BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy12830
         (94 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MWF|A Chain A, Crystal Structure Of Staphylococcus Aureus Sira Complexed
           With Staphyloferrin B
          Length = 298

 Score = 28.1 bits (61), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 5/47 (10%)

Query: 1   MPYANQPSVHITDLTDENVKFQVEDTELSKRTNGNWKENMEWKGLSA 47
           +P  N   + +   +D N K    D  L K+T   W  + EWK L A
Sbjct: 215 IPLMNADHIFVVK-SDPNAK----DAALVKKTESEWTSSKEWKNLDA 256


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.132    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,867,477
Number of Sequences: 62578
Number of extensions: 95137
Number of successful extensions: 150
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 148
Number of HSP's gapped (non-prelim): 2
length of query: 94
length of database: 14,973,337
effective HSP length: 61
effective length of query: 33
effective length of database: 11,156,079
effective search space: 368150607
effective search space used: 368150607
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)