Query psy12795 Match_columns 121 No_of_seqs 119 out of 792 Neff 3.3 Searched_HMMs 46136 Date Fri Aug 16 19:48:46 2013 Command hhsearch -i /work/01045/syshi/Psyhhblits/psy12795.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12795hhsearch_cdd -cpu 12 -v 0 No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PF04898 Glu_syn_central: Glut 100.0 2.1E-44 4.5E-49 296.1 4.2 100 1-118 32-131 (287) 2 KOG0399|consensus 100.0 1.2E-38 2.6E-43 299.5 8.2 101 1-119 568-668 (2142) 3 PRK11750 gltB glutamate syntha 100.0 1.9E-38 4E-43 300.6 8.5 101 1-119 489-589 (1485) 4 PF03672 UPF0154: Uncharacteri 55.9 4.2 9.1E-05 27.8 0.2 22 47-71 28-49 (64) 5 PRK00523 hypothetical protein; 50.4 5.7 0.00012 27.8 0.2 21 47-70 36-56 (72) 6 PRK09545 znuA high-affinity zi 47.5 2.9 6.3E-05 34.4 -1.9 59 24-82 7-70 (311) 7 PRK01844 hypothetical protein; 42.5 8.9 0.00019 26.8 0.2 21 47-70 35-55 (72) 8 PF06440 DNA_pol3_theta: DNA p 39.4 18 0.0004 25.5 1.4 32 11-53 42-73 (75) 9 PF08763 Ca_chan_IQ: Voltage g 34.2 21 0.00047 21.9 0.9 11 16-26 14-24 (35) 10 PF01805 Surp: Surp module; I 34.0 60 0.0013 20.2 3.0 25 2-26 28-52 (55) 11 PRK10969 DNA polymerase III su 33.6 20 0.00043 25.3 0.8 31 12-53 43-73 (75) 12 PF15601 Imm42: Immunity prote 26.5 50 0.0011 25.2 2.0 18 10-27 94-116 (134) 13 PF02325 YGGT: YGGT family; I 25.6 7.4 0.00016 25.6 -2.4 13 45-57 35-47 (75) 14 PF13651 EcoRI_methylase: Aden 25.3 19 0.00042 31.4 -0.5 15 44-58 138-152 (336) 15 PF01353 GFP: Green fluorescen 21.2 45 0.00097 27.3 0.9 18 9-26 67-84 (219) No 1 >PF04898 Glu_syn_central: Glutamate synthase central domain; InterPro: IPR006982 Glutamate synthase (GltS)1 is a key enzyme in the early stages of the assimilation of ammonia in bacteria, yeasts, and plants. In bacteria, L-glutamate is involved in osmoregulation, is the precursor for other amino acids, and can be the precursor for haem biosynthesis. In plants, GltS is especially essential in the reassimilation of ammonia released by photorespiration. On the basis of the amino acid sequence and the nature of the electron donor, three different classes of GltS can de defined as follows: 1) ferredoxin-dependent GltS (Fd-GltS), 2) NADPH-dependent GltS (NADPH-GltS), and 3) NADH-dependent GltS (properties of the three classes have been reviewed extensively []). The enzyme is a complex iron-sulphur flavoprotein catalysing the reductive transfer of the amido nitrogen from L-glutamine to 2-oxoglutarate to form two molecules of L-glutamate via intramolecular channelling of ammonia from the amidotransferase domain to the FMN-binding domain. Reaction of amidotransferase domain:L-glutamine + H2O = L-glutamate + NH3 Reactions of FMN-binding domain:2-oxoglutarate + NH3 = 2-iminoglutarate + H2O 2e + FMNox = FMNred 2-iminoglutarate + FMNred = L-glutamate + FMNox The central domain of glutamate synthase connects the N-terminal amidotransferase domain with the FMN-binding domain and has an alpha/beta overall topology [].; GO: 0015930 glutamate synthase activity, 0006807 nitrogen compound metabolic process, 0055114 oxidation-reduction process; PDB: 1EA0_A 2VDC_E 1OFE_A 1LLW_A 1OFD_A 1LLZ_A 1LM1_A. Probab=100.00 E-value=2.1e-44 Score=296.12 Aligned_cols=100 Identities=50% Similarity=0.742 Sum_probs=69.6 Q ss_pred CCCCcccccccCCCCchHHHHHHHhhhhcchhhhhhhccccccccccCCCCCCccccceeeeeeeecCCCcCCCCCCCCc Q psy12795 1 MGNDAPLACLSEFQPLLYDYFKQLFAQLLPVLLSVTTMYCSLSLQVTNPPIDPFREKVVMSLMCPIGPEANILEPSAKQC 80 (121) Q Consensus 1 MG~DtPLA~LS~~~~~L~dYFkQ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDpiRE~~VmSl~~~lG~~~nil~~~~~~~ 80 (121) ||+||||||||+++++|||||||+|| ||||||||||||++||||+|+||+++|+|++++++| T Consensus 32 MG~DtPLAvLS~~~~~l~~YFkQ~FA------------------QVTNPPID~iRE~~vmSl~~~lG~~~n~l~~~~~~~ 93 (287) T PF04898_consen 32 MGDDTPLAVLSEKPQNLFDYFKQLFA------------------QVTNPPIDPIREELVMSLRTYLGPRPNILEETPEHA 93 (287) T ss_dssp S---S--CCC-SS---GGGCEEE----------------------SSS----TTTTGGG-B--EEES--S-TTS-SGGGC T ss_pred CCCCChhHhhcCCCCcHHHHHHHhhh------------------hccCCCcchhhhhheeecceeeCCCCCCCCCCCCCc Confidence 99999999999999999999999999 999999999999999999999999999999999999 Q ss_pred ceEEcCCcccCHHHHHHHHhccCCCceeEEEEeeEeCC Q psy12795 81 HRLFLPNPLLSLYDLEVIRLNTHRGWKVMKVSLMADLT 118 (121) Q Consensus 81 ~rL~L~SPVLs~~~l~~i~~~~~~~~~~~~l~~~~~~~ 118 (121) ++|+|+||||+++|+++|++...++|++.+++++|++. T Consensus 94 ~~l~l~sPiL~~~~l~~l~~~~~~~~~~~~l~~~f~~~ 131 (287) T PF04898_consen 94 RRLELDSPILSNGQLEKLRSLDDPGFKAATLDATFPAE 131 (287) T ss_dssp -CEEESSSB--HHHHHHHHHH--CCCCEEEEESEEEST T ss_pred eEEEecCCEECHHHHHHHHHhhccCCCccEEEEEEECC Confidence 99999999999999999999877889999999999976 No 2 >KOG0399|consensus Probab=100.00 E-value=1.2e-38 Score=299.45 Aligned_cols=101 Identities=58% Similarity=1.024 Sum_probs=98.8 Q ss_pred CCCCcccccccCCCCchHHHHHHHhhhhcchhhhhhhccccccccccCCCCCCccccceeeeeeeecCCCcCCCCCCCCc Q psy12795 1 MGNDAPLACLSEFQPLLYDYFKQLFAQLLPVLLSVTTMYCSLSLQVTNPPIDPFREKVVMSLMCPIGPEANILEPSAKQC 80 (121) Q Consensus 1 MG~DtPLA~LS~~~~~L~dYFkQ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDpiRE~~VmSl~~~lG~~~nil~~~~~~~ 80 (121) ||||+||||||++|++|||||||+|| ||||||||||||.+||||.|+|||++|+||.++++| T Consensus 568 MGnDaplA~LS~~p~llydYFkQlFA------------------QVTNPpIDPiRE~iVmSLec~IGp~gNllE~~~eq~ 629 (2142) T KOG0399|consen 568 MGNDAPLACLSDRPHLLYDYFKQLFA------------------QVTNPPIDPIREAIVMSLECYIGPEGNLLEPGPEQC 629 (2142) T ss_pred cCCCcceehhcCCccHHHHHHHHHHH------------------hccCCCCChhhhhheEEEEeeecCCcCcccCChhHh Confidence 99999999999999999999999999 999999999999999999999999999999999999 Q ss_pred ceEEcCCcccCHHHHHHHHhccCCCceeEEEEeeEeCCC Q psy12795 81 HRLFLPNPLLSLYDLEVIRLNTHRGWKVMKVSLMADLTN 119 (121) Q Consensus 81 ~rL~L~SPVLs~~~l~~i~~~~~~~~~~~~l~~~~~~~~ 119 (121) +|+.|++|||+..||+.|+...+++||++.|+++|+..+ T Consensus 630 ~rl~L~~PvL~~~e~ealk~~~y~~wk~k~iditf~~~~ 668 (2142) T KOG0399|consen 630 SRLILKGPVLNEEEMEALKNDMYPGWKVKEIDITFDKSE 668 (2142) T ss_pred ceeeccCCcCCHHHHHHHhcCCCccceeeeeeeeeehhh Confidence 999999999999999999998899999999999999654 No 3 >PRK11750 gltB glutamate synthase subunit alpha; Provisional Probab=100.00 E-value=1.9e-38 Score=300.58 Aligned_cols=101 Identities=41% Similarity=0.658 Sum_probs=97.2 Q ss_pred CCCCcccccccCCCCchHHHHHHHhhhhcchhhhhhhccccccccccCCCCCCccccceeeeeeeecCCCcCCCCCCCCc Q psy12795 1 MGNDAPLACLSEFQPLLYDYFKQLFAQLLPVLLSVTTMYCSLSLQVTNPPIDPFREKVVMSLMCPIGPEANILEPSAKQC 80 (121) Q Consensus 1 MG~DtPLA~LS~~~~~L~dYFkQ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDpiRE~~VmSl~~~lG~~~nil~~~~~~~ 80 (121) ||+||||||||+++++|||||||+|| ||||||||||||++||||+|+||+++|+|++++++| T Consensus 489 MG~D~plAvLS~~~~~l~~yFkQ~FA------------------QVTNPPID~iRE~~vmSl~~~lG~~~n~l~~~~~~~ 550 (1485) T PRK11750 489 MGDDTPMAVLSSQPRSIYDYFRQQFA------------------QVTNPPIDPLREAHVMSLATCIGREMNVFCETEGHA 550 (1485) T ss_pred CCCCcchhhhcCCCccHHHHhhhcce------------------eccCCCCchhhhhceeeeeeeeCCCcCcCCCCcccC Confidence 99999999999999999999999999 999999999999999999999999999999999999 Q ss_pred ceEEcCCcccCHHHHHHHHhccCCCceeEEEEeeEeCCC Q psy12795 81 HRLFLPNPLLSLYDLEVIRLNTHRGWKVMKVSLMADLTN 119 (121) Q Consensus 81 ~rL~L~SPVLs~~~l~~i~~~~~~~~~~~~l~~~~~~~~ 119 (121) ++|+|+||||++.|+++|+.....+|++.+++++|++.+ T Consensus 551 ~~l~l~~PiL~~~~~~~l~~~~~~~~~~~~l~~~f~~~~ 589 (1485) T PRK11750 551 HRVIFKSPVLSYSDFKQLTTLDEEHYRADTLDLNYDPEE 589 (1485) T ss_pred CeEEeCCceeCHHHHHHHHhccccCCceEEEEEEEeCCh Confidence 999999999999999999987656799999999998743 No 4 >PF03672 UPF0154: Uncharacterised protein family (UPF0154); InterPro: IPR005359 The proteins in this entry are functionally uncharacterised. Probab=55.90 E-value=4.2 Score=27.76 Aligned_cols=22 Identities=36% Similarity=0.797 Sum_probs=15.8 Q ss_pred cCCCCCCccccceeeeeeeecCCCc Q psy12795 47 TNPPIDPFREKVVMSLMCPIGPEAN 71 (121) Q Consensus 47 TNPPIDpiRE~~VmSl~~~lG~~~n 71 (121) -||||+ |+-+-+++.-.|.++| T Consensus 28 ~NPpin---e~mir~M~~QMG~kpS 49 (64) T PF03672_consen 28 ENPPIN---EKMIRAMMMQMGRKPS 49 (64) T ss_pred HCCCCC---HHHHHHHHHHhCCCcc Confidence 599987 5666667777787543 No 5 >PRK00523 hypothetical protein; Provisional Probab=50.39 E-value=5.7 Score=27.79 Aligned_cols=21 Identities=29% Similarity=0.676 Sum_probs=15.5 Q ss_pred cCCCCCCccccceeeeeeeecCCC Q psy12795 47 TNPPIDPFREKVVMSLMCPIGPEA 70 (121) Q Consensus 47 TNPPIDpiRE~~VmSl~~~lG~~~ 70 (121) -||||+ |+.+-+.+.-.|.++ T Consensus 36 ~NPpin---e~mir~M~~QMGqKP 56 (72) T PRK00523 36 ENPPIT---ENMIRAMYMQMGRKP 56 (72) T ss_pred HCcCCC---HHHHHHHHHHhCCCc Confidence 599987 566666777778754 No 6 >PRK09545 znuA high-affinity zinc transporter periplasmic component; Reviewed Probab=47.48 E-value=2.9 Score=34.37 Aligned_cols=59 Identities=19% Similarity=0.241 Sum_probs=44.1 Q ss_pred HhhhhcchhhhhhhccccccccccCCCCCCccccce---eeeeeee--cCCCcCCCCCCCCcce Q psy12795 24 LFAQLLPVLLSVTTMYCSLSLQVTNPPIDPFREKVV---MSLMCPI--GPEANILEPSAKQCHR 82 (121) Q Consensus 24 ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDpiRE~~V---mSl~~~l--G~~~nil~~~~~~~~r 82 (121) +||.||..||.-++-|-.+.+-+|++||--|-+.++ ....+.+ |..+.-+++++++.++ T Consensus 7 ~~~~~~~~~~~~~~~~~~~~VvaS~~pl~~~v~~I~gd~~~V~~Lvp~g~dPH~yep~p~d~~~ 70 (311) T PRK09545 7 LFAALLAALLGGATQAANAAVVTSIKPLGFIASAIADGVTETEVLLPDGASPHDYSLRPSDVKR 70 (311) T ss_pred HHHHHHHhhcccccccccCcEEEEcHHHHHHHHHHcCCCceEEeccCCCCCCcCCCCCHHHHHH Confidence 688899999999999999999999999988766654 2334444 4455667888765433 No 7 >PRK01844 hypothetical protein; Provisional Probab=42.55 E-value=8.9 Score=26.82 Aligned_cols=21 Identities=33% Similarity=0.752 Sum_probs=15.2 Q ss_pred cCCCCCCccccceeeeeeeecCCC Q psy12795 47 TNPPIDPFREKVVMSLMCPIGPEA 70 (121) Q Consensus 47 TNPPIDpiRE~~VmSl~~~lG~~~ 70 (121) -||||+ |+.+-+.+.-.|.++ T Consensus 35 ~NPpin---e~mir~Mm~QMGqkP 55 (72) T PRK01844 35 KNPPIN---EQMLKMMMMQMGQKP 55 (72) T ss_pred HCCCCC---HHHHHHHHHHhCCCc Confidence 799987 566666677778754 No 8 >PF06440 DNA_pol3_theta: DNA polymerase III, theta subunit; InterPro: IPR009052 This entry represents the theta subunit of DNA polymerase III from bacteria, whose core structure consists of an irregular array of three helices []. DNA polymerase III (Pol III) is the primary enzyme responsible for replication of Escherichia coli chromosomal DNA. The holoenzyme consists of 17 proteins and contains two core polymerases. The Pol III catalytic core has three tightly associated subunits: alpha, epsilon and theta. The alpha subunit is responsible for the DNA polymerase activity, while the epsilon subunit is the 3'-5' proofreading exonuclease. The epsilon subunit binds to both the alpha and theta subunits in the linear order alpha-epsilon-theta. The theta subunit is the smallest, and may act to enhance the proofreading activity of epsilon, especially under extreme conditions []. This entry also includes a homologue of polymerase III theta called HOT (homologue of theta) from Bacteriophage P1. HOT contains three alpha-helices, as reported for theta, but the folding topology of the two is different, which could account for the suggested greater heat stability of HOT as compared to theta [].; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 1SE7_A 2IDO_D 2AE9_A 1DU2_A 2XY8_B 2AXD_S. Probab=39.44 E-value=18 Score=25.55 Aligned_cols=32 Identities=28% Similarity=0.523 Sum_probs=23.7 Q ss_pred cCCCCchHHHHHHHhhhhcchhhhhhhccccccccccCCCCCC Q psy12795 11 SEFQPLLYDYFKQLFAQLLPVLLSVTTMYCSLSLQVTNPPIDP 53 (121) Q Consensus 11 S~~~~~L~dYFkQ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDp 53 (121) -+.|..|-.||+++.. .|-..|.|..--|.+| T Consensus 42 reqPe~LR~YFreRL~-----------~YR~~s~~l~r~~yep 73 (75) T PF06440_consen 42 REQPEHLREYFRERLN-----------YYRQISKQLPRLPYEP 73 (75) T ss_dssp HCS-GGGHHHHHHHHH-----------HHHHHHCCSSTTTSS- T ss_pred HHCcHHHHHHHHHHHH-----------HHHHHHHhCCCCCCCC Confidence 4568899999999988 6777777777666665 No 9 >PF08763 Ca_chan_IQ: Voltage gated calcium channel IQ domain; InterPro: IPR014873 Ca2+ ions are unique in that they not only carry charge but they are also the most widely used of diffusible second messengers. Voltage-dependent Ca2+ channels (VDCC) are a family of molecules that allow cells to couple electrical activity to intracellular Ca2+ signalling. The opening and closing of these channels by depolarizing stimuli, such as action potentials, allows Ca2+ ions to enter neurons down a steep electrochemical gradient, producing transient intracellular Ca2+ signals. Many of the processes that occur in neurons, including transmitter release, gene transcription and metabolism are controlled by Ca2+ influx occurring simultaneously at different cellular locales. The pore is formed by the alpha-1 subunit which incorporates the conduction pore, the voltage sensor and gating apparatus, and the known sites of channel regulation by second messengers, drugs, and toxins []. The activity of this pore is modulated by 4 tightly-coupled subunits: an intracellular beta subunit; a transmembrane gamma subunit; and a disulphide-linked complex of alpha-2 and delta subunits, which are proteolytically cleaved from the same gene product. Properties of the protein including gating voltage-dependence, G protein modulation and kinase susceptibility can be influenced by these subunits. Voltage-gated calcium channels are classified as T, L, N, P, Q and R, and are distinguished by their sensitivity to pharmacological blocks, single-channel conductance kinetics, and voltage-dependence. On the basis of their voltage activation properties, the voltage-gated calcium classes can be further divided into two broad groups: the low (T-type) and high (L, N, P, Q and R-type) threshold-activated channels. The voltage-gated calcium channel alpha 1 subunit contains an IQ domain, named for its isoleucine-glutamine (IQ) motif, which interacts with hydrophobic pockets of Ca2+/calmodulin []. The interaction regulates two self-regulatory calcium dependent feedback mechanisms, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF). ; PDB: 3OXQ_F 2F3Z_B 3G43_E 2F3Y_B 2BE6_D 3DVM_B 3BXK_D 2VAY_B 3DVK_B 3BXL_B .... Probab=34.22 E-value=21 Score=21.88 Aligned_cols=11 Identities=45% Similarity=0.857 Sum_probs=8.5 Q ss_pred chHHHHHHHhh Q psy12795 16 LLYDYFKQLFA 26 (121) Q Consensus 16 ~L~dYFkQ~FA 26 (121) +++|||||.=+ T Consensus 14 lI~dyfr~~K~ 24 (35) T PF08763_consen 14 LIQDYFRQFKK 24 (35) T ss_dssp HHHHHHHHHHH T ss_pred HHHHHHHHHHH Confidence 58999998644 No 10 >PF01805 Surp: Surp module; InterPro: IPR000061 SWAP is derived from the Suppressor-of-White-APricot splicing regulator from Drosophila melanogaster. The domain is found in regulators responsible for pervasive, nonsex-specific alternative pre-mRNA splicing characteristics and has been found in splicing regulatory proteins []. These ancient, conserved SWAP proteins share a colinearly arrayed series of novel sequence motifs [].; GO: 0003723 RNA binding, 0006396 RNA processing; PDB: 2E5Z_A 2DT7_B 2DT6_A 1UG0_A 1X4P_A 2E60_A 1X4O_A 4DGW_B. Probab=33.95 E-value=60 Score=20.19 Aligned_cols=25 Identities=16% Similarity=0.210 Sum_probs=21.6 Q ss_pred CCCcccccccCCCCchHHHHHHHhh Q psy12795 2 GNDAPLACLSEFQPLLYDYFKQLFA 26 (121) Q Consensus 2 G~DtPLA~LS~~~~~L~dYFkQ~FA 26 (121) ++|.-++-|.+...+.+.||+++.+ T Consensus 28 ~~np~F~FL~~~~~~~~~yY~~~l~ 52 (55) T PF01805_consen 28 RNNPQFNFLFPSDSPYHAYYRWKLA 52 (55) T ss_dssp TTSGGGGGGSTTSSTHHHHHHHHHH T ss_pred CCCCCCcCcCCCCCCCchHHHHHHH Confidence 4678889999887889999999887 No 11 >PRK10969 DNA polymerase III subunit theta; Reviewed Probab=33.61 E-value=20 Score=25.31 Aligned_cols=31 Identities=26% Similarity=0.475 Sum_probs=24.8 Q ss_pred CCCCchHHHHHHHhhhhcchhhhhhhccccccccccCCCCCC Q psy12795 12 EFQPLLYDYFKQLFAQLLPVLLSVTTMYCSLSLQVTNPPIDP 53 (121) Q Consensus 12 ~~~~~L~dYFkQ~FA~~~~~~~~~~~~~~~~~~QVTNPPIDp 53 (121) +.|..+-+||+++.+ -|-.+|.|..-.|.|| T Consensus 43 eqPe~lR~yFreRL~-----------~yR~~s~~l~r~py~~ 73 (75) T PRK10969 43 EQPEHLRSYFRERLI-----------AYRLASVNLSRLPYEP 73 (75) T ss_pred hCCHHHHHHHHHHHH-----------HHHHHHhhcCCCCCCC Confidence 467889999999998 6777777777777765 No 12 >PF15601 Imm42: Immunity protein 42 Probab=26.47 E-value=50 Score=25.19 Aligned_cols=18 Identities=44% Similarity=0.580 Sum_probs=15.7 Q ss_pred ccCCCCchHHHH-----HHHhhh Q psy12795 10 LSEFQPLLYDYF-----KQLFAQ 27 (121) Q Consensus 10 LS~~~~~L~dYF-----kQ~FA~ 27 (121) +|.....|++|| +..|.- T Consensus 94 i~~~i~~L~~yFvt~dG~~~f~~ 116 (134) T PF15601_consen 94 ISPDITSLSDYFVTSDGKDLFEV 116 (134) T ss_pred CCCCCCcHHHHhcCcchhhHHHH Confidence 678889999999 999983 No 13 >PF02325 YGGT: YGGT family; InterPro: IPR003425 This family represents Ycf19. It is associated with phototrophic organisms and may therefore play a role in photosynthesis, despite its wider association with bacteria outside of the cyanobacteria. ; GO: 0016020 membrane Probab=25.60 E-value=7.4 Score=25.64 Aligned_cols=13 Identities=38% Similarity=0.848 Sum_probs=11.8 Q ss_pred cccCCCCCCcccc Q psy12795 45 QVTNPPIDPFREK 57 (121) Q Consensus 45 QVTNPPIDpiRE~ 57 (121) ++|+|.+.|+|-- T Consensus 35 ~~TeP~l~p~r~~ 47 (75) T PF02325_consen 35 RITEPILRPFRRI 47 (75) T ss_pred HHhhHHHHHHHHH Confidence 9999999999954 No 14 >PF13651 EcoRI_methylase: Adenine-specific methyltransferase EcoRI Probab=25.29 E-value=19 Score=31.41 Aligned_cols=15 Identities=60% Similarity=0.933 Sum_probs=13.0 Q ss_pred ccccCCCCCCccccc Q psy12795 44 LQVTNPPIDPFREKV 58 (121) Q Consensus 44 ~QVTNPPIDpiRE~~ 58 (121) +-|||||.--+||=+ T Consensus 138 IVVTNPPFSLFrEyv 152 (336) T PF13651_consen 138 IVVTNPPFSLFREYV 152 (336) T ss_pred EEEeCCCcHHHHHHH Confidence 479999999999963 No 15 >PF01353 GFP: Green fluorescent protein; InterPro: IPR011584 The green fluorescent protein (GFP) is found in the jellyfish (Aequorea victoria), and functions as an energy-transfer acceptor. It fluoresces in vivo upon receiving energy from the Ca2+-activated photoprotein aequorin. The protein absorbs light maximally at 395 nm and exhibits a smaller absorbance peak at 470 nm. The fluorescence emission spectrum peaks at 509 nm with a shoulder at 540 nm. The protein is produced in the photocytes and contains a chromophore, which is composed of modified amino acid residues. The chromophore is formed upon cyclization of the residues ser-dehydrotyr-gly. There are several other members of the GFP family, which are able to fluoresce different colours, sveral of which are non-fluorescent []. These proteins are all essentailly encoded by single genes, since both the substrate and the catalytic enzyme for pigment biosynthesis are provided within a single polypeptide chain []. More information about this protein can be found at Protein of the Month: Green Fluorescent Protein [].; GO: 0008218 bioluminescence; PDB: 2G16_B 1QYO_A 1W7S_B 3ED8_B 3GJ1_A 1GFL_B 3GJ2_C 2WSO_A 3DQD_A 2AWJ_A .... Probab=21.24 E-value=45 Score=27.26 Aligned_cols=18 Identities=39% Similarity=0.857 Sum_probs=14.8 Q ss_pred cccCCCCchHHHHHHHhh Q psy12795 9 CLSEFQPLLYDYFKQLFA 26 (121) Q Consensus 9 ~LS~~~~~L~dYFkQ~FA 26 (121) |.++.|..+-|||||.|- T Consensus 67 ~F~kYP~~i~dyFk~sfp 84 (219) T PF01353_consen 67 CFTKYPDGIPDYFKQSFP 84 (219) T ss_dssp TSSBECTTSG-HHHHTTT T ss_pred ehhcCcCCCccHHHHhCC Confidence 677889999999999985 Done!