Diaphorina citri psyllid: psy1283


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MAGTPQSLTMKLYQAVIADVINNVKEAFQEEGVDEQVLQELKHIWEAKLFGIGVGKLSKRKEWMSKCYRSSNISGRPSLSGNLKARLVYQPCLTQPVELLSICAADHELQAIRKPLVSYQKLM
cccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHHHHHccccHHcccc
********TMKLYQAVIADVINNVKEAFQEEGVDEQVLQELKHIWEAKLFGIGVGKLSKRKEWMSKCYRSSNI*****LSGNLKARLVYQPCLTQPVELLSICAADHELQAIRKPLV*YQKLM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGTPQSLTMKLYQAVIADVINNVKEAFQEEGVDEQVLQELKHIWEAKLFGIGVGKLSKRKEWMSKCYRSSNISGRPSLSGNLKARLVYQPCLTQPVELLSICAADHELQAIRKPLVSYQKLM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription initiation factor IIA subunit 1 TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.confidentP52654

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RM1, chain C
Confidence level:very confident
Coverage over the Query: 5-62
View the alignment between query and template
View the model in PyMOL