Probab=95.95  E-value=0.17  Score=43.10  Aligned_cols=123  Identities=20%  Similarity=0.228  Sum_probs=62.3

Q ss_pred             CCCeEEEEECCCcCCCCCccceecCCCCCCccCceeEEeecccccCCCCCCccCceEEEEeeeChhhHhhHhhhCCCccc
Q psy12782         50 RYDVAVLRLDRPVQYMPHIAPICLPEKGEDFLGQFGWAAGWGALQAGSRLRPKTLQAVDVPIIDNRQCERWHKSNGINVV  129 (203)
Q Consensus        50 ~~DiALl~L~~~~~~~~~i~picl~~~~~~~~~~~~~~~Gwg~~~~~~~~~~~~l~~~~~~~~~~~~C~~~~~~~~~~~~  129 (203)
                      ..||||||++.+-    ...++.|.+......++.+...|+-...      ...   +..-+++..  .+.....    .
T Consensus       137 ~~DlAvlkv~~~~----~l~~~~lg~s~~~~~G~~V~aiG~P~g~------~~t---vt~GivS~~--~r~~~~~----~  197 (455)
T PRK10139        137 QSDIALLQIQNPS----KLTQIAIADSDKLRVGDFAVAVGNPFGL------GQT---ATSGIISAL--GRSGLNL----E  197 (455)
T ss_pred             CCCEEEEEecCCC----CCceeEecCccccCCCCEEEEEecCCCC------CCc---eEEEEEccc--cccccCC----C
Confidence            4699999998642    3446667655433468888888863211      111   112222221  0000000    0


Q ss_pred             ccCCeEEeeeeCCCCCCCcCCCCCeeEEeeCCcEEEEEEEEecCCC-CCCCCCeEEEeCCCCHHHHHHhhc
Q psy12782        130 IYDEMMCAGYRGGAKDSCQGDSGGPLMMERTGRWFLIGIVSAGYSC-AQQGQPGIYHRVAYTVDWISYIMN  199 (203)
Q Consensus       130 ~~~~~~C~~~~~~~~~~c~~d~G~pl~~~~~~~~~lvGv~s~~~~c-~~~~~~~v~t~v~~~~~WI~~~i~  199 (203)
                      -....+     ........|.+||||+... |  .++||.+....- ......+...-+..-...+++.++
T Consensus       198 ~~~~~i-----qtda~in~GnSGGpl~n~~-G--~vIGi~~~~~~~~~~~~gigfaIP~~~~~~v~~~l~~  260 (455)
T PRK10139        198 GLENFI-----QTDASINRGNSGGALLNLN-G--ELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLID  260 (455)
T ss_pred             CcceEE-----EECCccCCCCCcceEECCC-C--eEEEEEEEEEcCCCCccceEEEEEhHHHHHHHHHHhh
Confidence            001112     1224567899999999754 2  299999874321 111123444555444555555554


No 11 
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism]
Probab=95.82  E-value=0.12  Score=40.13  Aligned_cols=54  Identities=19%  Similarity=0.335  Sum_probs=37.8

Q ss_pred             CCCCCcCCCCCeeEEeeCCcEEEEEEEEecCCCCCCCCCeEEEeCC-CCHHHHHHhhc
Q psy12782        143 AKDSCQGDSGGPLMMERTGRWFLIGIVSAGYSCAQQGQPGIYHRVA-YTVDWISYIMN  199 (203)
Q Consensus       143 ~~~~c~~d~G~pl~~~~~~~~~lvGv~s~~~~c~~~~~~~v~t~v~-~~~~WI~~~i~  199 (203)
                      ..+.+.|++|+|++...+   +++||..-+..-.......-.+|+. ..++||.+.++
T Consensus       197 ~~dT~pG~SGSpv~~~~~---~vigv~~~g~~~~~~~~~n~~vr~t~~~~~~I~~~~~  251 (251)
T COG3591         197 DADTLPGSSGSPVLISKD---EVIGVHYNGPGANGGSLANNAVRLTPEILNFIQQNIK  251 (251)
T ss_pred             EecccCCCCCCceEecCc---eEEEEEecCCCcccccccCcceEecHHHHHHHHHhhC
Confidence            357899999999999776   7999999887532222233344444 46799988763


No 12 
>TIGR02038 protease_degS periplasmic serine pepetdase DegS. This family consists of the periplasmic serine protease DegS (HhoB), a shorter paralog of protease DO (HtrA, DegP) and DegQ (HhoA). It is found in E. coli and several other Proteobacteria of the gamma subdivision. It contains a trypsin domain and a single copy of PDZ domain (in contrast to DegP with two copies). A critical role of this DegS is to sense stress in the periplasm and partially degrade an inhibitor of sigma(E).
Probab=95.51  E-value=0.26  Score=40.59  Aligned_cols=37  Identities=22%  Similarity=0.230  Sum_probs=24.3

Q ss_pred             CCCeEEEEECCCcCCCCCccceecCCCCCCccCceeEEeecc
Q psy12782         50 RYDVAVLRLDRPVQYMPHIAPICLPEKGEDFLGQFGWAAGWG   91 (203)
Q Consensus        50 ~~DiALl~L~~~~~~~~~i~picl~~~~~~~~~~~~~~~Gwg   91 (203)
                      ..||||||++.+-     +.++.+........++.+.+.|+.
T Consensus       124 ~~DlAvlkv~~~~-----~~~~~l~~s~~~~~G~~V~aiG~P  160 (351)
T TIGR02038       124 LTDLAVLKIEGDN-----LPTIPVNLDRPPHVGDVVLAIGNP  160 (351)
T ss_pred             CCCEEEEEecCCC-----CceEeccCcCccCCCCEEEEEeCC
Confidence            4599999998642     334445333333368999999985


No 13 
>PRK10942 serine endoprotease; Provisional
Probab=95.07  E-value=0.35  Score=41.47  Aligned_cols=37  Identities=24%  Similarity=0.451  Sum_probs=24.5

Q ss_pred             CCCeEEEEECCCcCCCCCccceecCCCCCCccCceeEEeec
Q psy12782         50 RYDVAVLRLDRPVQYMPHIAPICLPEKGEDFLGQFGWAAGW   90 (203)
Q Consensus        50 ~~DiALl~L~~~~~~~~~i~picl~~~~~~~~~~~~~~~Gw   90 (203)
                      ..||||||++.+-.    ..++.|.+......++.+.+.|.
T Consensus       158 ~~DlAvlki~~~~~----l~~~~lg~s~~l~~G~~V~aiG~  194 (473)
T PRK10942        158 RSDIALIQLQNPKN----LTAIKMADSDALRVGDYTVAIGN  194 (473)
T ss_pred             CCCEEEEEecCCCC----CceeEecCccccCCCCEEEEEcC
Confidence            46999999975322    34566655443346888888885


No 14 
>PF02395 Peptidase_S6:  Immunoglobulin A1 protease Serine protease Prosite pattern;  InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to the MEROPS peptidase family S6 (clan PA(S)). The type sample being the IgA1-specific serine endopeptidase from Neisseria gonorrhoeae []. These cleave prolyl bonds in the hinge regions of immunoglobulin A heavy chains. Similar specificity is shown by the unrelated family of M26 metalloendopeptidases.; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 3SZE_A 3H09_B 3SYJ_A 1WXR_A 3AK5_B.
Probab=92.90  E-value=0.079  Score=47.80  Aligned_cols=32  Identities=34%  Similarity=0.737  Sum_probs=22.6

Q ss_pred             CCCCcCCCCCeeEEee--CCcEEEEEEEEecCCC
Q psy12782        144 KDSCQGDSGGPLMMER--TGRWFLIGIVSAGYSC  175 (203)
Q Consensus       144 ~~~c~~d~G~pl~~~~--~~~~~lvGv~s~~~~c  175 (203)
                      ...-.|||||||+.-+  +++|+|+||.+.+...
T Consensus       211 n~~~~GDSGSPlF~YD~~~kKWvl~Gv~~~~~~~  244 (769)
T PF02395_consen  211 NYGSPGDSGSPLFAYDKEKKKWVLVGVLSGGNGY  244 (769)
T ss_dssp             EB--TT-TT-EEEEEETTTTEEEEEEEEEEECCC
T ss_pred             cccccCcCCCceEEEEccCCeEEEEEEEcccccc
Confidence            3567899999998755  6789999999987554


No 15 
>PF00947 Pico_P2A:  Picornavirus core protein 2A;  InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This domain defines cysteine peptidases belong to MEROPS peptidase family C3 (picornain, clan PA(C)), subfamilies 3CA and 3CB. The protein fold of this peptidase domain for members of this family resembles that of the serine peptidase, chymotrypsin [], the type example for clan PA. Picornaviral proteins are expressed as a single polyprotein which is cleaved by the viral 3C cysteine protease []. The poliovirus polyprotein is selectively cleaved between the Gln-|-Gly bond. In other picornavirus reactions Glu may be substituted for Gln, and Ser or Thr for Gly. ; GO: 0008233 peptidase activity, 0006508 proteolysis, 0016032 viral reproduction; PDB: 2HRV_B 1Z8R_A.
Probab=90.58  E-value=0.34  Score=33.46  Aligned_cols=35  Identities=31%  Similarity=0.416  Sum_probs=27.2

Q ss_pred             CcCCCCCeeEEeeCCcEEEEEEEEecCCCCCCCCCeEEEeCCCC
Q psy12782        147 CQGDSGGPLMMERTGRWFLIGIVSAGYSCAQQGQPGIYHRVAYT  190 (203)
Q Consensus       147 c~~d~G~pl~~~~~~~~~lvGv~s~~~~c~~~~~~~v~t~v~~~  190 (203)
                      -.||-||+|.|+..    ++||++.|-+     ....|++|+.+
T Consensus        88 ~PGdCGg~L~C~HG----ViGi~Tagg~-----g~VaF~dir~~  122 (127)
T PF00947_consen   88 EPGDCGGILRCKHG----VIGIVTAGGE-----GHVAFADIRDL  122 (127)
T ss_dssp             STT-TCSEEEETTC----EEEEEEEEET-----TEEEEEECCCG
T ss_pred             CCCCCCceeEeCCC----eEEEEEeCCC-----ceEEEEechhh
Confidence            36799999999987    9999998732     24679999884


No 16 
>PF05580 Peptidase_S55:  SpoIVB peptidase S55;  InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to the MEROPS peptidase family S55 (SpoIVB peptidase family, clan PA(S)). The protein SpoIVB plays a key role in signalling in the final sigma-K checkpoint of Bacillus subtilis [, ].
Probab=78.08  E-value=2.3  Score=32.34  Aligned_cols=26  Identities=35%  Similarity=0.592  Sum_probs=22.9

Q ss_pred             CCCCcCCCCCeeEEeeCCcEEEEEEEEecC
Q psy12782        144 KDSCQGDSGGPLMMERTGRWFLIGIVSAGY  173 (203)
Q Consensus       144 ~~~c~~d~G~pl~~~~~~~~~lvGv~s~~~  173 (203)
                      ....+|.||||++.++.    |+|-+++..
T Consensus       175 GGIvqGMSGSPI~qdGK----LiGAVthvf  200 (218)
T PF05580_consen  175 GGIVQGMSGSPIIQDGK----LIGAVTHVF  200 (218)
T ss_pred             CCEEecccCCCEEECCE----EEEEEEEEE
Confidence            46789999999999877    999999875


No 17 
>PF00863 Peptidase_C4:  Peptidase family C4 This family belongs to family C4 of the peptidase classification.;  InterPro: IPR001730 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  Nuclear inclusion A (NIA) proteases from potyviruses are cysteine peptidases belong to the MEROPS peptidase family C4 (NIa protease family, clan PA(C)) [, ].  Potyviruses include plant viruses in which the single-stranded RNA encodes a polyprotein with NIA protease activity, where proteolytic cleavage is specific for Gln+Gly sites. The NIA protease acts on the polyprotein, releasing itself by Gln+Gly cleavage at both the N- and C-termini. It further processes the polyprotein by cleavage at five similar sites in the C-terminal half of the sequence. In addition to its C-terminal protease activity, the NIA protease contains an N-terminal domain that has been implicated in the transcription process []. This peptidase is present in the nuclear inclusion protein of potyviruses.; GO: 0008234 cysteine-type peptidase activity, 0006508 proteolysis; PDB: 3MMG_B 1Q31_B 1LVB_A 1LVM_A.
Probab=77.16  E-value=9.7  Score=29.51  Aligned_cols=47  Identities=21%  Similarity=0.478  Sum_probs=25.1

Q ss_pred             CCCcCCCCCeeEEeeCCcEEEEEEEEecCCCCCCCCCeEEEeCCCCHHHHHHhh
Q psy12782        145 DSCQGDSGGPLMMERTGRWFLIGIVSAGYSCAQQGQPGIYHRVAYTVDWISYIM  198 (203)
Q Consensus       145 ~~c~~d~G~pl~~~~~~~~~lvGv~s~~~~c~~~~~~~v~t~v~~~~~WI~~~i  198 (203)
                      +.=.|+=|+||+...++.  +|||-|.+..-...   -.|+.+..  ++++..+
T Consensus       147 sTk~G~CG~PlVs~~Dg~--IVGiHsl~~~~~~~---N~F~~f~~--~f~~~~l  193 (235)
T PF00863_consen  147 STKDGDCGLPLVSTKDGK--IVGIHSLTSNTSSR---NYFTPFPD--DFEEFYL  193 (235)
T ss_dssp             ---TT-TT-EEEETTT----EEEEEEEEETTTSS---EEEEE--T--THHHHHC
T ss_pred             cCCCCccCCcEEEcCCCc--EEEEEcCccCCCCe---EEEEcCCH--HHHHHHh
Confidence            334567799999987765  99999987544333   35666554  4444443


No 18 
>PF13365 Trypsin_2:  Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A ....
Probab=69.74  E-value=4.3  Score=26.96  Aligned_cols=21  Identities=48%  Similarity=0.966  Sum_probs=15.0

Q ss_pred             CCCcCCCCCeeEEeeCCcEEEEEE
Q psy12782        145 DSCQGDSGGPLMMERTGRWFLIGI  168 (203)
Q Consensus       145 ~~c~~d~G~pl~~~~~~~~~lvGv  168 (203)
                      ..-.|.|||||+. .+|+  ++||
T Consensus       100 ~~~~G~SGgpv~~-~~G~--vvGi  120 (120)
T PF13365_consen  100 DTRPGSSGGPVFD-SDGR--VVGI  120 (120)
T ss_dssp             S-STTTTTSEEEE-TTSE--EEEE
T ss_pred             ccCCCcEeHhEEC-CCCE--EEeC
Confidence            4456899999977 4454  8886


No 19 
>TIGR02860 spore_IV_B stage IV sporulation protein B. SpoIVB, the stage IV sporulation protein B of endospore-forming bacteria such as Bacillus subtilis, is a serine proteinase, expressed in the spore (rather than mother cell) compartment, that participates in a proteolytic activation cascade for Sigma-K. It appears to be universal among endospore-forming bacteria and occurs nowhere else.
Probab=64.81  E-value=5.7  Score=33.34  Aligned_cols=45  Identities=22%  Similarity=0.429  Sum_probs=31.4

Q ss_pred             CCCCcCCCCCeeEEeeCCcEEEEEEEEecCCCCCCCCCeEEEeCCCCHHHHHHhh
Q psy12782        144 KDSCQGDSGGPLMMERTGRWFLIGIVSAGYSCAQQGQPGIYHRVAYTVDWISYIM  198 (203)
Q Consensus       144 ~~~c~~d~G~pl~~~~~~~~~lvGv~s~~~~c~~~~~~~v~t~v~~~~~WI~~~i  198 (203)
                      ....+|.||||++.++.    |+|=+++..-......+++      |.+|..+..
T Consensus       355 gGivqGMSGSPi~q~gk----liGAvtHVfvndpt~GYGi------~ie~Ml~~~  399 (402)
T TIGR02860       355 GGIVQGMSGSPIIQNGK----VIGAVTHVFVNDPTSGYGV------YIEWMLKEA  399 (402)
T ss_pred             CCEEecccCCCEEECCE----EEEEEEEEEecCCCcceee------hHHHHHHHh
Confidence            47789999999999987    9998887642211122345      467877643


No 20 
>PF05579 Peptidase_S32:  Equine arteritis virus serine endopeptidase S32;  InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to MEROPS peptidase family S32 (clan PA(S)). The type example is equine arteritis virus serine endopeptidase (equine arteritis virus), which is involved in processing of nidovirus polyproteins [].; GO: 0004252 serine-type endopeptidase activity, 0016032 viral reproduction, 0019082 viral protein processing; PDB: 3FAN_A 3FAO_A 1MBM_A.
Probab=62.83  E-value=6  Score=31.17  Aligned_cols=22  Identities=41%  Similarity=0.774  Sum_probs=16.8

Q ss_pred             cCCCCCeeEEeeCCcEEEEEEEEec
Q psy12782        148 QGDSGGPLMMERTGRWFLIGIVSAG  172 (203)
Q Consensus       148 ~~d~G~pl~~~~~~~~~lvGv~s~~  172 (203)
                      .||||+|++..+..   |+||-+..
T Consensus       207 ~GDSGSPVVt~dg~---liGVHTGS  228 (297)
T PF05579_consen  207 PGDSGSPVVTEDGD---LIGVHTGS  228 (297)
T ss_dssp             GGCTT-EEEETTC----EEEEEEEE
T ss_pred             CCCCCCccCcCCCC---EEEEEecC
Confidence            57999999997652   99998864


No 21 
>PF02907 Peptidase_S29:  Hepatitis C virus NS3 protease;  InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This signature identifies the Hepatitis C virus NS3 protein as a serine protease which belongs to MEROPS peptidase family S29 (hepacivirin family, clan PA(S)), which has a trypsin-like fold. The non-structural (NS) protein NS3 is one of the NS proteins involved in replication of the HCV genome. The NS2 proteinase (IPR002518 from INTERPRO), a zinc-dependent enzyme, performs a single proteolytic cut to release the N terminus of NS3. The action of NS3 proteinase (NS3P), which resides in the N-terminal one-third of the NS3 protein, then yields all remaining non-structural proteins. The C-terminal two-thirds of the NS3 protein contain a helicase. The functional relationship between the proteinase and helicase domains is unknown. NS3 has a structural zinc-binding site and requires cofactor NS4. It has been suggested that the NS3 serine protease of hepatitus C is involved in cell transformation and that the ability to transform requires an active enzyme [].; GO: 0008236 serine-type peptidase activity, 0006508 proteolysis, 0019087 transformation of host cell by virus; PDB: 2QV1_B 3LOX_C 2OBQ_C 2OC1_C 2OC0_A 3LON_A 3KNX_A 2O8M_A 2OBO_A 2OC8_A ....
Probab=59.35  E-value=8.7  Score=26.97  Aligned_cols=25  Identities=28%  Similarity=0.646  Sum_probs=17.3

Q ss_pred             CCCcCCCCCeeEEeeCCcEEEEEEEEec
Q psy12782        145 DSCQGDSGGPLMMERTGRWFLIGIVSAG  172 (203)
Q Consensus       145 ~~c~~d~G~pl~~~~~~~~~lvGv~s~~  172 (203)
                      +.-+|-+|||++|... +  ++|++...
T Consensus       104 s~lkGSSGgPiLC~~G-H--~vG~f~aa  128 (148)
T PF02907_consen  104 SDLKGSSGGPILCPSG-H--AVGMFRAA  128 (148)
T ss_dssp             HHHTT-TT-EEEETTS-E--EEEEEEEE
T ss_pred             EEEecCCCCcccCCCC-C--EEEEEEEE
Confidence            4467889999999753 2  99988764


No 22 
>PF00548 Peptidase_C3:  3C cysteine protease (picornain 3C);  InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This signature defines cysteine peptidases belong to MEROPS peptidase family C3 (picornain, clan PA(C)), subfamilies C3A and C3B. The protein fold of this peptidase domain for members of this family resembles that of the serine peptidase, chymotrypsin [], the type example for clan PA. Picornaviral proteins are expressed as a single polyprotein which is cleaved by the viral C3 cysteine protease. The poliovirus polyprotein is selectively cleaved between the Gln-|-Gly bond. In other picornavirus reactions Glu may be substituted for Gln, and Ser or Thr for Gly. ; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis; PDB: 3SJO_E 2H6M_A 1QA7_C 1HAV_B 2HAL_A 2H9H_A 3QZQ_B 3QZR_A 3R0F_B 3SJ9_A ....
Probab=57.98  E-value=7.2  Score=28.63  Aligned_cols=28  Identities=36%  Similarity=0.494  Sum_probs=22.0

Q ss_pred             CCCcCCCCCeeEEeeCCcEEEEEEEEec
Q psy12782        145 DSCQGDSGGPLMMERTGRWFLIGIVSAG  172 (203)
Q Consensus       145 ~~c~~d~G~pl~~~~~~~~~lvGv~s~~  172 (203)
                      ....|+=||||+.+..+...++||-..|
T Consensus       143 ~t~~G~CG~~l~~~~~~~~~i~GiHvaG  170 (172)
T PF00548_consen  143 PTKPGMCGSPLVSRIGGQGKIIGIHVAG  170 (172)
T ss_dssp             EEETTGTTEEEEESCGGTTEEEEEEEEE
T ss_pred             CCCCCccCCeEEEeeccCccEEEEEecc
Confidence            4457888999999766666799997765


No 23 
>PF14903 WG_beta_rep:  WG containing repeat
Probab=41.74  E-value=40  Score=16.81  Aligned_cols=25  Identities=20%  Similarity=0.198  Sum_probs=17.3

Q ss_pred             EEEeCCCCCCCCCCCCCCeEEEEECC
Q psy12782         35 KINVHPYFKFTPQADRYDVAVLRLDR   60 (203)
Q Consensus        35 ~i~~hp~y~~~~~~~~~DiALl~L~~   60 (203)
                      ++++.|.|+. -..+.+++|+++...
T Consensus         9 ~~vi~~~yd~-i~~~~~g~~~v~~~~   33 (35)
T PF14903_consen    9 KIVIPPKYDE-IYPFSNGYAIVKKDG   33 (35)
T ss_pred             CEEEEccccC-ccccCCCEEEEEECC
Confidence            3566788873 345678899988753


No 24 
>KOG3939|consensus
Probab=40.68  E-value=77  Score=24.94  Aligned_cols=39  Identities=28%  Similarity=0.455  Sum_probs=27.6

Q ss_pred             EEeeeeCCCCCCCcCCCCCeeEEe-----------------eCCcEEEEEEEEecC
Q psy12782        135 MCAGYRGGAKDSCQGDSGGPLMME-----------------RTGRWFLIGIVSAGY  173 (203)
Q Consensus       135 ~C~~~~~~~~~~c~~d~G~pl~~~-----------------~~~~~~lvGv~s~~~  173 (203)
                      .|......-+..|...+||+|+|.                 +.+..+++|++..+.
T Consensus       239 a~G~~f~l~qGts~ETsGGlLIclP~eqaakfcaei~s~k~gegqAWIIGiVekgn  294 (312)
T KOG3939|consen  239 ACGNMFKLRQGTSAETSGGLLICLPREQAAKFCAEIKSPKNGEGQAWIIGIVEKGN  294 (312)
T ss_pred             hccccceeccCCCccCCCceEEEccHHHHHHHHHHhcCCccCCCceEEEEEEecCC
Confidence            444333344678888999999982                 234688999999864


No 25 
>PF00944 Peptidase_S3:  Alphavirus core protein ;  InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. Togavirin, also known as Sindbis virus core endopeptidase, is a serine protease resident at the N terminus of the p130 polyprotein of togaviruses []. The endopeptidase signature identifies the peptidase as belonging to the MEROPS peptidase family S3 (togavirin family, clan PA(S)). The polyprotein also includes structural proteins for the nucleocapsid core and for the glycoprotein spikes []. Togavirin is only active while part of the polyprotein, cleavage at a Trp-Ser bond resulting in total lack of activity []. Mutagenesis studies have identified the location of the His-Asp-Ser catalytic triad, and X-ray studies have revealed the protein fold to be similar to that of chymotrypsin [, ].; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 2YEW_D 1EP5_A 3J0C_F 1EP6_C 1WYK_D 1DYL_A 1VCQ_B 1VCP_B 1LD4_D 1KXA_A ....
Probab=40.49  E-value=8.8  Score=26.96  Aligned_cols=26  Identities=38%  Similarity=0.693  Sum_probs=18.9

Q ss_pred             CCcCCCCCeeEEeeCCcEEEEEEEEecCC
Q psy12782        146 SCQGDSGGPLMMERTGRWFLIGIVSAGYS  174 (203)
Q Consensus       146 ~c~~d~G~pl~~~~~~~~~lvGv~s~~~~  174 (203)
                      --.||||-|++.+. |+  +|||+-.|.+
T Consensus       103 g~~GDSGRpi~DNs-Gr--VVaIVLGG~n  128 (158)
T PF00944_consen  103 GKPGDSGRPIFDNS-GR--VVAIVLGGAN  128 (158)
T ss_dssp             -STTSTTEEEESTT-SB--EEEEEEEEEE
T ss_pred             CCCCCCCCccCcCC-CC--EEEEEecCCC
Confidence            35789999998764 44  8888877643


No 26 
>PF05416 Peptidase_C37:  Southampton virus-type processing peptidase;  InterPro: IPR001665 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to the MEROPS peptidase family C37, (clan PA(C)). The type example is calicivirin from Southampton virus, an endopeptidase that cleaves the polyprotein at sites N-terminal to itself, liberating the polyprotein helicase. Southampton virus is a positive-stranded ssRNA virus belonging to the Caliciviruses, which are viruses that cause gastroenteritis. The calicivirus genome contains two open reading frames, ORF1 and ORF2. ORF1 encodes a non-structural polypeptide, which has RNA helicase, cysteine protease and RNA polymerase activity []. The regions of the polyprotein in which these activities lie are similar to proteins produced by the picornaviruses []. ORF2 encodes a structural, capsid protein. Two different families of caliciviruses can be distinguished on the basis of sequence similarity, namely the Norwalk-like viruses or small round structured viruses (SRSVs), and those classed as non-SRSVs.; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis; PDB: 2FYQ_A 2FYR_A 1WQS_D 4ASH_A 2IPH_B.
Probab=39.75  E-value=53  Score=27.90  Aligned_cols=31  Identities=29%  Similarity=0.646  Sum_probs=23.4

Q ss_pred             CCCcCCCCCeeEEeeCCcEEEEEEEEecCCC
Q psy12782        145 DSCQGDSGGPLMMERTGRWFLIGIVSAGYSC  175 (203)
Q Consensus       145 ~~c~~d~G~pl~~~~~~~~~lvGv~s~~~~c  175 (203)
                      ..-.||-|.|-++...+.|+++||-+.....
T Consensus       499 GT~PGDCGcPYvyKrgNd~VV~GVH~AAtr~  529 (535)
T PF05416_consen  499 GTIPGDCGCPYVYKRGNDWVVIGVHAAATRS  529 (535)
T ss_dssp             S--TTGTT-EEEEEETTEEEEEEEEEEE-SS
T ss_pred             CCCCCCCCCceeeecCCcEEEEEEEehhccC
Confidence            4577899999999999999999998876443


No 27 
>PF10459 Peptidase_S46:  Peptidase S46;  InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This entry represents S46 peptidases, where dipeptidyl-peptidase 7 (DPP-7) is the best-characterised member of this family. It is a serine peptidase that is located on the cell surface and is predicted to have two N-terminal transmembrane domains. 
Probab=35.99  E-value=33  Score=31.16  Aligned_cols=63  Identities=19%  Similarity=0.169  Sum_probs=36.4

Q ss_pred             CCeEEeeeeCCCCCCCcCCCCCeeEEeeCCcEEEEEEEEecC-C---CCCCCC----CeEEEeCCCCHHHHHHhhccc
Q psy12782        132 DEMMCAGYRGGAKDSCQGDSGGPLMMERTGRWFLIGIVSAGY-S---CAQQGQ----PGIYHRVAYTVDWISYIMNTA  201 (203)
Q Consensus       132 ~~~~C~~~~~~~~~~c~~d~G~pl~~~~~~~~~lvGv~s~~~-~---c~~~~~----~~v~t~v~~~~~WI~~~i~~~  201 (203)
                      +.-+|.-+   +.+...|.||||++....   .|||++==+. .   ..-.-.    =.|-+++. |.-|+.+.+..+
T Consensus       619 ~~pv~Fls---tnDitGGNSGSPvlN~~G---eLVGl~FDgn~Esl~~D~~fdp~~~R~I~VDiR-yvL~~ldkv~gA  689 (698)
T PF10459_consen  619 SVPVNFLS---TNDITGGNSGSPVLNAKG---ELVGLAFDGNWESLSGDIAFDPELNRTIHVDIR-YVLWALDKVYGA  689 (698)
T ss_pred             CeeeEEEe---ccCcCCCCCCCccCCCCc---eEEEEeecCchhhcccccccccccceeEEEEHH-HHHHHHHHHhCh
Confidence            34477653   357889999999998543   3999864221 0   000001    14455554 477877666544


No 28 
>PF00949 Peptidase_S7:  Peptidase S7, Flavivirus NS3 serine protease ;  InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This signature identifies serine peptidases belong to MEROPS peptidase family S7 (flavivirin family, clan PA(S)). The protein fold of the peptidase domain for members of this family resembles that of chymotrypsin, the type example for clan PA.  Flaviviruses produce a polyprotein from the ssRNA genome. The N terminus of the NS3 protein (approx. 180 aa) is required for the processing of the polyprotein. NS3 also has conserved homology with NTP-binding proteins and DEAD family of RNA helicase [, , ].; GO: 0003723 RNA binding, 0003724 RNA helicase activity, 0005524 ATP binding; PDB: 2IJO_B 3E90_D 2GGV_B 2FP7_B 2WV9_A 3U1I_B 3U1J_B 2WZQ_A 2WHX_A 3L6P_A ....
Probab=24.95  E-value=71  Score=22.42  Aligned_cols=27  Identities=26%  Similarity=0.589  Sum_probs=17.2

Q ss_pred             CCCcCCCCCeeEEeeCCcEEEEEEEEecCC
Q psy12782        145 DSCQGDSGGPLMMERTGRWFLIGIVSAGYS  174 (203)
Q Consensus       145 ~~c~~d~G~pl~~~~~~~~~lvGv~s~~~~  174 (203)
                      +.-.|.||+|++..+. +  ++||.-.+..
T Consensus        93 d~~~GsSGSpi~n~~g-~--ivGlYg~g~~  119 (132)
T PF00949_consen   93 DFPKGSSGSPIFNQNG-E--IVGLYGNGVE  119 (132)
T ss_dssp             -S-TTGTT-EEEETTS-C--EEEEEEEEEE
T ss_pred             ccCCCCCCCceEcCCC-c--EEEEEcccee
Confidence            4567899999996542 2  8998776543


No 29 
>KOG1421|consensus
Probab=20.41  E-value=4.3e+02  Score=24.41  Aligned_cols=48  Identities=15%  Similarity=0.224  Sum_probs=26.0

Q ss_pred             CCCCcCCCCCeeEEeeCCcEEEEEEEEecCCCCCCCCCeEEEeCCCCHHHH
Q psy12782        144 KDSCQGDSGGPLMMERTGRWFLIGIVSAGYSCAQQGQPGIYHRVAYTVDWI  194 (203)
Q Consensus       144 ~~~c~~d~G~pl~~~~~~~~~lvGv~s~~~~c~~~~~~~v~t~v~~~~~WI  194 (203)
                      .+.-.|.+|+|++--..   +.|.+.+.+...+..+......||-.-+..|
T Consensus       211 sstsggssgspVv~i~g---yAVAl~agg~~ssas~ffLpLdrV~RaL~cl  258 (955)
T KOG1421|consen  211 SSTSGGSSGSPVVDIPG---YAVALNAGGSISSASDFFLPLDRVVRALRCL  258 (955)
T ss_pred             hcCCCCCCCCceecccc---eEEeeecCCcccccccceeeccchhhhhhhh
Confidence            46677899999986432   3666666554333323223334444434433


No 30 
>PRK08572 rps17p 30S ribosomal protein S17P; Reviewed
Probab=20.06  E-value=2.9e+02  Score=18.66  Aligned_cols=30  Identities=17%  Similarity=0.199  Sum_probs=22.2

Q ss_pred             EEEeeeeeecccCCCCCceEEeeEEEEeCCCCC
Q psy12782         11 QVTLGDYVINSAVEPLPAYTFGVRKINVHPYFK   43 (203)
Q Consensus        11 ~V~~G~~~~~~~~~~~~~~~~~v~~i~~hp~y~   43 (203)
                      .+..|..--+.++.   .-.+.|.+.+.||.|.
T Consensus        30 k~l~G~VvS~Km~K---TvvV~v~r~~~hpkY~   59 (108)
T PRK08572         30 QVLEGTVVSDKMHK---TVVVEREYLHYVPKYE   59 (108)
T ss_pred             EEEEEEEEecCCCc---eEEEEEEEEEecCCcc
Confidence            35667666666655   5678899999999996


Done!