Diaphorina citri psyllid: psy12813


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MSSKDVIKKETGKEAEVVLKDFKEDNQSWIGRAEQIAALRDKVKLKCVNSGLGSFSVALYLLEPHTCRYILGVESSMICKLLPYADEYGLFKDVPANL
cccHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHHcccccEEEEEEEccccccEEEEEEEccccEEEEEEEccccccccccccccccccccccccc
***************EVVLKDFKEDNQSWIGRAEQIAALRDKVKLKCVNSGLGSFSVALYLLEPHTCRYILGVESSMICKLLPYADEYGLFKDVP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSKDVIKKETGKEAEVVLKDFKEDNQSWIGRAEQIAALRDKVKLKCVNSGLGSFSVALYLLEPHTCRYILGVESSMICKLLPYADEYGLFKDVPANL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Endoplasmic reticulum lectin 1 Probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins.confidentQ28IT1
Endoplasmic reticulum lectin 1 Probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins.confidentQ8VEH8
Endoplasmic reticulum lectin 1 Probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins.confidentQ5R8S4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001948 [MF]glycoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005788 [CC]endoplasmic reticulum lumenprobableGO:0005737, GO:0005575, GO:0005783, GO:0043233, GO:0044464, GO:0043229, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0005623, GO:0044424, GO:0044432, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030433 [BP]ER-associated protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AIH, chain A
Confidence level:confident
Coverage over the Query: 3-80
View the alignment between query and template
View the model in PyMOL