BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy12811
         (74 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3T5O|A Chain A, Crystal Structure Of Human Complement Component C6
 pdb|4A5W|B Chain B, Crystal Structure Of C5b6
 pdb|4E0S|B Chain B, Crystal Structure Of C5b-6
          Length = 913

 Score = 26.2 bits (56), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 9/39 (23%), Positives = 22/39 (56%)

Query: 36  KVDYGHEEVKVKHNHDPREFCIFELRFPFEECSPYETWC 74
           ++++G E  ++  N   +E C ++  + +E+CS   + C
Sbjct: 821 QLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKC 859


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.142    0.487 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,517,830
Number of Sequences: 62578
Number of extensions: 86856
Number of successful extensions: 110
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 109
Number of HSP's gapped (non-prelim): 1
length of query: 74
length of database: 14,973,337
effective HSP length: 44
effective length of query: 30
effective length of database: 12,219,905
effective search space: 366597150
effective search space used: 366597150
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)