Query         psy12797
Match_columns 66
No_of_seqs    138 out of 756
Neff          5.7 
Searched_HMMs 46136
Date          Fri Aug 16 19:51:40 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12797.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12797hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00713 GltS Glutamine amidotr  99.9 2.1E-23 4.5E-28  153.8   4.4   66    1-66    128-195 (413)
  2 PF00310 GATase_2:  Glutamine a  99.9 2.2E-22 4.8E-27  145.9   3.6   65    1-66    125-189 (361)
  3 PRK11750 gltB glutamate syntha  99.8 1.3E-21 2.9E-26  159.1   5.2   65    1-66    140-206 (1485)
  4 COG0067 GltB Glutamate synthas  99.8 6.4E-21 1.4E-25  139.2   3.4   61    1-66    136-196 (371)
  5 KOG0399|consensus               99.8 5.4E-20 1.2E-24  148.6   3.7   65    1-66    207-278 (2142)
  6 cd01907 GlxB Glutamine amidotr  91.9    0.08 1.7E-06   36.6   1.2   48   16-63     16-71  (249)
  7 PF00159 Hormone_3:  Pancreatic  34.4     5.6 0.00012   20.5  -1.4   12   54-65     13-24  (36)
  8 cd00126 PAH Pancreatic Hormone  33.2     7.5 0.00016   20.0  -1.1   12   54-65     13-24  (36)
  9 PF01701 PSI_PsaJ:  Photosystem  32.8      17 0.00038   18.9   0.3    9   57-65     28-36  (37)
 10 smart00309 PAH Pancreatic horm  31.7     8.2 0.00018   19.9  -1.1   13   53-65     12-24  (36)
 11 COG4905 Predicted membrane pro  28.7      17 0.00037   25.6  -0.2   21   37-57     22-42  (243)
 12 PRK02733 photosystem I reactio  26.1      23 0.00049   18.9   0.0    9   57-65     28-36  (42)
 13 COG4741 Predicted secreted end  26.0      28  0.0006   23.7   0.4   18   48-66     86-103 (175)
 14 CHL00105 psaJ photosystem I su  24.9      26 0.00057   18.6   0.1    9   57-65     28-36  (42)
 15 smart00531 TFIIE Transcription  24.2 1.3E+02  0.0029   19.0   3.4   33   14-46     75-108 (147)
 16 PRK06266 transcription initiat  20.8 1.7E+02  0.0037   19.4   3.4   29   14-42     93-122 (178)

No 1  
>cd00713 GltS Glutamine amidotransferases class-II (Gn-AT), glutamate synthase (GltS)-type. GltS is a homodimer that synthesizes L-glutamate from 2-oxoglutarate and L-glutamine, an important step in ammonia assimilation in bacteria, cyanobacteria and plants. The N-terminal glutaminase domain catalyzes the hydrolysis of glutamine to glutamic acid and ammonia, and has a fold similar to that of other glutamine amidotransferases such as glucosamine-fructose 6-phosphate synthase (GLMS or GFAT), glutamine phosphoribosylpyrophosphate (Prpp) amidotransferase (GPATase), asparagine synthetase B (AsnB), and beta lactam synthetase (beta-LS), as well as the Ntn hydrolase folds of the proteasomal alpha and beta subunits.
Probab=99.88  E-value=2.1e-23  Score=153.78  Aligned_cols=66  Identities=41%  Similarity=0.798  Sum_probs=56.9

Q ss_pred             CEEEEEcCC--CChHHHHHHHHHHHHHHhhhCCCCCCceEEeccCcchhhhhcccChhchhhhccCCC
Q psy12797          1 MRQVFLTGK--QDEEEFKRQIYVLRKVSTHKIPKPGQRFYICSLSNRIVVYKGQFTADQLWKYFTDLN   66 (66)
Q Consensus         1 i~Qvfv~~~--~~~~~fer~Ly~~Rk~~e~~~~~~~~~fYi~SLSs~tivYKGml~~~qL~~fy~DL~   66 (66)
                      |+|+||.++  .+..+|||+||++||++|+.+.....+|||||||++|||||||++|+||..||+||+
T Consensus       128 i~Q~fv~~~~~~~~~~~er~l~~~r~~~e~~~~~~~~~~yv~Sls~~~iVyKGm~~~~~v~~~Y~DL~  195 (413)
T cd00713         128 IEQVFVGAPSGDDGEAFERKLYLLRKRIEKAIRAADEDFYVCSLSSRTIVYKGMLLPEQLGQFYPDLQ  195 (413)
T ss_pred             EEEEEEecCCccCcchHHHHHHHHHHHHHHHHHhcCCCEEEEecccceEEEeccccHHHHHHhccccC
Confidence            799999754  234679999999999999976432246999999999999999999999999999985


No 2  
>PF00310 GATase_2:  Glutamine amidotransferases class-II;  InterPro: IPR000583 A large group of biosynthetic enzymes are able to catalyse the removal of the ammonia group from glutamine and then to transfer this group to a substrate to form a new carbon-nitrogen group. This catalytic activity is known as glutamine amidotransferase (GATase) (2.4.2 from EC) []. The GATase domain exists either as a separate polypeptidic subunit or as part of a larger polypeptide fused in different ways to a synthase domain. On the basis of sequence similarities two classes of GATase domains have been identified [, ], class-I (also known as trpG-type) and class-II (also known as purF-type). Enzymes containing Class-II GATase domains include amido phosphoribosyltransferase (glutamine phosphoribosylpyrophosphate amidotransferase) (2.4.2.14 from EC), which catalyses the first step in purine biosynthesis (gene purF in bacteria, ADE4 in yeast); glucosamine--fructose-6-phosphate aminotransferase (2.6.1.16 from EC), which catalyses the formation of glucosamine 6-phosphate from fructose 6-phosphate and glutamine (gene glmS in Escherichia coli, nodM in Rhizobium, GFA1 in yeast); and asparagine synthetase (glutamine-hydrolizing) (6.3.5.4 from EC), which is responsible for the synthesis of asparagine from aspartate and glutamine. A cysteine is present at the N-terminal extremity of the mature form of all these enzymes. This domain is found in a number of cysteine peptidases belonging to MEROPS peptidase family C44 and their non-peptidase homologs. ; GO: 0008152 metabolic process; PDB: 1OFE_A 1LLW_A 1OFD_A 1LLZ_A 1LM1_A 1GPH_1 1AO0_D 3OOJ_E 1JXA_C 2J6H_B ....
Probab=99.85  E-value=2.2e-22  Score=145.87  Aligned_cols=65  Identities=43%  Similarity=0.791  Sum_probs=55.6

Q ss_pred             CEEEEEcCCCChHHHHHHHHHHHHHHhhhCCCCCCceEEeccCcchhhhhcccChhchhhhccCCC
Q psy12797          1 MRQVFLTGKQDEEEFKRQIYVLRKVSTHKIPKPGQRFYICSLSNRIVVYKGQFTADQLWKYFTDLN   66 (66)
Q Consensus         1 i~Qvfv~~~~~~~~fer~Ly~~Rk~~e~~~~~~~~~fYi~SLSs~tivYKGml~~~qL~~fy~DL~   66 (66)
                      |+|+||..+..+.+||++||++||++|+.....+ .|||||||++|||||||++|+||.+||+||+
T Consensus       125 i~Q~fv~~~~~~~~~e~~l~~~rk~~e~~~~~~~-~~yv~SlS~~tivYKg~~~~~~l~~~y~Dl~  189 (361)
T PF00310_consen  125 IWQVFVAPPEGEEEFERRLYLIRKRIEKAIEEDD-AFYVCSLSSRTIVYKGMGTPEQLAEFYPDLQ  189 (361)
T ss_dssp             EEEEEEE-TT-HHHHHHHHHHHHHHHHHHHCCHT-TBEEEEEESSEEEEEECC-GGGHHHHCCGGG
T ss_pred             EEEEEEECCcchhhHHHHHHHHHHHHHHhhhhcC-CEEEEecCcchhhhhhccCHHHHHHHHHhhc
Confidence            6899998664478999999999999999875432 4999999999999999999999999999985


No 3  
>PRK11750 gltB glutamate synthase subunit alpha; Provisional
Probab=99.84  E-value=1.3e-21  Score=159.09  Aligned_cols=65  Identities=31%  Similarity=0.731  Sum_probs=56.2

Q ss_pred             CEEEEEcCC--CChHHHHHHHHHHHHHHhhhCCCCCCceEEeccCcchhhhhcccChhchhhhccCCC
Q psy12797          1 MRQVFLTGK--QDEEEFKRQIYVLRKVSTHKIPKPGQRFYICSLSNRIVVYKGQFTADQLWKYFTDLN   66 (66)
Q Consensus         1 i~Qvfv~~~--~~~~~fer~Ly~~Rk~~e~~~~~~~~~fYi~SLSs~tivYKGml~~~qL~~fy~DL~   66 (66)
                      |+|+||.++  .+..+|||+||++||++|+...+. .+|||||||++|||||||++|+||.+||+||+
T Consensus       140 i~Q~fv~~~~~~~~~~fer~Ly~~R~~~e~~~~~~-~~~Yi~SlS~rtiVYKGml~~~ql~~fY~DL~  206 (1485)
T PRK11750        140 IEQVFVNAPAGWRERDFERRLFIARRRIEKRLADD-KDFYVCSLSNLVIIYKGLMMPADLPRFYLDLA  206 (1485)
T ss_pred             EEEEEEccCCCCChhhHHHHHHHHHHHHHHhhccC-CCEEEEecCCCcceeEecccHHHHHHhhhhhC
Confidence            799999753  244579999999999999875332 36999999999999999999999999999995


No 4  
>COG0067 GltB Glutamate synthase domain 1 [Amino acid transport and metabolism]
Probab=99.82  E-value=6.4e-21  Score=139.24  Aligned_cols=61  Identities=34%  Similarity=0.737  Sum_probs=55.4

Q ss_pred             CEEEEEcCCCChHHHHHHHHHHHHHHhhhCCCCCCceEEeccCcchhhhhcccChhchhhhccCCC
Q psy12797          1 MRQVFLTGKQDEEEFKRQIYVLRKVSTHKIPKPGQRFYICSLSNRIVVYKGQFTADQLWKYFTDLN   66 (66)
Q Consensus         1 i~Qvfv~~~~~~~~fer~Ly~~Rk~~e~~~~~~~~~fYi~SLSs~tivYKGml~~~qL~~fy~DL~   66 (66)
                      |+|+||.  .+..+|||+||++||++|+++..   +|||||+|++|||||||++|+||.+||+||+
T Consensus       136 ~~qv~i~--~~~~~~e~~l~i~r~~~~~~~~~---~~yv~S~s~~t~VYKG~~~p~~V~~~y~dl~  196 (371)
T COG0067         136 IEQVFIG--ASGDDFERVLFIARKRIEKRIGA---DFYVCSLSSRTIVYKGVGLPEDVAEFYLDLD  196 (371)
T ss_pred             hheeEee--cCchhhhhhhhhhhhhhhhcccC---CEEEEecCCCeEEEecccCHHHHHHHHhhcc
Confidence            6899997  35678999999999999998754   6999999999999999999999999999985


No 5  
>KOG0399|consensus
Probab=99.79  E-value=5.4e-20  Score=148.56  Aligned_cols=65  Identities=46%  Similarity=0.901  Sum_probs=55.8

Q ss_pred             CEEEEEc-------CCCChHHHHHHHHHHHHHHhhhCCCCCCceEEeccCcchhhhhcccChhchhhhccCCC
Q psy12797          1 MRQVFLT-------GKQDEEEFKRQIYVLRKVSTHKIPKPGQRFYICSLSNRIVVYKGQFTADQLWKYFTDLN   66 (66)
Q Consensus         1 i~Qvfv~-------~~~~~~~fer~Ly~~Rk~~e~~~~~~~~~fYi~SLSs~tivYKGml~~~qL~~fy~DL~   66 (66)
                      |.|+|+-       +..+.++|||.||++||+++.++... .+|||||||++|||||||+.|+||..||+||+
T Consensus       207 i~Qv~l~p~~~~~~ae~~~~~fer~ly~lRk~~~~~i~~~-~e~YvcSLsn~TIVYKGql~~~ql~~yY~DL~  278 (2142)
T KOG0399|consen  207 ILQVFLFPTYDAIYAEFDTDKFERSLYLLRKQASLQIGKE-KEFYVCSLSNQTIVYKGQLRPEQLYNYYPDLT  278 (2142)
T ss_pred             hhhhccccchhcccccccHHHHHHHHHHHHHHHHHhhhhc-ceEEEEeccCceEEEecccCHHHHhhhccccc
Confidence            5788652       11356889999999999999987654 47999999999999999999999999999996


No 6  
>cd01907 GlxB Glutamine amidotransferases class-II (Gn-AT)_GlxB-type.  GlxB is a glutamine amidotransferase-like protein of unknown function found in bacteria and archaea. GlxB has a structural fold similar to that of other class II glutamine amidotransferases including glucosamine-fructose 6-phosphate synthase (GLMS or GFAT), glutamine phosphoribosylpyrophosphate (Prpp) amidotransferase (GPATase),  asparagine synthetase B (AsnB), beta lactam synthetase (beta-LS) and glutamate synthase (GltS).   The GlxB fold is also somewhat similar to the Ntn (N-terminal nucleophile) hydrolase fold of the proteasomal alpha and beta subunits.
Probab=91.94  E-value=0.08  Score=36.61  Aligned_cols=48  Identities=13%  Similarity=0.233  Sum_probs=36.9

Q ss_pred             HHHHHHHHHHHhhhCC-CC-C------CceEEeccCcchhhhhcccChhchhhhcc
Q psy12797         16 KRQIYVLRKVSTHKIP-KP-G------QRFYICSLSNRIVVYKGQFTADQLWKYFT   63 (66)
Q Consensus        16 er~Ly~~Rk~~e~~~~-~~-~------~~fYi~SLSs~tivYKGml~~~qL~~fy~   63 (66)
                      ...++..-..++++-. +. +      .++|+.|+|+++.+|||+..+.++.++|.
T Consensus        16 ~~~~~~~l~~lqhRG~~dsaGia~~~~~~~~~~s~~~~~~~~K~~G~~~~v~~~~~   71 (249)
T cd01907          16 GALLVEMLDAMQERGPGDGAGFALYGDPDAFVYSSGKDMEVFKGVGYPEDIARRYD   71 (249)
T ss_pred             HHHHHHHHHHHHhcCCCCCceEEEEcCCCeEEEecCCCeEEEeeccCHHHHHhhcC
Confidence            3456666677787765 32 2      24688899999999999999999999885


No 7  
>PF00159 Hormone_3:  Pancreatic hormone peptide;  InterPro: IPR001955 Pancreatic hormone (PP) [] is a peptide synthesized in pancreatic islets of Langherhans, which acts as a regulator of pancreatic and gastrointestinal functions. The hormone is produced as a larger propeptide, which is enzymatically cleaved to yield the mature active peptide: this is 36 amino acids in length [] and has an amidated C terminus []. The hormone has a globular structure, residues 2-8 forming a left-handed poly-proline-II-like helix, residues 9-13 a beta turn, and 14-32 an alpha-helix,held close to the first helix by hydrophobic interactions []. Unlike glucagon, another peptide hormone, the structure of pancreatic peptide is preserved in aqueous solution []. Both N and C termini are required for activity: receptor binding and activation functions may reside in the N and C termini respectively []. Pancreatic hormone is part of a wider family of active peptides that includes:  Neuropeptide Y (NPY) [], one of the most abundant peptides in the mammalian nervous system. NPY is implicated in the control of feeding and the secretion of the gonadotrophin-releasing hormone. Peptide YY (PYY) []. PPY is a gut peptide that inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibits jejunal and colonic mobility. Various NPY and PYY-like polypeptides from fish and amphibians [, ]. Neuropeptide F (NPF) from invertebrates such as worms and snail. Skin peptide Tyr-Tyr (SPYY) from the frog Phyllomedusa bicolor. SPYY shows a large spectra of antibacterial and antifungal activity.  All these peptides are 36 to 39 amino acids long. Like most active peptides, their C-terminal is amidated and they are synthesized as larger protein precursors.; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 1LJV_A 1BBA_A 1V1D_A 1PPT_A 2H3T_A 2H4B_A 2BF9_A 2H3S_B 1K8V_A 2DF0_A ....
Probab=34.42  E-value=5.6  Score=20.49  Aligned_cols=12  Identities=25%  Similarity=0.703  Sum_probs=9.7

Q ss_pred             ChhchhhhccCC
Q psy12797         54 TADQLWKYFTDL   65 (66)
Q Consensus        54 ~~~qL~~fy~DL   65 (66)
                      ++++|.+|+.+|
T Consensus        13 speel~~Y~~~L   24 (36)
T PF00159_consen   13 SPEELAQYYAAL   24 (36)
T ss_dssp             SHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHH
Confidence            578888888776


No 8  
>cd00126 PAH Pancreatic Hormone domain, a regulator of pancreatic and gastrointestinal functions; neuropeptide Y (NPY)b, peptide YY (PYY), and pancreatic polypetide (PP) are closely related; propeptide is enzymatically cleaved to yield the mature active peptide with amidated C-terminal ends; receptor binding and activation functions may reside in the N- and C-termini respectively; occurs in neurons, intestinal endocrine cells, and pancreas; exist as monomers and dimers
Probab=33.17  E-value=7.5  Score=20.04  Aligned_cols=12  Identities=25%  Similarity=0.673  Sum_probs=9.6

Q ss_pred             ChhchhhhccCC
Q psy12797         54 TADQLWKYFTDL   65 (66)
Q Consensus        54 ~~~qL~~fy~DL   65 (66)
                      +++||.+||.+|
T Consensus        13 ~~eel~~Y~~~L   24 (36)
T cd00126          13 SPEELRQYLAAL   24 (36)
T ss_pred             CHHHHHHHHHHH
Confidence            478899988776


No 9  
>PF01701 PSI_PsaJ:  Photosystem I reaction centre subunit IX / PsaJ;  InterPro: IPR002615 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. This family consists of the photosystem I reaction centre subunit IX or PsaJ from various organisms including Synechocystis sp. (strain PCC 6803), Pinus thunbergii (Green pine) and Zea mays (Maize). PsaJ (P19443 from SWISSPROT) is a small 4.4kDa, chloroplast encoded, hydrophobic subunit of the photosystem I reaction complex whose function is not yet fully understood []. PsaJ can be cross-linked to PsaF (P12356 from SWISSPROT) and has a single predicted transmembrane domain. It has a proposed role in maintaing PsaF in the correct orientation to allow for fast electron transfer from soluble donor proteins to P700+ [].; GO: 0015979 photosynthesis, 0009522 photosystem I; PDB: 2WSF_J 2WSC_J 2O01_J 2WSE_J 1JB0_J 3PCQ_J 3LW5_J.
Probab=32.78  E-value=17  Score=18.85  Aligned_cols=9  Identities=33%  Similarity=0.907  Sum_probs=6.3

Q ss_pred             chhhhccCC
Q psy12797         57 QLWKYFTDL   65 (66)
Q Consensus        57 qL~~fy~DL   65 (66)
                      ++-+||||+
T Consensus        28 EiNRffPD~   36 (37)
T PF01701_consen   28 EINRFFPDL   36 (37)
T ss_dssp             SSTTTSTS-
T ss_pred             HHHHhCCCc
Confidence            567899986


No 10 
>smart00309 PAH Pancreatic hormones / neuropeptide F / peptide YY family. Pancreatic hormone is a regulator of pancreatic and gastrointestinal functions.
Probab=31.75  E-value=8.2  Score=19.92  Aligned_cols=13  Identities=23%  Similarity=0.542  Sum_probs=9.9

Q ss_pred             cChhchhhhccCC
Q psy12797         53 FTADQLWKYFTDL   65 (66)
Q Consensus        53 l~~~qL~~fy~DL   65 (66)
                      -+|+||.+||.+|
T Consensus        12 a~~e~l~~Y~~~L   24 (36)
T smart00309       12 ASPEDLRQYLAAL   24 (36)
T ss_pred             CCHHHHHHHHHHH
Confidence            3678888888776


No 11 
>COG4905 Predicted membrane protein [Function unknown]
Probab=28.66  E-value=17  Score=25.61  Aligned_cols=21  Identities=24%  Similarity=0.504  Sum_probs=18.1

Q ss_pred             eEEeccCcchhhhhcccChhc
Q psy12797         37 FYICSLSNRIVVYKGQFTADQ   57 (66)
Q Consensus        37 fYi~SLSs~tivYKGml~~~q   57 (66)
                      ...||.|.|.+||.|-+++.-
T Consensus        22 t~fcS~~dkk~V~RGFL~Gpy   42 (243)
T COG4905          22 TIFCSVNDKKIVNRGFLTGPY   42 (243)
T ss_pred             HhheeeccceeEeecccccCC
Confidence            467999999999999988753


No 12 
>PRK02733 photosystem I reaction center subunit IX; Provisional
Probab=26.14  E-value=23  Score=18.90  Aligned_cols=9  Identities=33%  Similarity=0.877  Sum_probs=6.3

Q ss_pred             chhhhccCC
Q psy12797         57 QLWKYFTDL   65 (66)
Q Consensus        57 qL~~fy~DL   65 (66)
                      ++-+||||+
T Consensus        28 EiNRffPD~   36 (42)
T PRK02733         28 EFNRFFPDL   36 (42)
T ss_pred             HHHHhCchH
Confidence            456788885


No 13 
>COG4741 Predicted secreted endonuclease distantly related to archaeal Holliday junction resolvase [Nucleotide transport and metabolism]
Probab=26.05  E-value=28  Score=23.65  Aligned_cols=18  Identities=28%  Similarity=0.599  Sum_probs=13.0

Q ss_pred             hhhcccChhchhhhccCCC
Q psy12797         48 VYKGQFTADQLWKYFTDLN   66 (66)
Q Consensus        48 vYKGml~~~qL~~fy~DL~   66 (66)
                      |--|.+ ++||.+|||++.
T Consensus        86 Vi~GrV-tEqlaPffp~f~  103 (175)
T COG4741          86 VILGRV-TEQLAPFFPEFK  103 (175)
T ss_pred             HHhhhh-HhhhcccccCCC
Confidence            334554 689999999863


No 14 
>CHL00105 psaJ photosystem I subunit IX
Probab=24.93  E-value=26  Score=18.65  Aligned_cols=9  Identities=22%  Similarity=0.715  Sum_probs=6.3

Q ss_pred             chhhhccCC
Q psy12797         57 QLWKYFTDL   65 (66)
Q Consensus        57 qL~~fy~DL   65 (66)
                      ++-+||||+
T Consensus        28 EiNRffPD~   36 (42)
T CHL00105         28 EINRFFPDA   36 (42)
T ss_pred             HHHHhCChh
Confidence            456788885


No 15 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=24.20  E-value=1.3e+02  Score=18.99  Aligned_cols=33  Identities=18%  Similarity=0.309  Sum_probs=22.2

Q ss_pred             HHHHHHHHHHHHHhhhCCCC-CCceEEeccCcch
Q psy12797         14 EFKRQIYVLRKVSTHKIPKP-GQRFYICSLSNRI   46 (66)
Q Consensus        14 ~fer~Ly~~Rk~~e~~~~~~-~~~fYi~SLSs~t   46 (66)
                      ....++..+++.++..+... +..+|+|---.++
T Consensus        75 vik~r~~~~~~~L~~~l~~e~~~~~Y~Cp~C~~~  108 (147)
T smart00531       75 VVKYKLDKMRKRLEDKLEDETNNAYYKCPNCQSK  108 (147)
T ss_pred             HHHHHHHHHHHHHHHHHhcccCCcEEECcCCCCE
Confidence            46678888888888766432 3469999644433


No 16 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=20.79  E-value=1.7e+02  Score=19.42  Aligned_cols=29  Identities=14%  Similarity=0.258  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHhhhCCCC-CCceEEecc
Q psy12797         14 EFKRQIYVLRKVSTHKIPKP-GQRFYICSL   42 (66)
Q Consensus        14 ~fer~Ly~~Rk~~e~~~~~~-~~~fYi~SL   42 (66)
                      ....++..+.+.++..+... +..||+|--
T Consensus        93 ~ik~~~~~~~~klk~~l~~e~~~~~Y~Cp~  122 (178)
T PRK06266         93 IIKKKKMEELKKLKEQLEEEENNMFFFCPN  122 (178)
T ss_pred             HHHHHHHHHHHHHHHHhhhccCCCEEECCC
Confidence            46667777777777766432 346999954


Done!