Query         psy12795
Match_columns 121
No_of_seqs    119 out of 792
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 19:48:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12795.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12795hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04898 Glu_syn_central:  Glut 100.0 2.1E-44 4.5E-49  296.1   4.2  100    1-118    32-131 (287)
  2 KOG0399|consensus              100.0 1.2E-38 2.6E-43  299.5   8.2  101    1-119   568-668 (2142)
  3 PRK11750 gltB glutamate syntha 100.0 1.9E-38   4E-43  300.6   8.5  101    1-119   489-589 (1485)
  4 PF03672 UPF0154:  Uncharacteri  55.9     4.2 9.1E-05   27.8   0.2   22   47-71     28-49  (64)
  5 PRK00523 hypothetical protein;  50.4     5.7 0.00012   27.8   0.2   21   47-70     36-56  (72)
  6 PRK09545 znuA high-affinity zi  47.5     2.9 6.3E-05   34.4  -1.9   59   24-82      7-70  (311)
  7 PRK01844 hypothetical protein;  42.5     8.9 0.00019   26.8   0.2   21   47-70     35-55  (72)
  8 PF06440 DNA_pol3_theta:  DNA p  39.4      18  0.0004   25.5   1.4   32   11-53     42-73  (75)
  9 PF08763 Ca_chan_IQ:  Voltage g  34.2      21 0.00047   21.9   0.9   11   16-26     14-24  (35)
 10 PF01805 Surp:  Surp module;  I  34.0      60  0.0013   20.2   3.0   25    2-26     28-52  (55)
 11 PRK10969 DNA polymerase III su  33.6      20 0.00043   25.3   0.8   31   12-53     43-73  (75)
 12 PF15601 Imm42:  Immunity prote  26.5      50  0.0011   25.2   2.0   18   10-27     94-116 (134)
 13 PF02325 YGGT:  YGGT family;  I  25.6     7.4 0.00016   25.6  -2.4   13   45-57     35-47  (75)
 14 PF13651 EcoRI_methylase:  Aden  25.3      19 0.00042   31.4  -0.5   15   44-58    138-152 (336)
 15 PF01353 GFP:  Green fluorescen  21.2      45 0.00097   27.3   0.9   18    9-26     67-84  (219)

No 1  
>PF04898 Glu_syn_central:  Glutamate synthase central domain;  InterPro: IPR006982 Glutamate synthase (GltS)1 is a key enzyme in the early stages of the assimilation of ammonia in bacteria, yeasts, and plants. In bacteria, L-glutamate is involved in osmoregulation, is the precursor for other amino acids, and can be the precursor for haem biosynthesis. In plants, GltS is especially essential in the reassimilation of ammonia released by photorespiration. On the basis of the amino acid sequence and the nature of the electron donor, three different classes of GltS can de defined as follows: 1) ferredoxin-dependent GltS (Fd-GltS), 2) NADPH-dependent GltS (NADPH-GltS), and 3) NADH-dependent GltS (properties of the three classes have been reviewed extensively []). The enzyme is a complex iron-sulphur flavoprotein catalysing the reductive transfer of the amido nitrogen from L-glutamine to 2-oxoglutarate to form two molecules of L-glutamate via intramolecular channelling of ammonia from the amidotransferase domain to the FMN-binding domain. Reaction of amidotransferase domain:  L-glutamine + H2O = L-glutamate + NH3  Reactions of FMN-binding domain:  2-oxoglutarate + NH3 = 2-iminoglutarate + H2O  2e + FMNox = FMNred  2-iminoglutarate + FMNred = L-glutamate + FMNox  The central domain of glutamate synthase connects the N-terminal amidotransferase domain with the FMN-binding domain and has an alpha/beta overall topology [].; GO: 0015930 glutamate synthase activity, 0006807 nitrogen compound metabolic process, 0055114 oxidation-reduction process; PDB: 1EA0_A 2VDC_E 1OFE_A 1LLW_A 1OFD_A 1LLZ_A 1LM1_A.
Probab=100.00  E-value=2.1e-44  Score=296.12  Aligned_cols=100  Identities=50%  Similarity=0.742  Sum_probs=69.6

Q ss_pred             CCCCcccccccCCCCchHHHHHHHhhhhcchhhhhhhccccccccccCCCCCCccccceeeeeeeecCCCcCCCCCCCCc
Q psy12795          1 MGNDAPLACLSEFQPLLYDYFKQLFAQLLPVLLSVTTMYCSLSLQVTNPPIDPFREKVVMSLMCPIGPEANILEPSAKQC   80 (121)
Q Consensus         1 MG~DtPLA~LS~~~~~L~dYFkQ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDpiRE~~VmSl~~~lG~~~nil~~~~~~~   80 (121)
                      ||+||||||||+++++|||||||+||                  ||||||||||||++||||+|+||+++|+|++++++|
T Consensus        32 MG~DtPLAvLS~~~~~l~~YFkQ~FA------------------QVTNPPID~iRE~~vmSl~~~lG~~~n~l~~~~~~~   93 (287)
T PF04898_consen   32 MGDDTPLAVLSEKPQNLFDYFKQLFA------------------QVTNPPIDPIREELVMSLRTYLGPRPNILEETPEHA   93 (287)
T ss_dssp             S---S--CCC-SS---GGGCEEE----------------------SSS----TTTTGGG-B--EEES--S-TTS-SGGGC
T ss_pred             CCCCChhHhhcCCCCcHHHHHHHhhh------------------hccCCCcchhhhhheeecceeeCCCCCCCCCCCCCc
Confidence            99999999999999999999999999                  999999999999999999999999999999999999


Q ss_pred             ceEEcCCcccCHHHHHHHHhccCCCceeEEEEeeEeCC
Q psy12795         81 HRLFLPNPLLSLYDLEVIRLNTHRGWKVMKVSLMADLT  118 (121)
Q Consensus        81 ~rL~L~SPVLs~~~l~~i~~~~~~~~~~~~l~~~~~~~  118 (121)
                      ++|+|+||||+++|+++|++...++|++.+++++|++.
T Consensus        94 ~~l~l~sPiL~~~~l~~l~~~~~~~~~~~~l~~~f~~~  131 (287)
T PF04898_consen   94 RRLELDSPILSNGQLEKLRSLDDPGFKAATLDATFPAE  131 (287)
T ss_dssp             -CEEESSSB--HHHHHHHHHH--CCCCEEEEESEEEST
T ss_pred             eEEEecCCEECHHHHHHHHHhhccCCCccEEEEEEECC
Confidence            99999999999999999999877889999999999976


No 2  
>KOG0399|consensus
Probab=100.00  E-value=1.2e-38  Score=299.45  Aligned_cols=101  Identities=58%  Similarity=1.024  Sum_probs=98.8

Q ss_pred             CCCCcccccccCCCCchHHHHHHHhhhhcchhhhhhhccccccccccCCCCCCccccceeeeeeeecCCCcCCCCCCCCc
Q psy12795          1 MGNDAPLACLSEFQPLLYDYFKQLFAQLLPVLLSVTTMYCSLSLQVTNPPIDPFREKVVMSLMCPIGPEANILEPSAKQC   80 (121)
Q Consensus         1 MG~DtPLA~LS~~~~~L~dYFkQ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDpiRE~~VmSl~~~lG~~~nil~~~~~~~   80 (121)
                      ||||+||||||++|++|||||||+||                  ||||||||||||.+||||.|+|||++|+||.++++|
T Consensus       568 MGnDaplA~LS~~p~llydYFkQlFA------------------QVTNPpIDPiRE~iVmSLec~IGp~gNllE~~~eq~  629 (2142)
T KOG0399|consen  568 MGNDAPLACLSDRPHLLYDYFKQLFA------------------QVTNPPIDPIREAIVMSLECYIGPEGNLLEPGPEQC  629 (2142)
T ss_pred             cCCCcceehhcCCccHHHHHHHHHHH------------------hccCCCCChhhhhheEEEEeeecCCcCcccCChhHh
Confidence            99999999999999999999999999                  999999999999999999999999999999999999


Q ss_pred             ceEEcCCcccCHHHHHHHHhccCCCceeEEEEeeEeCCC
Q psy12795         81 HRLFLPNPLLSLYDLEVIRLNTHRGWKVMKVSLMADLTN  119 (121)
Q Consensus        81 ~rL~L~SPVLs~~~l~~i~~~~~~~~~~~~l~~~~~~~~  119 (121)
                      +|+.|++|||+..||+.|+...+++||++.|+++|+..+
T Consensus       630 ~rl~L~~PvL~~~e~ealk~~~y~~wk~k~iditf~~~~  668 (2142)
T KOG0399|consen  630 SRLILKGPVLNEEEMEALKNDMYPGWKVKEIDITFDKSE  668 (2142)
T ss_pred             ceeeccCCcCCHHHHHHHhcCCCccceeeeeeeeeehhh
Confidence            999999999999999999998899999999999999654


No 3  
>PRK11750 gltB glutamate synthase subunit alpha; Provisional
Probab=100.00  E-value=1.9e-38  Score=300.58  Aligned_cols=101  Identities=41%  Similarity=0.658  Sum_probs=97.2

Q ss_pred             CCCCcccccccCCCCchHHHHHHHhhhhcchhhhhhhccccccccccCCCCCCccccceeeeeeeecCCCcCCCCCCCCc
Q psy12795          1 MGNDAPLACLSEFQPLLYDYFKQLFAQLLPVLLSVTTMYCSLSLQVTNPPIDPFREKVVMSLMCPIGPEANILEPSAKQC   80 (121)
Q Consensus         1 MG~DtPLA~LS~~~~~L~dYFkQ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDpiRE~~VmSl~~~lG~~~nil~~~~~~~   80 (121)
                      ||+||||||||+++++|||||||+||                  ||||||||||||++||||+|+||+++|+|++++++|
T Consensus       489 MG~D~plAvLS~~~~~l~~yFkQ~FA------------------QVTNPPID~iRE~~vmSl~~~lG~~~n~l~~~~~~~  550 (1485)
T PRK11750        489 MGDDTPMAVLSSQPRSIYDYFRQQFA------------------QVTNPPIDPLREAHVMSLATCIGREMNVFCETEGHA  550 (1485)
T ss_pred             CCCCcchhhhcCCCccHHHHhhhcce------------------eccCCCCchhhhhceeeeeeeeCCCcCcCCCCcccC
Confidence            99999999999999999999999999                  999999999999999999999999999999999999


Q ss_pred             ceEEcCCcccCHHHHHHHHhccCCCceeEEEEeeEeCCC
Q psy12795         81 HRLFLPNPLLSLYDLEVIRLNTHRGWKVMKVSLMADLTN  119 (121)
Q Consensus        81 ~rL~L~SPVLs~~~l~~i~~~~~~~~~~~~l~~~~~~~~  119 (121)
                      ++|+|+||||++.|+++|+.....+|++.+++++|++.+
T Consensus       551 ~~l~l~~PiL~~~~~~~l~~~~~~~~~~~~l~~~f~~~~  589 (1485)
T PRK11750        551 HRVIFKSPVLSYSDFKQLTTLDEEHYRADTLDLNYDPEE  589 (1485)
T ss_pred             CeEEeCCceeCHHHHHHHHhccccCCceEEEEEEEeCCh
Confidence            999999999999999999987656799999999998743


No 4  
>PF03672 UPF0154:  Uncharacterised protein family (UPF0154);  InterPro: IPR005359 The proteins in this entry are functionally uncharacterised.
Probab=55.90  E-value=4.2  Score=27.76  Aligned_cols=22  Identities=36%  Similarity=0.797  Sum_probs=15.8

Q ss_pred             cCCCCCCccccceeeeeeeecCCCc
Q psy12795         47 TNPPIDPFREKVVMSLMCPIGPEAN   71 (121)
Q Consensus        47 TNPPIDpiRE~~VmSl~~~lG~~~n   71 (121)
                      -||||+   |+-+-+++.-.|.++|
T Consensus        28 ~NPpin---e~mir~M~~QMG~kpS   49 (64)
T PF03672_consen   28 ENPPIN---EKMIRAMMMQMGRKPS   49 (64)
T ss_pred             HCCCCC---HHHHHHHHHHhCCCcc
Confidence            599987   5666667777787543


No 5  
>PRK00523 hypothetical protein; Provisional
Probab=50.39  E-value=5.7  Score=27.79  Aligned_cols=21  Identities=29%  Similarity=0.676  Sum_probs=15.5

Q ss_pred             cCCCCCCccccceeeeeeeecCCC
Q psy12795         47 TNPPIDPFREKVVMSLMCPIGPEA   70 (121)
Q Consensus        47 TNPPIDpiRE~~VmSl~~~lG~~~   70 (121)
                      -||||+   |+.+-+.+.-.|.++
T Consensus        36 ~NPpin---e~mir~M~~QMGqKP   56 (72)
T PRK00523         36 ENPPIT---ENMIRAMYMQMGRKP   56 (72)
T ss_pred             HCcCCC---HHHHHHHHHHhCCCc
Confidence            599987   566666777778754


No 6  
>PRK09545 znuA high-affinity zinc transporter periplasmic component; Reviewed
Probab=47.48  E-value=2.9  Score=34.37  Aligned_cols=59  Identities=19%  Similarity=0.241  Sum_probs=44.1

Q ss_pred             HhhhhcchhhhhhhccccccccccCCCCCCccccce---eeeeeee--cCCCcCCCCCCCCcce
Q psy12795         24 LFAQLLPVLLSVTTMYCSLSLQVTNPPIDPFREKVV---MSLMCPI--GPEANILEPSAKQCHR   82 (121)
Q Consensus        24 ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDpiRE~~V---mSl~~~l--G~~~nil~~~~~~~~r   82 (121)
                      +||.||..||.-++-|-.+.+-+|++||--|-+.++   ....+.+  |..+.-+++++++.++
T Consensus         7 ~~~~~~~~~~~~~~~~~~~~VvaS~~pl~~~v~~I~gd~~~V~~Lvp~g~dPH~yep~p~d~~~   70 (311)
T PRK09545          7 LFAALLAALLGGATQAANAAVVTSIKPLGFIASAIADGVTETEVLLPDGASPHDYSLRPSDVKR   70 (311)
T ss_pred             HHHHHHHhhcccccccccCcEEEEcHHHHHHHHHHcCCCceEEeccCCCCCCcCCCCCHHHHHH
Confidence            688899999999999999999999999988766654   2334444  4455667888765433


No 7  
>PRK01844 hypothetical protein; Provisional
Probab=42.55  E-value=8.9  Score=26.82  Aligned_cols=21  Identities=33%  Similarity=0.752  Sum_probs=15.2

Q ss_pred             cCCCCCCccccceeeeeeeecCCC
Q psy12795         47 TNPPIDPFREKVVMSLMCPIGPEA   70 (121)
Q Consensus        47 TNPPIDpiRE~~VmSl~~~lG~~~   70 (121)
                      -||||+   |+.+-+.+.-.|.++
T Consensus        35 ~NPpin---e~mir~Mm~QMGqkP   55 (72)
T PRK01844         35 KNPPIN---EQMLKMMMMQMGQKP   55 (72)
T ss_pred             HCCCCC---HHHHHHHHHHhCCCc
Confidence            799987   566666677778754


No 8  
>PF06440 DNA_pol3_theta:  DNA polymerase III, theta subunit;  InterPro: IPR009052 This entry represents the theta subunit of DNA polymerase III from bacteria, whose core structure consists of an irregular array of three helices []. DNA polymerase III (Pol III) is the primary enzyme responsible for replication of Escherichia coli chromosomal DNA. The holoenzyme consists of 17 proteins and contains two core polymerases. The Pol III catalytic core has three tightly associated subunits: alpha, epsilon and theta. The alpha subunit is responsible for the DNA polymerase activity, while the epsilon subunit is the 3'-5' proofreading exonuclease. The epsilon subunit binds to both the alpha and theta subunits in the linear order alpha-epsilon-theta. The theta subunit is the smallest, and may act to enhance the proofreading activity of epsilon, especially under extreme conditions [].  This entry also includes a homologue of polymerase III theta called HOT (homologue of theta) from Bacteriophage P1. HOT contains three alpha-helices, as reported for theta, but the folding topology of the two is different, which could account for the suggested greater heat stability of HOT as compared to theta [].; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 1SE7_A 2IDO_D 2AE9_A 1DU2_A 2XY8_B 2AXD_S.
Probab=39.44  E-value=18  Score=25.55  Aligned_cols=32  Identities=28%  Similarity=0.523  Sum_probs=23.7

Q ss_pred             cCCCCchHHHHHHHhhhhcchhhhhhhccccccccccCCCCCC
Q psy12795         11 SEFQPLLYDYFKQLFAQLLPVLLSVTTMYCSLSLQVTNPPIDP   53 (121)
Q Consensus        11 S~~~~~L~dYFkQ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDp   53 (121)
                      -+.|..|-.||+++..           .|-..|.|..--|.+|
T Consensus        42 reqPe~LR~YFreRL~-----------~YR~~s~~l~r~~yep   73 (75)
T PF06440_consen   42 REQPEHLREYFRERLN-----------YYRQISKQLPRLPYEP   73 (75)
T ss_dssp             HCS-GGGHHHHHHHHH-----------HHHHHHCCSSTTTSS-
T ss_pred             HHCcHHHHHHHHHHHH-----------HHHHHHHhCCCCCCCC
Confidence            4568899999999988           6777777777666665


No 9  
>PF08763 Ca_chan_IQ:  Voltage gated calcium channel IQ domain;  InterPro: IPR014873 Ca2+ ions are unique in that they not only carry charge but they are also the most widely used of diffusible second messengers. Voltage-dependent Ca2+ channels (VDCC) are a family of molecules that allow cells to couple electrical activity to intracellular Ca2+ signalling. The opening and closing of these channels by depolarizing stimuli, such as action potentials, allows Ca2+ ions to enter neurons down a steep electrochemical gradient, producing transient intracellular Ca2+ signals. Many of the processes that occur in neurons, including transmitter release, gene transcription and metabolism are controlled by Ca2+ influx occurring simultaneously at different cellular locales. The pore is formed by the alpha-1 subunit which incorporates the conduction pore, the voltage sensor and gating apparatus, and the known sites of channel regulation by second messengers, drugs, and toxins []. The activity of this pore is modulated by 4 tightly-coupled subunits: an intracellular beta subunit; a transmembrane gamma subunit; and a disulphide-linked complex of alpha-2 and delta subunits, which are proteolytically cleaved from the same gene product. Properties of the protein including gating voltage-dependence, G protein modulation and kinase susceptibility can be influenced by these subunits. Voltage-gated calcium channels are classified as T, L, N, P, Q and R, and are distinguished by their sensitivity to pharmacological blocks, single-channel conductance kinetics, and voltage-dependence. On the basis of their voltage activation properties, the voltage-gated calcium classes can be further divided into two broad groups: the low (T-type) and high (L, N, P, Q and R-type) threshold-activated channels. The voltage-gated calcium channel alpha 1 subunit contains an IQ domain, named for its isoleucine-glutamine (IQ) motif, which interacts with hydrophobic pockets of Ca2+/calmodulin []. The interaction regulates two self-regulatory calcium dependent feedback mechanisms, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF). ; PDB: 3OXQ_F 2F3Z_B 3G43_E 2F3Y_B 2BE6_D 3DVM_B 3BXK_D 2VAY_B 3DVK_B 3BXL_B ....
Probab=34.22  E-value=21  Score=21.88  Aligned_cols=11  Identities=45%  Similarity=0.857  Sum_probs=8.5

Q ss_pred             chHHHHHHHhh
Q psy12795         16 LLYDYFKQLFA   26 (121)
Q Consensus        16 ~L~dYFkQ~FA   26 (121)
                      +++|||||.=+
T Consensus        14 lI~dyfr~~K~   24 (35)
T PF08763_consen   14 LIQDYFRQFKK   24 (35)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
Confidence            58999998644


No 10 
>PF01805 Surp:  Surp module;  InterPro: IPR000061 SWAP is derived from the Suppressor-of-White-APricot splicing regulator from Drosophila melanogaster. The domain is found in regulators responsible for pervasive, nonsex-specific alternative pre-mRNA splicing characteristics and has been found in splicing regulatory proteins []. These ancient, conserved SWAP proteins share a colinearly arrayed series of novel sequence motifs [].; GO: 0003723 RNA binding, 0006396 RNA processing; PDB: 2E5Z_A 2DT7_B 2DT6_A 1UG0_A 1X4P_A 2E60_A 1X4O_A 4DGW_B.
Probab=33.95  E-value=60  Score=20.19  Aligned_cols=25  Identities=16%  Similarity=0.210  Sum_probs=21.6

Q ss_pred             CCCcccccccCCCCchHHHHHHHhh
Q psy12795          2 GNDAPLACLSEFQPLLYDYFKQLFA   26 (121)
Q Consensus         2 G~DtPLA~LS~~~~~L~dYFkQ~FA   26 (121)
                      ++|.-++-|.+...+.+.||+++.+
T Consensus        28 ~~np~F~FL~~~~~~~~~yY~~~l~   52 (55)
T PF01805_consen   28 RNNPQFNFLFPSDSPYHAYYRWKLA   52 (55)
T ss_dssp             TTSGGGGGGSTTSSTHHHHHHHHHH
T ss_pred             CCCCCCcCcCCCCCCCchHHHHHHH
Confidence            4678889999887889999999887


No 11 
>PRK10969 DNA polymerase III subunit theta; Reviewed
Probab=33.61  E-value=20  Score=25.31  Aligned_cols=31  Identities=26%  Similarity=0.475  Sum_probs=24.8

Q ss_pred             CCCCchHHHHHHHhhhhcchhhhhhhccccccccccCCCCCC
Q psy12795         12 EFQPLLYDYFKQLFAQLLPVLLSVTTMYCSLSLQVTNPPIDP   53 (121)
Q Consensus        12 ~~~~~L~dYFkQ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDp   53 (121)
                      +.|..+-+||+++.+           -|-.+|.|..-.|.||
T Consensus        43 eqPe~lR~yFreRL~-----------~yR~~s~~l~r~py~~   73 (75)
T PRK10969         43 EQPEHLRSYFRERLI-----------AYRLASVNLSRLPYEP   73 (75)
T ss_pred             hCCHHHHHHHHHHHH-----------HHHHHHhhcCCCCCCC
Confidence            467889999999998           6777777777777765


No 12 
>PF15601 Imm42:  Immunity protein 42
Probab=26.47  E-value=50  Score=25.19  Aligned_cols=18  Identities=44%  Similarity=0.580  Sum_probs=15.7

Q ss_pred             ccCCCCchHHHH-----HHHhhh
Q psy12795         10 LSEFQPLLYDYF-----KQLFAQ   27 (121)
Q Consensus        10 LS~~~~~L~dYF-----kQ~FA~   27 (121)
                      +|.....|++||     +..|.-
T Consensus        94 i~~~i~~L~~yFvt~dG~~~f~~  116 (134)
T PF15601_consen   94 ISPDITSLSDYFVTSDGKDLFEV  116 (134)
T ss_pred             CCCCCCcHHHHhcCcchhhHHHH
Confidence            678889999999     999983


No 13 
>PF02325 YGGT:  YGGT family;  InterPro: IPR003425 This family represents Ycf19. It is associated with phototrophic organisms and may therefore play a role in photosynthesis, despite its wider association with bacteria outside of the cyanobacteria. ; GO: 0016020 membrane
Probab=25.60  E-value=7.4  Score=25.64  Aligned_cols=13  Identities=38%  Similarity=0.848  Sum_probs=11.8

Q ss_pred             cccCCCCCCcccc
Q psy12795         45 QVTNPPIDPFREK   57 (121)
Q Consensus        45 QVTNPPIDpiRE~   57 (121)
                      ++|+|.+.|+|--
T Consensus        35 ~~TeP~l~p~r~~   47 (75)
T PF02325_consen   35 RITEPILRPFRRI   47 (75)
T ss_pred             HHhhHHHHHHHHH
Confidence            9999999999954


No 14 
>PF13651 EcoRI_methylase:  Adenine-specific methyltransferase EcoRI
Probab=25.29  E-value=19  Score=31.41  Aligned_cols=15  Identities=60%  Similarity=0.933  Sum_probs=13.0

Q ss_pred             ccccCCCCCCccccc
Q psy12795         44 LQVTNPPIDPFREKV   58 (121)
Q Consensus        44 ~QVTNPPIDpiRE~~   58 (121)
                      +-|||||.--+||=+
T Consensus       138 IVVTNPPFSLFrEyv  152 (336)
T PF13651_consen  138 IVVTNPPFSLFREYV  152 (336)
T ss_pred             EEEeCCCcHHHHHHH
Confidence            479999999999963


No 15 
>PF01353 GFP:  Green fluorescent protein;  InterPro: IPR011584 The green fluorescent protein (GFP) is found in the jellyfish (Aequorea victoria), and functions as an energy-transfer acceptor. It fluoresces in vivo upon receiving energy from the Ca2+-activated photoprotein aequorin. The protein absorbs light maximally at 395 nm and exhibits a smaller absorbance peak at 470 nm. The fluorescence emission spectrum peaks at 509 nm with a shoulder at 540 nm. The protein is produced in the photocytes and contains a chromophore, which is composed of modified amino acid residues. The chromophore is formed upon cyclization of the residues ser-dehydrotyr-gly. There are several other members of the GFP family, which are able to fluoresce different colours, sveral of which are non-fluorescent []. These proteins are all essentailly encoded by single genes, since both the substrate and the catalytic enzyme for pigment biosynthesis are provided within a single polypeptide chain []. More information about this protein can be found at Protein of the Month: Green Fluorescent Protein [].; GO: 0008218 bioluminescence; PDB: 2G16_B 1QYO_A 1W7S_B 3ED8_B 3GJ1_A 1GFL_B 3GJ2_C 2WSO_A 3DQD_A 2AWJ_A ....
Probab=21.24  E-value=45  Score=27.26  Aligned_cols=18  Identities=39%  Similarity=0.857  Sum_probs=14.8

Q ss_pred             cccCCCCchHHHHHHHhh
Q psy12795          9 CLSEFQPLLYDYFKQLFA   26 (121)
Q Consensus         9 ~LS~~~~~L~dYFkQ~FA   26 (121)
                      |.++.|..+-|||||.|-
T Consensus        67 ~F~kYP~~i~dyFk~sfp   84 (219)
T PF01353_consen   67 CFTKYPDGIPDYFKQSFP   84 (219)
T ss_dssp             TSSBECTTSG-HHHHTTT
T ss_pred             ehhcCcCCCccHHHHhCC
Confidence            677889999999999985


Done!