Query         psy12784
Match_columns 70
No_of_seqs    101 out of 422
Neff          6.8 
Searched_HMMs 46136
Date          Fri Aug 16 19:34:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12784.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12784hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3700|consensus               99.4 1.3E-14 2.8E-19  109.9  -2.7   65    4-68    239-304 (705)
  2 PF01757 Acyl_transf_3:  Acyltr  95.6   0.019 4.1E-07   37.2   3.5   29   34-62      2-30  (340)
  3 PRK03854 opgC glucans biosynth  74.3     4.5 9.6E-05   28.4   3.3   26   30-55      6-31  (375)
  4 COG1835 Predicted acyltransfer  73.1     4.5 9.8E-05   28.5   3.1   28   30-57     12-39  (386)
  5 COG3274 Predicted O-acyltransf  46.8      31 0.00068   25.0   3.4   24   32-55      4-27  (332)
  6 PF07786 DUF1624:  Protein of u  22.2      94   0.002   20.1   2.4   23   33-55      2-24  (223)
  7 PF15061 DUF4538:  Domain of un  22.2 1.1E+02  0.0024   16.7   2.2   27   42-68     11-37  (58)
  8 PF10129 OpgC_C:  OpgC protein;  20.1      94   0.002   22.3   2.2   18   36-53      5-22  (358)
  9 PF12422 Condensin2nSMC:  Conde  19.8      80  0.0017   19.8   1.6   19   29-47      7-25  (152)
 10 TIGR02549 CRISPR_DxTHG CRISPR-  18.5      32  0.0007   15.8  -0.3   17   33-49      4-20  (26)

No 1  
>KOG3700|consensus
Probab=99.39  E-value=1.3e-14  Score=109.85  Aligned_cols=65  Identities=32%  Similarity=0.528  Sum_probs=58.8

Q ss_pred             CcchhhhhhheehhhhHHHhhccCC-CCCCcchhHHHHHHHHHHHHHHHHHhhhhhccccchhhhh
Q psy12784          4 AGLVTQCLMGFSLIKNTKKLISLDR-SPDDIECVHGIRTLNAFMLLLSHKSMALFFNPYINRTQMA   68 (70)
Q Consensus         4 ~~~~~~~l~~FS~~~N~~~L~~~~~-~~~~l~~l~GiR~lsm~wIi~gH~~~~~~~~p~~N~~~~e   68 (70)
                      ++...+++.|||+++|+++|++.++ +++.++|+||||++||+|||.||++++....|.+|+..+.
T Consensus       239 ~~~~~~il~~FS~~~N~~~lfs~~~~~~~~I~~L~giR~lS~~WVi~gH~~~~~~~~~~~n~~~~~  304 (705)
T KOG3700|consen  239 QNRLARILLAFSLWTNAKLLFSVKESKPGFIDCLDGIRFLSMFWVVFGHTFNFLQFSPVDNLASLL  304 (705)
T ss_pred             hhhhhhhheeeeHhhhHHHHcccccCCCCcceeecchheeeeeEEEeccEEEEEeccccccHHHHH
Confidence            4678899999999999999999875 4578999999999999999999999999988889988764


No 2  
>PF01757 Acyl_transf_3:  Acyltransferase family;  InterPro: IPR002656 This entry contains a range of acyltransferase enzymes as well as yet uncharacterised proteins from Caenorhabditis elegans. It also includes the protein OatA. The pathogenic bacteria, Staphylococcus aureus, is able to cause persistent infections due to its ability to resist the immune defence system. Lysozyme, a cell wall-lytic enzyme, is one of the first defence compounds induced in serum and tissues after the onset of infection.  S. aureus has complete resistance to lysozyme action by O-acetylating its peptidoglycan (PG) by O-acetyltransferase (OatA) [, ]. Staphylococcus bacteria are one of the only bacterial genera that are resistant to lysozyme and tend to colonise the skin and mucosa of humans and animals []. OatA is an integral membrane protein. This entry also includes NolL proteins. NolL-dependent acetylation is specific for the fucosyl penta-N-acetylglucosamine species. In addition, the NolL protein caused elevated production of lipo-chitin oligosaccharides (LCOs). The NolL protein obtained from Rhizobium loti (Mesorhizobium loti) functions as an acetyl transferase [].; GO: 0016747 transferase activity, transferring acyl groups other than amino-acyl groups
Probab=95.55  E-value=0.019  Score=37.18  Aligned_cols=29  Identities=17%  Similarity=0.482  Sum_probs=23.5

Q ss_pred             chhHHHHHHHHHHHHHHHHHhhhhhcccc
Q psy12784         34 ECVHGIRTLNAFMLLLSHKSMALFFNPYI   62 (70)
Q Consensus        34 ~~l~GiR~lsm~wIi~gH~~~~~~~~p~~   62 (70)
                      ..+|++|.+++++|+.+|........+..
T Consensus         2 ~~iD~lR~ia~l~Vv~~H~~~~~~~~~~~   30 (340)
T PF01757_consen    2 YWIDGLRGIAILLVVFGHSFIFYFPPPFQ   30 (340)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHhcccccc
Confidence            57999999999999999999865444333


No 3  
>PRK03854 opgC glucans biosynthesis protein; Provisional
Probab=74.32  E-value=4.5  Score=28.45  Aligned_cols=26  Identities=15%  Similarity=0.110  Sum_probs=22.5

Q ss_pred             CCCcchhHHHHHHHHHHHHHHHHHhh
Q psy12784         30 PDDIECVHGIRTLNAFMLLLSHKSMA   55 (70)
Q Consensus        30 ~~~l~~l~GiR~lsm~wIi~gH~~~~   55 (70)
                      ++....+|-+|+++++.|+.+|+..+
T Consensus         6 ~~R~~~lD~lR~~a~l~VV~~H~~~~   31 (375)
T PRK03854          6 AQREYFLDSIRAWLMLLGIPFHISLI   31 (375)
T ss_pred             cchhhhHHHHHHHHHHHHHHHHHHHH
Confidence            44577899999999999999999764


No 4  
>COG1835 Predicted acyltransferases [Lipid metabolism]
Probab=73.07  E-value=4.5  Score=28.52  Aligned_cols=28  Identities=18%  Similarity=0.427  Sum_probs=24.1

Q ss_pred             CCCcchhHHHHHHHHHHHHHHHHHhhhh
Q psy12784         30 PDDIECVHGIRTLNAFMLLLSHKSMALF   57 (70)
Q Consensus        30 ~~~l~~l~GiR~lsm~wIi~gH~~~~~~   57 (70)
                      .+-+.-+||+|.+...+|+..|......
T Consensus        12 ~~~~~~ldgLR~iAal~Vv~~H~~~~~~   39 (386)
T COG1835          12 GGRLPGLDGLRAIAALLVVLYHAGFQIG   39 (386)
T ss_pred             ccccCCcHHHHHHHHHHHHHHHcccccc
Confidence            5678999999999999999999886433


No 5  
>COG3274 Predicted O-acyltransferase [General function prediction only]
Probab=46.75  E-value=31  Score=24.98  Aligned_cols=24  Identities=21%  Similarity=0.481  Sum_probs=20.9

Q ss_pred             CcchhHHHHHHHHHHHHHHHHHhh
Q psy12784         32 DIECVHGIRTLNAFMLLLSHKSMA   55 (70)
Q Consensus        32 ~l~~l~GiR~lsm~wIi~gH~~~~   55 (70)
                      .+.-+|-.|+++++.||.-|+...
T Consensus         4 ri~wiD~~r~iA~f~VV~iH~~~~   27 (332)
T COG3274           4 RIVWIDLLRSIACFMVVMIHSTLW   27 (332)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHHH
Confidence            466789999999999999998764


No 6  
>PF07786 DUF1624:  Protein of unknown function (DUF1624);  InterPro: IPR012429 These sequences are found in hypothetical proteins of unknown function expressed by bacterial and archaeal species. The region in question is approximately 230 residues long. 
Probab=22.25  E-value=94  Score=20.07  Aligned_cols=23  Identities=22%  Similarity=0.343  Sum_probs=19.7

Q ss_pred             cchhHHHHHHHHHHHHHHHHHhh
Q psy12784         33 IECVHGIRTLNAFMLLLSHKSMA   55 (70)
Q Consensus        33 l~~l~GiR~lsm~wIi~gH~~~~   55 (70)
                      +..+|-+|.++++..+..|....
T Consensus         2 i~~lD~~RGlaii~Mi~~H~~~~   24 (223)
T PF07786_consen    2 IPSLDALRGLAIIGMILVHFLFD   24 (223)
T ss_pred             cHHHHHHHHHHHHhhhHhhCcCh
Confidence            56789999999999999998753


No 7  
>PF15061 DUF4538:  Domain of unknown function (DUF4538)
Probab=22.17  E-value=1.1e+02  Score=16.72  Aligned_cols=27  Identities=19%  Similarity=0.493  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHhhhhhccccchhhhh
Q psy12784         42 LNAFMLLLSHKSMALFFNPYINRTQMA   68 (70)
Q Consensus        42 lsm~wIi~gH~~~~~~~~p~~N~~~~e   68 (70)
                      +.-+.-.+|-.+..+.+.|..|+++.-
T Consensus        11 ~ggfVg~iG~a~Ypi~~~Pmm~~eeYk   37 (58)
T PF15061_consen   11 VGGFVGLIGAALYPIYFRPMMNPEEYK   37 (58)
T ss_pred             HHHHHHHHHHHHhhhhcccccChHHHH
Confidence            444555667777888999999998764


No 8  
>PF10129 OpgC_C:  OpgC protein;  InterPro: IPR014550 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=20.08  E-value=94  Score=22.29  Aligned_cols=18  Identities=22%  Similarity=0.412  Sum_probs=16.9

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q psy12784         36 VHGIRTLNAFMLLLSHKS   53 (70)
Q Consensus        36 l~GiR~lsm~wIi~gH~~   53 (70)
                      +|.+|-+.+..|.+.|.-
T Consensus         5 iD~~RGlaL~~Ifi~Hip   22 (358)
T PF10129_consen    5 IDFFRGLALVMIFIDHIP   22 (358)
T ss_pred             HHHHHHHHHHHHHHHhcC
Confidence            899999999999999984


No 9  
>PF12422 Condensin2nSMC:  Condensin II non structural maintenance of chromosomes subunit;  InterPro: IPR024741 Subunit G2 is a non-SMC subunit of condensin II, which is involved in maintenance of the structural integrity of chromosomes. Condensin II is made up of SMC (structural maintenance of chromosomes) and non-SMC subunits. The non-SMC subunits bind to the catalytic ends of the SMC subunit dimer. The condensin holocomplex is able to introduce superhelical tension into DNA in an ATP hydrolysis- dependent manner, resulting in the formation of positive supercoils in the presence of topoisomerase I and of positive knots in the presence of topoisomerase II [].; GO: 0005634 nucleus
Probab=19.79  E-value=80  Score=19.83  Aligned_cols=19  Identities=21%  Similarity=0.317  Sum_probs=15.8

Q ss_pred             CCCCcchhHHHHHHHHHHH
Q psy12784         29 SPDDIECVHGIRTLNAFML   47 (70)
Q Consensus        29 ~~~~l~~l~GiR~lsm~wI   47 (70)
                      ++.-+++.+|-|++|+++-
T Consensus         7 ~p~~i~~~~g~~fls~l~~   25 (152)
T PF12422_consen    7 PPSFIKTFEGRKFLSFLFS   25 (152)
T ss_pred             chhhcCcHHHHHHHHHHHH
Confidence            4667889999999999955


No 10 
>TIGR02549 CRISPR_DxTHG CRISPR-associated DxTHG motif protein. This model describes a short region highly conserved between two otherwise substantially different CRISPR-associated (cas) proteins, TIGR02221 and TIGR01987. This region includes the motif [VIL]-D-x-[ST]-H-[GS].
Probab=18.47  E-value=32  Score=15.81  Aligned_cols=17  Identities=12%  Similarity=0.299  Sum_probs=11.9

Q ss_pred             cchhHHHHHHHHHHHHH
Q psy12784         33 IECVHGIRTLNAFMLLL   49 (70)
Q Consensus        33 l~~l~GiR~lsm~wIi~   49 (70)
                      ++.-||+|.++++-...
T Consensus         4 lDiTHGfr~~P~la~~a   20 (26)
T TIGR02549         4 LDVTHGFNFMPLLAYEA   20 (26)
T ss_pred             EEecCcccchHHHHHHh
Confidence            34568999998876543


Done!