Query         psy12841
Match_columns 88
No_of_seqs    44 out of 46
Neff          2.7 
Searched_HMMs 46136
Date          Fri Aug 16 21:10:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12841.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12841hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4698|consensus               99.4 1.1E-13 2.5E-18  115.2   4.7   80    3-87    178-258 (475)
  2 PF04577 DUF563:  Protein of un  94.5   0.097 2.1E-06   35.8   4.7   72    6-84      1-74  (206)
  3 cd01893 Miro1 Miro1 subfamily.  61.7      17 0.00036   24.0   3.8   34   14-47     16-59  (166)
  4 COG2917 Intracellular septatio  49.8      11 0.00024   29.0   1.6   21    7-35    125-145 (180)
  5 PRK01904 hypothetical protein;  47.5      22 0.00048   26.6   2.9   54   25-80     72-134 (219)
  6 KOG0293|consensus               47.3      13 0.00028   32.5   1.9   50   32-84    331-383 (519)
  7 PRK15382 non-LEE encoded effec  47.2       6 0.00013   32.7  -0.1   10    7-16    299-308 (326)
  8 KOG0318|consensus               42.1      14 0.00029   33.0   1.2   38   36-74     82-120 (603)
  9 cd04101 RabL4 RabL4 (Rab-like4  41.5      27 0.00058   22.5   2.3   27   32-59     49-75  (164)
 10 cd01861 Rab6 Rab6 subfamily.    40.6      55  0.0012   20.8   3.6   26   34-60     48-73  (161)
 11 cd04138 H_N_K_Ras_like H-Ras/N  40.1      70  0.0015   20.1   4.0   24   35-59     49-72  (162)
 12 cd04144 Ras2 Ras2 subfamily.    39.2      53  0.0011   22.4   3.6   20   34-54     46-65  (190)
 13 PTZ00099 rab6; Provisional      39.0      22 0.00048   24.8   1.7   22   34-56     28-49  (176)
 14 PF12132 DUF3587:  Protein of u  38.4      12 0.00025   28.7   0.3    6    7-12    163-168 (199)
 15 PRK15384 type III secretion sy  38.3      10 0.00022   31.4  -0.1   10    7-16    304-313 (336)
 16 cd01871 Rac1_like Rac1-like su  38.2      28 0.00061   23.6   2.1   22   34-56     48-69  (174)
 17 cd04168 TetM_like Tet(M)-like   38.0      36 0.00079   25.1   2.8   26   33-58     62-87  (237)
 18 PRK15383 type III secretion sy  37.4      11 0.00023   31.3  -0.1   10    7-16    307-316 (335)
 19 cd01890 LepA LepA subfamily.    36.7      40 0.00088   22.0   2.6   21   33-54     65-85  (179)
 20 PF12368 DUF3650:  Protein of u  36.2      18 0.00039   20.3   0.8   10   16-26      8-17  (28)
 21 cd04150 Arf1_5_like Arf1-Arf5-  36.1      40 0.00086   22.3   2.5   24   33-57     42-65  (159)
 22 cd04106 Rab23_lke Rab23-like s  35.7      37 0.00081   21.7   2.3   27   32-59     48-74  (162)
 23 PF09829 DUF2057:  Uncharacteri  34.9      35 0.00076   24.3   2.3   51   28-79     53-111 (189)
 24 PRK04517 hypothetical protein;  33.8      49  0.0011   24.8   3.0   55   24-80     73-136 (216)
 25 cd04122 Rab14 Rab14 subfamily.  33.8      41 0.00088   22.0   2.3   23   34-57     50-72  (166)
 26 KOG1087|consensus               33.3      15 0.00032   31.4   0.1   14    2-17     18-31  (470)
 27 cd04119 RJL RJL (RabJ-Like) su  32.3      47   0.001   21.0   2.3   27   33-60     47-73  (168)
 28 cd04169 RF3 RF3 subfamily.  Pe  32.3      41 0.00089   25.4   2.3   25   33-57     69-93  (267)
 29 cd01863 Rab18 Rab18 subfamily.  32.0      45 0.00097   21.3   2.2   24   34-58     48-71  (161)
 30 cd04124 RabL2 RabL2 subfamily.  31.2      47   0.001   21.8   2.2   27   33-60     47-73  (161)
 31 PTZ00133 ADP-ribosylation fact  30.4      60  0.0013   22.3   2.8   26   33-59     59-84  (182)
 32 cd04109 Rab28 Rab28 subfamily.  29.9      54  0.0012   23.0   2.5   25   34-59     49-73  (215)
 33 TIGR00231 small_GTP small GTP-  29.6      51  0.0011   19.8   2.0   25   35-60     50-74  (161)
 34 COG3221 PhnD ABC-type phosphat  29.6      26 0.00056   27.7   0.9   31   43-77    122-152 (299)
 35 PF09730 BicD:  Microtubule-ass  29.2      18  0.0004   32.4   0.0    9    5-13    457-465 (717)
 36 cd04132 Rho4_like Rho4-like su  29.0      64  0.0014   21.5   2.6   22   34-56     48-69  (187)
 37 PLN00223 ADP-ribosylation fact  28.2      61  0.0013   22.3   2.5   25   34-59     60-84  (181)
 38 cd04152 Arl4_Arl7 Arl4/Arl7 su  27.9      71  0.0015   21.7   2.7   26   33-59     50-75  (183)
 39 cd04126 Rab20 Rab20 subfamily.  27.6      97  0.0021   22.8   3.6   22   34-56     43-64  (220)
 40 cd04127 Rab27A Rab27a subfamil  27.1      65  0.0014   21.2   2.3   26   33-59     61-86  (180)
 41 cd01889 SelB_euk SelB subfamil  26.8      52  0.0011   22.5   1.9   23   34-56     67-89  (192)
 42 smart00094 TR_FER Transferrin.  26.7      26 0.00057   28.0   0.5   19   59-77     96-114 (332)
 43 cd04136 Rap_like Rap-like subf  26.6      65  0.0014   20.5   2.2   22   34-56     48-69  (163)
 44 cd04149 Arf6 Arf6 subfamily.    26.6      71  0.0015   21.5   2.5   23   33-56     51-73  (168)
 45 smart00177 ARF ARF-like small   26.2      85  0.0018   21.1   2.9   26   33-59     55-80  (175)
 46 cd01865 Rab3 Rab3 subfamily.    26.0      60  0.0013   21.2   2.0   26   34-60     49-74  (165)
 47 cd01885 EF2 EF2 (for archaea a  25.7      75  0.0016   23.6   2.7   27   34-60     72-98  (222)
 48 COG3466 ISA1214 Putative trans  25.4      30 0.00066   22.0   0.5   10   65-74     38-47  (52)
 49 cd04108 Rab36_Rab34 Rab34/Rab3  24.8      83  0.0018   21.2   2.6   10   35-44     49-58  (170)
 50 cd04151 Arl1 Arl1 subfamily.    24.4      83  0.0018   20.3   2.5   26   33-59     41-66  (158)
 51 PLN03118 Rab family protein; P  24.4      80  0.0017   21.9   2.5   25   34-59     61-85  (211)
 52 TIGR00503 prfC peptide chain r  24.3      64  0.0014   27.2   2.4   27   33-59     78-104 (527)
 53 cd01897 NOG NOG1 is a nucleola  24.3      65  0.0014   20.7   1.9   13   34-46     46-58  (168)
 54 cd04110 Rab35 Rab35 subfamily.  23.9 1.5E+02  0.0032   20.5   3.8   25   35-60     55-79  (199)
 55 cd04107 Rab32_Rab38 Rab38/Rab3  23.4      94   0.002   21.3   2.7   27   33-60     48-74  (201)
 56 cd04157 Arl6 Arl6 subfamily.    23.4   1E+02  0.0022   19.5   2.7   26   33-59     43-68  (162)
 57 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  22.1      94   0.002   20.1   2.4   24   34-58     50-73  (166)
 58 cd00878 Arf_Arl Arf (ADP-ribos  22.0 1.1E+02  0.0023   19.6   2.6   25   34-59     42-66  (158)
 59 cd01888 eIF2_gamma eIF2-gamma   21.8      65  0.0014   22.6   1.7   23   35-57     83-105 (203)
 60 cd04112 Rab26 Rab26 subfamily.  21.3      87  0.0019   21.3   2.2   23   34-57     49-71  (191)
 61 PF12911 OppC_N:  N-terminal TM  21.2      55  0.0012   18.8   1.0   16   47-62      3-18  (56)
 62 cd01870 RhoA_like RhoA-like su  21.2      65  0.0014   21.0   1.5   12   33-44     47-58  (175)
 63 cd04120 Rab12 Rab12 subfamily.  21.1      95  0.0021   22.3   2.4   24   34-58     48-71  (202)
 64 smart00175 RAB Rab subfamily o  20.9      93   0.002   19.7   2.1   24   34-58     48-71  (164)
 65 smart00062 PBPb Bacterial peri  20.9      54  0.0012   20.4   1.0   19   58-76     95-113 (219)
 66 cd00154 Rab Rab family.  Rab G  20.6      98  0.0021   18.9   2.1   26   33-59     47-72  (159)
 67 cd04176 Rap2 Rap2 subgroup.  T  20.4      88  0.0019   20.1   2.0   22   34-56     48-69  (163)
 68 cd04175 Rap1 Rap1 subgroup.  T  20.4      96  0.0021   20.0   2.1   22   34-56     48-69  (164)
 69 cd04123 Rab21 Rab21 subfamily.  20.4      86  0.0019   19.6   1.9   24   33-57     47-70  (162)
 70 PF12974 Phosphonate-bd:  ABC t  20.2      40 0.00086   23.9   0.3   21   58-78     94-114 (243)

No 1  
>KOG4698|consensus
Probab=99.43  E-value=1.1e-13  Score=115.17  Aligned_cols=80  Identities=23%  Similarity=0.339  Sum_probs=72.4

Q ss_pred             ccccchhhhhhhhHhHhhhhhcCCCCCCcCCceeEEEeeccc-cCcchHHHHhhhhcCCcccccccCCceeeeccccccc
Q psy12841          3 SAVNMYHHFCDFFNLYASQHVNASHPDVFSTDVHIMIWESYT-YASAFADTFKAFTRHPVWDLKTFTGLTVCFKNLVLPL   81 (88)
Q Consensus         3 a~vNMYHHFCDF~NLY~S~HvN~S~~~~F~~Dv~Iv~Wdt~~-Y~d~F~~tw~aFt~~~~~~L~~~~gKrVCFk~a~f~l   81 (88)
                      .++||||||||++   +.+-+|.++ ..|++|+++++|++.. |...|+|.-++|+++| +-..+=+++++||++|+.+|
T Consensus       178 ~tgn~yhdf~d~~---ipL~it~~~-~~~n~ev~~li~~~~~ww~~kf~Dvv~~lSn~~-~v~~~~~~~ThcF~~~~vgL  252 (475)
T KOG4698|consen  178 YTGNEYHDFNDGI---IPLFITEAE-LRFNKEVQFLITETHSWWDMKFGDVVRQLSNYP-VVDFDAELRTHCFKEAIVGL  252 (475)
T ss_pred             cchhhHHHHHhhh---hhhhcccch-hcccccEEEEEEEcchhhhhhHHHHHHhcCCCc-eEEecCCceEEEeeeeeeee
Confidence            4689999999999   777778776 6699999999999977 7779999999999999 66778899999999999999


Q ss_pred             cccccc
Q psy12841         82 LPRMIY   87 (88)
Q Consensus        82 LpRm~~   87 (88)
                      ++++.|
T Consensus       253 ~~h~~y  258 (475)
T KOG4698|consen  253 VSHFPY  258 (475)
T ss_pred             eecccc
Confidence            999986


No 2  
>PF04577 DUF563:  Protein of unknown function (DUF563);  InterPro: IPR007657 This is a family of uncharacterised glycosyltransferases belonging to glycosyltransferase family 61. Sequences are further processed into a mature form.; GO: 0016757 transferase activity, transferring glycosyl groups
Probab=94.47  E-value=0.097  Score=35.78  Aligned_cols=72  Identities=19%  Similarity=0.265  Sum_probs=47.5

Q ss_pred             cch-hhhhhhhHhHhhhhhcCCCCCCcCCceeEEEeeccccC-cchHHHHhhhhcCCcccccccCCceeeeccccccccc
Q psy12841          6 NMY-HHFCDFFNLYASQHVNASHPDVFSTDVHIMIWESYTYA-SAFADTFKAFTRHPVWDLKTFTGLTVCFKNLVLPLLP   83 (88)
Q Consensus         6 NMY-HHFCDF~NLY~S~HvN~S~~~~F~~Dv~Iv~Wdt~~Y~-d~F~~tw~aFt~~~~~~L~~~~gKrVCFk~a~f~lLp   83 (88)
                      |.| |-.+|++-++.++...+.    .++ ..|++ ...... ....+.|+++.- +.-.+.--.++.+||+++++|..+
T Consensus         1 ~~~gH~l~d~l~~l~~~~~~~~----~~~-~~~l~-~~~~~~~~~~~~~l~~lg~-~~~~i~~~~~~~~~~~~l~~~~~~   73 (206)
T PF04577_consen    1 NNFGHFLIDFLPRLWYLPQYIP----DSD-IIILV-PDDFDNPPFIREILELLGI-PENRIKIDSDEPVCFERLIVPSPP   73 (206)
T ss_pred             CCCcEEHHHHHHHHHHHHHHCC----CCC-eEEEE-cCCccccHHHHHHHHHcCC-CccEEEEcCCCeEEECEEEEeCCC
Confidence            445 888999999988886666    333 23332 222222 345689998877 555553335599999999988765


Q ss_pred             c
Q psy12841         84 R   84 (88)
Q Consensus        84 R   84 (88)
                      .
T Consensus        74 ~   74 (206)
T PF04577_consen   74 Y   74 (206)
T ss_pred             c
Confidence            5


No 3  
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=61.71  E-value=17  Score=24.02  Aligned_cols=34  Identities=15%  Similarity=0.146  Sum_probs=21.0

Q ss_pred             hhHhHhhhhhcCCCCC----------CcCCceeEEEeeccccCc
Q psy12841         14 FFNLYASQHVNASHPD----------VFSTDVHIMIWESYTYAS   47 (88)
Q Consensus        14 F~NLY~S~HvN~S~~~----------~F~~Dv~Iv~Wdt~~Y~d   47 (88)
                      ++|+++..+..+..|.          ..+.++++.+|||.+...
T Consensus        16 l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~Dt~G~~~   59 (166)
T cd01893          16 LIMSLVSEEFPENVPRVLPEITIPADVTPERVPTTIVDTSSRPQ   59 (166)
T ss_pred             HHHHHHhCcCCccCCCcccceEeeeeecCCeEEEEEEeCCCchh
Confidence            5666666665444332          233567888999966544


No 4  
>COG2917 Intracellular septation protein A [Cell division and chromosome partitioning]
Probab=49.82  E-value=11  Score=29.00  Aligned_cols=21  Identities=38%  Similarity=0.823  Sum_probs=17.5

Q ss_pred             chhhhhhhhHhHhhhhhcCCCCCCcCCce
Q psy12841          7 MYHHFCDFFNLYASQHVNASHPDVFSTDV   35 (88)
Q Consensus         7 MYHHFCDF~NLY~S~HvN~S~~~~F~~Dv   35 (88)
                      +|-=||-.+|+|++.|        ||+|+
T Consensus       125 ~FFlf~ai~N~yV~~~--------fs~d~  145 (180)
T COG2917         125 LFFLFCAIANEYVARN--------FSTDT  145 (180)
T ss_pred             HHHHHHHHHHHHHHHh--------CCCCe
Confidence            3456899999999998        88885


No 5  
>PRK01904 hypothetical protein; Provisional
Probab=47.49  E-value=22  Score=26.63  Aligned_cols=54  Identities=20%  Similarity=0.326  Sum_probs=40.0

Q ss_pred             CCCCCCcCCceeEEEeecc---------ccCcchHHHHhhhhcCCcccccccCCceeeecccccc
Q psy12841         25 ASHPDVFSTDVHIMIWESY---------TYASAFADTFKAFTRHPVWDLKTFTGLTVCFKNLVLP   80 (88)
Q Consensus        25 ~S~~~~F~~Dv~Iv~Wdt~---------~Y~d~F~~tw~aFt~~~~~~L~~~~gKrVCFk~a~f~   80 (88)
                      |+....|..|.-|+-.|+.         .+.+  ..-=++|.+.|.+.|++=+||.|-++.-.++
T Consensus        72 ~~~~~~~~S~p~IvtF~a~~~~l~l~~P~~~~--~~~a~~F~~~P~~~L~d~~g~~V~~~qd~L~  134 (219)
T PRK01904         72 GSDRSLFESDPIIVTFQGTTEDIVISAPKLTN--ERDIDKFKKSPNITVKTASGKEISTKQDYLK  134 (219)
T ss_pred             CCCccEEeCCCEEEEEecCCeEEEEEcCCCCC--HHHHHHHhhCCcEEEEeCCCCEEEEEEEeec
Confidence            4445568999999988872         2333  2333599999999999999999998865543


No 6  
>KOG0293|consensus
Probab=47.26  E-value=13  Score=32.48  Aligned_cols=50  Identities=24%  Similarity=0.349  Sum_probs=35.4

Q ss_pred             CCceeEEEeeccccCcchHHHHhhhhcCCccccc-ccCCceee--ecccccccccc
Q psy12841         32 STDVHIMIWESYTYASAFADTFKAFTRHPVWDLK-TFTGLTVC--FKNLVLPLLPR   84 (88)
Q Consensus        32 ~~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~~~~~L~-~~~gKrVC--Fk~a~f~lLpR   84 (88)
                      ++|-+|++||+-+-.   -..|+--..--+.+|+ ++|||.|=  +.+-...++||
T Consensus       331 s~dr~i~~wdlDgn~---~~~W~gvr~~~v~dlait~Dgk~vl~v~~d~~i~l~~~  383 (519)
T KOG0293|consen  331 SPDRTIIMWDLDGNI---LGNWEGVRDPKVHDLAITYDGKYVLLVTVDKKIRLYNR  383 (519)
T ss_pred             CCCCcEEEecCCcch---hhcccccccceeEEEEEcCCCcEEEEEecccceeeech
Confidence            478999999995543   5678877776788886 99999863  24444444444


No 7  
>PRK15382 non-LEE encoded effector protein NleB; Provisional
Probab=47.16  E-value=6  Score=32.65  Aligned_cols=10  Identities=60%  Similarity=1.494  Sum_probs=8.5

Q ss_pred             chhhhhhhhH
Q psy12841          7 MYHHFCDFFN   16 (88)
Q Consensus         7 MYHHFCDF~N   16 (88)
                      -|-|||||+-
T Consensus       299 dYn~FCdFIE  308 (326)
T PRK15382        299 NYNHFCDFIE  308 (326)
T ss_pred             chhhhcccee
Confidence            4889999985


No 8  
>KOG0318|consensus
Probab=42.08  E-value=14  Score=32.98  Aligned_cols=38  Identities=16%  Similarity=0.476  Sum_probs=30.0

Q ss_pred             eEEEeeccccCcchHHHHhhhhcCCccccc-ccCCceeee
Q psy12841         36 HIMIWESYTYASAFADTFKAFTRHPVWDLK-TFTGLTVCF   74 (88)
Q Consensus        36 ~Iv~Wdt~~Y~d~F~~tw~aFt~~~~~~L~-~~~gKrVCF   74 (88)
                      +|.+|||..=.-.-+-.+++|. -|+-+|. +++|||.|-
T Consensus        82 ~vRIWdtt~~~hiLKnef~v~a-G~I~Di~Wd~ds~RI~a  120 (603)
T KOG0318|consen   82 KVRIWDTTQKEHILKNEFQVLA-GPIKDISWDFDSKRIAA  120 (603)
T ss_pred             cEEEEeccCcceeeeeeeeecc-cccccceeCCCCcEEEE
Confidence            5888999665557777788886 5788886 999999984


No 9  
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=41.48  E-value=27  Score=22.46  Aligned_cols=27  Identities=15%  Similarity=0.343  Sum_probs=17.9

Q ss_pred             CCceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         32 STDVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        32 ~~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      +..+++.+|||.+- ..|..+++.+-+.
T Consensus        49 ~~~~~l~i~Dt~G~-~~~~~~~~~~~~~   75 (164)
T cd04101          49 DNTVELFIFDSAGQ-ELYSDMVSNYWES   75 (164)
T ss_pred             CCEEEEEEEECCCH-HHHHHHHHHHhCC
Confidence            34588999999653 4556666666543


No 10 
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=40.58  E-value=55  Score=20.84  Aligned_cols=26  Identities=15%  Similarity=0.516  Sum_probs=17.0

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhcCC
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTRHP   60 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~~   60 (88)
                      ++++.+|||.+ ...|...|+.+-++-
T Consensus        48 ~~~l~~~D~~G-~~~~~~~~~~~~~~~   73 (161)
T cd01861          48 TVRLQLWDTAG-QERFRSLIPSYIRDS   73 (161)
T ss_pred             EEEEEEEECCC-cHHHHHHHHHHhccC
Confidence            46788999965 234566677665443


No 11 
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=40.15  E-value=70  Score=20.06  Aligned_cols=24  Identities=8%  Similarity=0.167  Sum_probs=14.2

Q ss_pred             eeEEEeeccccCcchHHHHhhhhcC
Q psy12841         35 VHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        35 v~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      +.+-+|||.+= +-|+..|..+-+.
T Consensus        49 ~~~~i~Dt~G~-~~~~~l~~~~~~~   72 (162)
T cd04138          49 CLLDILDTAGQ-EEYSAMRDQYMRT   72 (162)
T ss_pred             EEEEEEECCCC-cchHHHHHHHHhc
Confidence            34567999652 3466666655443


No 12 
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=39.18  E-value=53  Score=22.39  Aligned_cols=20  Identities=0%  Similarity=0.036  Sum_probs=11.6

Q ss_pred             ceeEEEeeccccCcchHHHHh
Q psy12841         34 DVHIMIWESYTYASAFADTFK   54 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~   54 (88)
                      .+.+.+|||.|= +.|...|+
T Consensus        46 ~~~l~i~Dt~G~-~~~~~~~~   65 (190)
T cd04144          46 PCMLEVLDTAGQ-EEYTALRD   65 (190)
T ss_pred             EEEEEEEECCCc-hhhHHHHH
Confidence            456788999552 23444444


No 13 
>PTZ00099 rab6; Provisional
Probab=39.02  E-value=22  Score=24.80  Aligned_cols=22  Identities=14%  Similarity=0.499  Sum_probs=13.6

Q ss_pred             ceeEEEeeccccCcchHHHHhhh
Q psy12841         34 DVHIMIWESYTYASAFADTFKAF   56 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aF   56 (88)
                      +++|.+|||.|-. .|...|..|
T Consensus        28 ~v~l~iwDt~G~e-~~~~~~~~~   49 (176)
T PTZ00099         28 PVRLQLWDTAGQE-RFRSLIPSY   49 (176)
T ss_pred             EEEEEEEECCChH-HhhhccHHH
Confidence            5888899996532 344444444


No 14 
>PF12132 DUF3587:  Protein of unknown function (DUF3587);  InterPro: IPR021982 This entry is represented by Hyposoter fugitivus ichnovirus, Gp7; it is a family of uncharacterised viral proteins.
Probab=38.45  E-value=12  Score=28.74  Aligned_cols=6  Identities=50%  Similarity=1.796  Sum_probs=5.1

Q ss_pred             chhhhh
Q psy12841          7 MYHHFC   12 (88)
Q Consensus         7 MYHHFC   12 (88)
                      =+||||
T Consensus       163 HfHHyC  168 (199)
T PF12132_consen  163 HFHHYC  168 (199)
T ss_pred             CcChhh
Confidence            489999


No 15 
>PRK15384 type III secretion system protein; Provisional
Probab=38.26  E-value=10  Score=31.43  Aligned_cols=10  Identities=50%  Similarity=1.261  Sum_probs=8.4

Q ss_pred             chhhhhhhhH
Q psy12841          7 MYHHFCDFFN   16 (88)
Q Consensus         7 MYHHFCDF~N   16 (88)
                      =|-|||||+-
T Consensus       304 dYn~FCdFIE  313 (336)
T PRK15384        304 DYNSFCDFIE  313 (336)
T ss_pred             chhhhcccee
Confidence            4889999985


No 16 
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=38.17  E-value=28  Score=23.64  Aligned_cols=22  Identities=9%  Similarity=0.247  Sum_probs=12.5

Q ss_pred             ceeEEEeeccccCcchHHHHhhh
Q psy12841         34 DVHIMIWESYTYASAFADTFKAF   56 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aF   56 (88)
                      ++++.+|||.+ .+.|...|+.+
T Consensus        48 ~~~l~i~Dt~G-~~~~~~~~~~~   69 (174)
T cd01871          48 PVNLGLWDTAG-QEDYDRLRPLS   69 (174)
T ss_pred             EEEEEEEECCC-chhhhhhhhhh
Confidence            46788899954 13344444443


No 17 
>cd04168 TetM_like Tet(M)-like subfamily.  Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria.  Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site.  This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative.  Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G.  EF-G and Tet(M) compete for binding on the ribosomes.  Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind.  Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity.  These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.
Probab=37.96  E-value=36  Score=25.14  Aligned_cols=26  Identities=8%  Similarity=0.129  Sum_probs=20.8

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhc
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTR   58 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~   58 (88)
                      .+.+|.+|||-|+.+..+++.+++..
T Consensus        62 ~~~~i~liDTPG~~~f~~~~~~~l~~   87 (237)
T cd04168          62 EDTKVNLIDTPGHMDFIAEVERSLSV   87 (237)
T ss_pred             CCEEEEEEeCCCccchHHHHHHHHHH
Confidence            47789999999998877777777643


No 18 
>PRK15383 type III secretion system protein; Provisional
Probab=37.39  E-value=11  Score=31.31  Aligned_cols=10  Identities=50%  Similarity=1.215  Sum_probs=8.4

Q ss_pred             chhhhhhhhH
Q psy12841          7 MYHHFCDFFN   16 (88)
Q Consensus         7 MYHHFCDF~N   16 (88)
                      =|-|||||+-
T Consensus       307 dYn~FCdFIE  316 (335)
T PRK15383        307 DYDAFCDFIE  316 (335)
T ss_pred             chhhhcccee
Confidence            4889999985


No 19 
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=36.67  E-value=40  Score=22.02  Aligned_cols=21  Identities=5%  Similarity=0.083  Sum_probs=14.1

Q ss_pred             CceeEEEeeccccCcchHHHHh
Q psy12841         33 TDVHIMIWESYTYASAFADTFK   54 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~   54 (88)
                      .+++|.+|||-|..+ |...|+
T Consensus        65 ~~~~~~l~Dt~G~~~-~~~~~~   85 (179)
T cd01890          65 QEYLLNLIDTPGHVD-FSYEVS   85 (179)
T ss_pred             CcEEEEEEECCCChh-hHHHHH
Confidence            467888999976654 444444


No 20 
>PF12368 DUF3650:  Protein of unknown function (DUF3650) ;  InterPro: IPR022111  This domain family is found in bacteria, and is approximately 30 amino acids in length. The family is found in association with PF00581 from PFAM. There is a single completely conserved residue N that may be functionally important. 
Probab=36.25  E-value=18  Score=20.35  Aligned_cols=10  Identities=40%  Similarity=0.624  Sum_probs=8.4

Q ss_pred             HhHhhhhhcCC
Q psy12841         16 NLYASQHVNAS   26 (88)
Q Consensus        16 NLY~S~HvN~S   26 (88)
                      |||+..| |-|
T Consensus         8 NrYV~eh-~ls   17 (28)
T PF12368_consen    8 NRYVKEH-GLS   17 (28)
T ss_pred             hhhHHhc-CCC
Confidence            8999999 665


No 21 
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=36.07  E-value=40  Score=22.35  Aligned_cols=24  Identities=4%  Similarity=0.333  Sum_probs=16.7

Q ss_pred             CceeEEEeeccccCcchHHHHhhhh
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFT   57 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt   57 (88)
                      .++++.+|||.+-. .|...|+.+-
T Consensus        42 ~~~~~~l~D~~G~~-~~~~~~~~~~   65 (159)
T cd04150          42 KNISFTVWDVGGQD-KIRPLWRHYF   65 (159)
T ss_pred             CCEEEEEEECCCCH-hHHHHHHHHh
Confidence            46889999996643 4666777653


No 22 
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=35.69  E-value=37  Score=21.65  Aligned_cols=27  Identities=30%  Similarity=0.597  Sum_probs=17.5

Q ss_pred             CCceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         32 STDVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        32 ~~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      +..+.+.+|||.+- +.|...|+.+-+.
T Consensus        48 ~~~~~~~i~D~~G~-~~~~~~~~~~~~~   74 (162)
T cd04106          48 DEDVRLMLWDTAGQ-EEFDAITKAYYRG   74 (162)
T ss_pred             CCEEEEEEeeCCch-HHHHHhHHHHhcC
Confidence            34578899999663 3466666665443


No 23 
>PF09829 DUF2057:  Uncharacterized protein conserved in bacteria (DUF2057);  InterPro: IPR018635 The proteins in this entry are functionally uncharacterised.
Probab=34.88  E-value=35  Score=24.34  Aligned_cols=51  Identities=22%  Similarity=0.327  Sum_probs=39.8

Q ss_pred             CCCcCCceeEEEeeccccCc--------chHHHHhhhhcCCcccccccCCceeeeccccc
Q psy12841         28 PDVFSTDVHIMIWESYTYAS--------AFADTFKAFTRHPVWDLKTFTGLTVCFKNLVL   79 (88)
Q Consensus        28 ~~~F~~Dv~Iv~Wdt~~Y~d--------~F~~tw~aFt~~~~~~L~~~~gKrVCFk~a~f   79 (88)
                      ...|..+.-|+-.|... .+        .=...-++|.+.|.+.|.|=.|+.|=++-..+
T Consensus        53 ~~~~~S~p~i~~f~~~~-~~~~l~~p~~~~~~~a~~F~~~P~~~l~d~~g~~i~~~~~~L  111 (189)
T PF09829_consen   53 HEKVKSDPYIVTFDASD-QDLTLSLPKIRSEQQAKAFAKNPQFTLTDSNGNPIPFKQDKL  111 (189)
T ss_pred             eeEEEeCCEEEEEEcCC-cEEEEEcCCCCCHHHHHHHHhCCcEEEEeCCCCEEEEEeeee
Confidence            35588888998888844 32        11456677999999999999999999987665


No 24 
>PRK04517 hypothetical protein; Provisional
Probab=33.82  E-value=49  Score=24.79  Aligned_cols=55  Identities=18%  Similarity=0.236  Sum_probs=40.6

Q ss_pred             cCCCCCCcCCceeEEEeecc---------ccCcchHHHHhhhhcCCcccccccCCceeeecccccc
Q psy12841         24 NASHPDVFSTDVHIMIWESY---------TYASAFADTFKAFTRHPVWDLKTFTGLTVCFKNLVLP   80 (88)
Q Consensus        24 N~S~~~~F~~Dv~Iv~Wdt~---------~Y~d~F~~tw~aFt~~~~~~L~~~~gKrVCFk~a~f~   80 (88)
                      .|+....|..|..|+-.|+.         .+.+  ..-=++|.+.|.+.|.|=.||.|=++.-+++
T Consensus        73 ~~~~~~~~~S~p~IvtF~a~~~~~~l~~P~~~~--~~~a~~f~~~p~~~L~d~~g~~I~~~qd~L~  136 (216)
T PRK04517         73 QGNDRIIVESDVIIATFDAANTELTFDMPKYRD--ARQAEKAIKTMQWQLVDEQGKAVEVRQDKLI  136 (216)
T ss_pred             cCCCceEEECCCEEEEEecCCcEEEEECCCCCC--HHHHHHHHhCCcEEEEcCCCCEEEEEEEEec
Confidence            34444669999999988872         2322  2344778899999999999999999876654


No 25 
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=33.75  E-value=41  Score=21.97  Aligned_cols=23  Identities=13%  Similarity=0.514  Sum_probs=14.5

Q ss_pred             ceeEEEeeccccCcchHHHHhhhh
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFT   57 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt   57 (88)
                      ++++.+|||.+ .+.|...|+.+-
T Consensus        50 ~~~l~i~Dt~G-~~~~~~~~~~~~   72 (166)
T cd04122          50 KIKLQIWDTAG-QERFRAVTRSYY   72 (166)
T ss_pred             EEEEEEEECCC-cHHHHHHHHHHh
Confidence            56788999955 234555555543


No 26 
>KOG1087|consensus
Probab=33.35  E-value=15  Score=31.38  Aligned_cols=14  Identities=36%  Similarity=0.641  Sum_probs=9.8

Q ss_pred             cccccchhhhhhhhHh
Q psy12841          2 VSAVNMYHHFCDFFNL   17 (88)
Q Consensus         2 da~vNMYHHFCDF~NL   17 (88)
                      |+|+||  ++||.+|.
T Consensus        18 DWa~Nl--eIcD~IN~   31 (470)
T KOG1087|consen   18 DWALNL--EICDLINS   31 (470)
T ss_pred             cHHHHH--HHHHHHhc
Confidence            566776  77887773


No 27 
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=32.29  E-value=47  Score=20.97  Aligned_cols=27  Identities=7%  Similarity=0.255  Sum_probs=18.1

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcCC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRHP   60 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~~   60 (88)
                      .++++.+|||.+.. .|...++.+-+..
T Consensus        47 ~~~~l~i~Dt~G~~-~~~~~~~~~~~~~   73 (168)
T cd04119          47 KEVRVNFFDLSGHP-EYLEVRNEFYKDT   73 (168)
T ss_pred             eEEEEEEEECCccH-HHHHHHHHHhccC
Confidence            46788899996653 4666777665443


No 28 
>cd04169 RF3 RF3 subfamily.  Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria.  Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide.  The class II release factor RF3 then initiates the release of the class I RF from the ribosome.  RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state.  GDP/GTP exchange occurs, followed by the release of the class I RF.  Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome.  RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts.
Probab=32.29  E-value=41  Score=25.44  Aligned_cols=25  Identities=20%  Similarity=0.264  Sum_probs=20.5

Q ss_pred             CceeEEEeeccccCcchHHHHhhhh
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFT   57 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt   57 (88)
                      .+..|.+|||.|+.+.-+++|+++.
T Consensus        69 ~~~~i~liDTPG~~df~~~~~~~l~   93 (267)
T cd04169          69 RDCVINLLDTPGHEDFSEDTYRTLT   93 (267)
T ss_pred             CCEEEEEEECCCchHHHHHHHHHHH
Confidence            4788999999998887778888864


No 29 
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=32.03  E-value=45  Score=21.34  Aligned_cols=24  Identities=21%  Similarity=0.495  Sum_probs=15.6

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhc
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTR   58 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~   58 (88)
                      .+++.+|||.+- +.|...++++-+
T Consensus        48 ~~~~~l~D~~g~-~~~~~~~~~~~~   71 (161)
T cd01863          48 KVKLAIWDTAGQ-ERFRTLTSSYYR   71 (161)
T ss_pred             EEEEEEEECCCc-hhhhhhhHHHhC
Confidence            478899999663 345555665543


No 30 
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=31.25  E-value=47  Score=21.81  Aligned_cols=27  Identities=7%  Similarity=0.333  Sum_probs=17.6

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcCC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRHP   60 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~~   60 (88)
                      ..++|-+|||.+- +.|...|+.+-++-
T Consensus        47 ~~~~~~i~Dt~G~-~~~~~~~~~~~~~~   73 (161)
T cd04124          47 KTILVDFWDTAGQ-ERFQTMHASYYHKA   73 (161)
T ss_pred             EEEEEEEEeCCCc-hhhhhhhHHHhCCC
Confidence            3567888999664 35666777655443


No 31 
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=30.43  E-value=60  Score=22.25  Aligned_cols=26  Identities=4%  Similarity=0.355  Sum_probs=18.2

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      .++.+.+|||.+- +.|...|+.+-+.
T Consensus        59 ~~~~~~l~D~~G~-~~~~~~~~~~~~~   84 (182)
T PTZ00133         59 KNLKFTMWDVGGQ-DKLRPLWRHYYQN   84 (182)
T ss_pred             CCEEEEEEECCCC-HhHHHHHHHHhcC
Confidence            4688999999663 3567777776443


No 32 
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=29.90  E-value=54  Score=23.03  Aligned_cols=25  Identities=12%  Similarity=0.248  Sum_probs=17.5

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      .+.+.+|||.+- +.|...|+.|-+.
T Consensus        49 ~~~~~i~Dt~G~-~~~~~l~~~~~~~   73 (215)
T cd04109          49 NVTLQVWDIGGQ-SIGGKMLDKYIYG   73 (215)
T ss_pred             EEEEEEEECCCc-HHHHHHHHHHhhc
Confidence            577889999663 4567777777443


No 33 
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=29.62  E-value=51  Score=19.82  Aligned_cols=25  Identities=4%  Similarity=0.092  Sum_probs=16.1

Q ss_pred             eeEEEeeccccCcchHHHHhhhhcCC
Q psy12841         35 VHIMIWESYTYASAFADTFKAFTRHP   60 (88)
Q Consensus        35 v~Iv~Wdt~~Y~d~F~~tw~aFt~~~   60 (88)
                      .++.+|||.+. ..|...|+.+.+.-
T Consensus        50 ~~~~~~D~~G~-~~~~~~~~~~~~~~   74 (161)
T TIGR00231        50 YKFNLLDTAGQ-EDYRAIRRLYYRAV   74 (161)
T ss_pred             EEEEEEECCCc-ccchHHHHHHHhhh
Confidence            67889999773 34555666555443


No 34 
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=29.62  E-value=26  Score=27.68  Aligned_cols=31  Identities=19%  Similarity=0.288  Sum_probs=23.1

Q ss_pred             cccCcchHHHHhhhhcCCcccccccCCceeeeccc
Q psy12841         43 YTYASAFADTFKAFTRHPVWDLKTFTGLTVCFKNL   77 (88)
Q Consensus        43 ~~Y~d~F~~tw~aFt~~~~~~L~~~~gKrVCFk~a   77 (88)
                      .+|.+.|-    |=.+.|+-.|+|.+|||++|-+.
T Consensus       122 ~~Y~S~~i----~~~ds~i~sl~dlkgk~~af~d~  152 (299)
T COG3221         122 PGYYSVII----VRADSPIKSLEDLKGKRFAFGDP  152 (299)
T ss_pred             cceeEEEE----EeCCCCcchHHHhcCCeEeccCC
Confidence            34555442    34678899999999999999764


No 35 
>PF09730 BicD:  Microtubule-associated protein Bicaudal-D;  InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []. Glycogen synthase kinase-3beta (GSK-3beta) is required for the binding of BICD to dynein but not to dynactin, acting to maintain the anchoring of microtubules to the centromere []. It appears that amino-acid residues 437-617 of BicD and the kinase activity of GSK-3 are necessary for the formation of a complex between BicD and GSK-3beta in intact cells [].; GO: 0006810 transport, 0005794 Golgi apparatus
Probab=29.17  E-value=18  Score=32.44  Aligned_cols=9  Identities=44%  Similarity=1.184  Sum_probs=7.6

Q ss_pred             ccchhhhhh
Q psy12841          5 VNMYHHFCD   13 (88)
Q Consensus         5 vNMYHHFCD   13 (88)
                      -|+|||.|=
T Consensus       457 AqLYHHVC~  465 (717)
T PF09730_consen  457 AQLYHHVCM  465 (717)
T ss_pred             HHHHHHHHH
Confidence            379999995


No 36 
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=29.00  E-value=64  Score=21.47  Aligned_cols=22  Identities=5%  Similarity=0.208  Sum_probs=13.2

Q ss_pred             ceeEEEeeccccCcchHHHHhhh
Q psy12841         34 DVHIMIWESYTYASAFADTFKAF   56 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aF   56 (88)
                      .+.+.+|||.+- +.|...|+.+
T Consensus        48 ~~~l~i~Dt~G~-~~~~~~~~~~   69 (187)
T cd04132          48 IIELALWDTAGQ-EEYDRLRPLS   69 (187)
T ss_pred             EEEEEEEECCCc-hhHHHHHHHh
Confidence            567889999552 2344455444


No 37 
>PLN00223 ADP-ribosylation factor; Provisional
Probab=28.19  E-value=61  Score=22.29  Aligned_cols=25  Identities=4%  Similarity=0.365  Sum_probs=18.1

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      ++.+.+|||.+- +.|...|+.+-++
T Consensus        60 ~~~~~i~D~~Gq-~~~~~~~~~~~~~   84 (181)
T PLN00223         60 NISFTVWDVGGQ-DKIRPLWRHYFQN   84 (181)
T ss_pred             CEEEEEEECCCC-HHHHHHHHHHhcc
Confidence            577889999663 4677888876443


No 38 
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=27.87  E-value=71  Score=21.71  Aligned_cols=26  Identities=15%  Similarity=0.395  Sum_probs=18.5

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      ..+.+.+|||.+.. .|...|+.+-+.
T Consensus        50 ~~~~l~l~Dt~G~~-~~~~~~~~~~~~   75 (183)
T cd04152          50 KGITFHFWDVGGQE-KLRPLWKSYTRC   75 (183)
T ss_pred             CceEEEEEECCCcH-hHHHHHHHHhcc
Confidence            35778899997643 467888887543


No 39 
>cd04126 Rab20 Rab20 subfamily.  Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells.  It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells.  Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron.  It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=27.58  E-value=97  Score=22.76  Aligned_cols=22  Identities=18%  Similarity=0.359  Sum_probs=14.1

Q ss_pred             ceeEEEeeccccCcchHHHHhhh
Q psy12841         34 DVHIMIWESYTYASAFADTFKAF   56 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aF   56 (88)
                      .+++.+|||.+- ..|...|+.+
T Consensus        43 ~~~l~iwDt~G~-e~~~~l~~~~   64 (220)
T cd04126          43 PYNISIWDTAGR-EQFHGLGSMY   64 (220)
T ss_pred             EEEEEEEeCCCc-ccchhhHHHH
Confidence            567889999553 2455566554


No 40 
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=27.05  E-value=65  Score=21.15  Aligned_cols=26  Identities=23%  Similarity=0.542  Sum_probs=16.9

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      .++++-+|||.+= +-|...|+.+-++
T Consensus        61 ~~~~~~i~Dt~G~-~~~~~~~~~~~~~   86 (180)
T cd04127          61 QRIHLQLWDTAGQ-ERFRSLTTAFFRD   86 (180)
T ss_pred             CEEEEEEEeCCCh-HHHHHHHHHHhCC
Confidence            3577889999652 3466666665544


No 41 
>cd01889 SelB_euk SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner.  This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and euk
Probab=26.84  E-value=52  Score=22.48  Aligned_cols=23  Identities=13%  Similarity=0.096  Sum_probs=17.4

Q ss_pred             ceeEEEeeccccCcchHHHHhhh
Q psy12841         34 DVHIMIWESYTYASAFADTFKAF   56 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aF   56 (88)
                      ..++.+|||-|+.+..+..+++-
T Consensus        67 ~~~~~i~DtpG~~~~~~~~~~~~   89 (192)
T cd01889          67 NLQITLVDCPGHASLIRTIIGGA   89 (192)
T ss_pred             CceEEEEECCCcHHHHHHHHHHH
Confidence            67888999988877667666653


No 42 
>smart00094 TR_FER Transferrin.
Probab=26.73  E-value=26  Score=28.03  Aligned_cols=19  Identities=11%  Similarity=0.457  Sum_probs=15.9

Q ss_pred             CCcccccccCCceeeeccc
Q psy12841         59 HPVWDLKTFTGLTVCFKNL   77 (88)
Q Consensus        59 ~~~~~L~~~~gKrVCFk~a   77 (88)
                      -++..|.+.+|||+||-+.
T Consensus        96 S~i~sl~dLkGKksChtg~  114 (332)
T smart00094       96 SAIFTWNQLRGKKSCHTGV  114 (332)
T ss_pred             CCCCCHHHhCCCceecCCC
Confidence            3678899999999999764


No 43 
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=26.63  E-value=65  Score=20.47  Aligned_cols=22  Identities=9%  Similarity=0.163  Sum_probs=13.5

Q ss_pred             ceeEEEeeccccCcchHHHHhhh
Q psy12841         34 DVHIMIWESYTYASAFADTFKAF   56 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aF   56 (88)
                      .+.+.+|||.|- +.|...|+.+
T Consensus        48 ~~~l~i~Dt~G~-~~~~~~~~~~   69 (163)
T cd04136          48 QCMLEILDTAGT-EQFTAMRDLY   69 (163)
T ss_pred             EEEEEEEECCCc-cccchHHHHH
Confidence            356678999653 2355566554


No 44 
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=26.61  E-value=71  Score=21.47  Aligned_cols=23  Identities=9%  Similarity=0.372  Sum_probs=16.2

Q ss_pred             CceeEEEeeccccCcchHHHHhhh
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAF   56 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aF   56 (88)
                      +++.+.+|||.+-. -|...|+.+
T Consensus        51 ~~~~~~l~Dt~G~~-~~~~~~~~~   73 (168)
T cd04149          51 KNVKFNVWDVGGQD-KIRPLWRHY   73 (168)
T ss_pred             CCEEEEEEECCCCH-HHHHHHHHH
Confidence            46889999996543 356677665


No 45 
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=26.17  E-value=85  Score=21.14  Aligned_cols=26  Identities=4%  Similarity=0.335  Sum_probs=17.9

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      .++.+.+|||.+- +.|...|+.+-+.
T Consensus        55 ~~~~l~l~D~~G~-~~~~~~~~~~~~~   80 (175)
T smart00177       55 KNISFTVWDVGGQ-DKIRPLWRHYYTN   80 (175)
T ss_pred             CCEEEEEEECCCC-hhhHHHHHHHhCC
Confidence            3578899999664 3466778776443


No 46 
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=26.01  E-value=60  Score=21.23  Aligned_cols=26  Identities=19%  Similarity=0.431  Sum_probs=16.4

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhcCC
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTRHP   60 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~~   60 (88)
                      .+.+.+|||.+- +.|...|.++-+.-
T Consensus        49 ~~~~~l~Dt~g~-~~~~~~~~~~~~~~   74 (165)
T cd01865          49 RVKLQIWDTAGQ-ERYRTITTAYYRGA   74 (165)
T ss_pred             EEEEEEEECCCh-HHHHHHHHHHccCC
Confidence            477899999653 33555666655443


No 47 
>cd01885 EF2 EF2 (for archaea and eukarya).  Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome.  The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins.  Two major mechanisms are known to regulate protein elongation and both involve eEF2.  First, eEF2 can be modulated by reversible phosphorylation.  Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes.  Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2.  In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation.  Seco
Probab=25.66  E-value=75  Score=23.57  Aligned_cols=27  Identities=11%  Similarity=-0.026  Sum_probs=21.3

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhcCC
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTRHP   60 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~~   60 (88)
                      +.+|.+|||.|..+.-+++..++..=.
T Consensus        72 ~~~i~iiDTPG~~~f~~~~~~~l~~aD   98 (222)
T cd01885          72 EYLINLIDSPGHVDFSSEVTAALRLCD   98 (222)
T ss_pred             ceEEEEECCCCccccHHHHHHHHHhcC
Confidence            688999999998887778887775443


No 48 
>COG3466 ISA1214 Putative transposon-encoded protein [Function unknown]
Probab=25.39  E-value=30  Score=22.02  Aligned_cols=10  Identities=30%  Similarity=0.494  Sum_probs=9.1

Q ss_pred             cccCCceeee
Q psy12841         65 KTFTGLTVCF   74 (88)
Q Consensus        65 ~~~~gKrVCF   74 (88)
                      |+|-|||||.
T Consensus        38 K~yiG~rv~v   47 (52)
T COG3466          38 KRYIGKRVYV   47 (52)
T ss_pred             hHHcCcEEEE
Confidence            8999999995


No 49 
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=24.78  E-value=83  Score=21.17  Aligned_cols=10  Identities=10%  Similarity=0.654  Sum_probs=7.6

Q ss_pred             eeEEEeeccc
Q psy12841         35 VHIMIWESYT   44 (88)
Q Consensus        35 v~Iv~Wdt~~   44 (88)
                      +++.+|||.+
T Consensus        49 ~~l~i~Dt~G   58 (170)
T cd04108          49 FSLQLWDTAG   58 (170)
T ss_pred             EEEEEEeCCC
Confidence            4678899965


No 50 
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=24.43  E-value=83  Score=20.31  Aligned_cols=26  Identities=4%  Similarity=0.339  Sum_probs=17.5

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      .++.+.+|||.+-. .|...|+.+-+.
T Consensus        41 ~~~~~~i~Dt~G~~-~~~~~~~~~~~~   66 (158)
T cd04151          41 KNLKFQVWDLGGQT-SIRPYWRCYYSN   66 (158)
T ss_pred             CCEEEEEEECCCCH-HHHHHHHHHhcC
Confidence            46788999996643 366777765443


No 51 
>PLN03118 Rab family protein; Provisional
Probab=24.36  E-value=80  Score=21.94  Aligned_cols=25  Identities=16%  Similarity=0.461  Sum_probs=16.3

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      ++++.+|||.+- +.|...|+.+-+.
T Consensus        61 ~~~l~l~Dt~G~-~~~~~~~~~~~~~   85 (211)
T PLN03118         61 RLKLTIWDTAGQ-ERFRTLTSSYYRN   85 (211)
T ss_pred             EEEEEEEECCCc-hhhHHHHHHHHhc
Confidence            467889999664 3456666665443


No 52 
>TIGR00503 prfC peptide chain release factor 3. This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. More recently, RF-3 was shown to be active primarily at UGA stop codons in E. coli. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis PCC6803, and in Staphylococcus aureus.
Probab=24.30  E-value=64  Score=27.21  Aligned_cols=27  Identities=15%  Similarity=0.203  Sum_probs=21.9

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      .+.+|.+|||-|+.+.-+++|++...-
T Consensus        78 ~~~~inliDTPG~~df~~~~~~~l~~a  104 (527)
T TIGR00503        78 RDCLVNLLDTPGHEDFSEDTYRTLTAV  104 (527)
T ss_pred             CCeEEEEEECCChhhHHHHHHHHHHhC
Confidence            378899999998888778899987543


No 53 
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=24.26  E-value=65  Score=20.73  Aligned_cols=13  Identities=0%  Similarity=-0.077  Sum_probs=10.2

Q ss_pred             ceeEEEeeccccC
Q psy12841         34 DVHIMIWESYTYA   46 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~   46 (88)
                      ++.+.+|||.|..
T Consensus        46 ~~~~~i~Dt~G~~   58 (168)
T cd01897          46 YLRWQVIDTPGLL   58 (168)
T ss_pred             ceEEEEEECCCcC
Confidence            5788999997653


No 54 
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=23.95  E-value=1.5e+02  Score=20.49  Aligned_cols=25  Identities=20%  Similarity=0.470  Sum_probs=16.2

Q ss_pred             eeEEEeeccccCcchHHHHhhhhcCC
Q psy12841         35 VHIMIWESYTYASAFADTFKAFTRHP   60 (88)
Q Consensus        35 v~Iv~Wdt~~Y~d~F~~tw~aFt~~~   60 (88)
                      +.+.+|||.+ ...|+..|+.+-++.
T Consensus        55 ~~l~l~D~~G-~~~~~~~~~~~~~~a   79 (199)
T cd04110          55 VKLQIWDTAG-QERFRTITSTYYRGT   79 (199)
T ss_pred             EEEEEEeCCC-chhHHHHHHHHhCCC
Confidence            5678999955 234667776655543


No 55 
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=23.41  E-value=94  Score=21.35  Aligned_cols=27  Identities=19%  Similarity=0.400  Sum_probs=17.6

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcCC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRHP   60 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~~   60 (88)
                      ..+.+.+|||.+- +.|...|+.+-++-
T Consensus        48 ~~~~l~l~Dt~G~-~~~~~~~~~~~~~a   74 (201)
T cd04107          48 TVVRLQLWDIAGQ-ERFGGMTRVYYRGA   74 (201)
T ss_pred             CEEEEEEEECCCc-hhhhhhHHHHhCCC
Confidence            4677889999653 34666776655443


No 56 
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=23.40  E-value=1e+02  Score=19.55  Aligned_cols=26  Identities=0%  Similarity=0.220  Sum_probs=17.2

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      .++.+.+|||.+.. .|...|+.+-++
T Consensus        43 ~~~~~~l~Dt~G~~-~~~~~~~~~~~~   68 (162)
T cd04157          43 GNLSFTAFDMSGQG-KYRGLWEHYYKN   68 (162)
T ss_pred             CCEEEEEEECCCCH-hhHHHHHHHHcc
Confidence            46778899996644 366677765443


No 57 
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=22.09  E-value=94  Score=20.08  Aligned_cols=24  Identities=17%  Similarity=0.490  Sum_probs=15.9

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhc
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTR   58 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~   58 (88)
                      .+++-+|||.|- +.|...|+.+-+
T Consensus        50 ~~~~~i~D~~G~-~~~~~~~~~~~~   73 (166)
T cd01869          50 TIKLQIWDTAGQ-ERFRTITSSYYR   73 (166)
T ss_pred             EEEEEEEECCCc-HhHHHHHHHHhC
Confidence            457888999663 346667766544


No 58 
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=21.97  E-value=1.1e+02  Score=19.55  Aligned_cols=25  Identities=12%  Similarity=0.355  Sum_probs=16.9

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      ++.+.+|||.+.. .|...|+.+.+.
T Consensus        42 ~~~~~i~D~~G~~-~~~~~~~~~~~~   66 (158)
T cd00878          42 NVSFTVWDVGGQD-KIRPLWKHYYEN   66 (158)
T ss_pred             CEEEEEEECCCCh-hhHHHHHHHhcc
Confidence            5778899996643 456677766443


No 59 
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2).  eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits.  The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit.  Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome.  The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B.  eIF2B is a heteropentamer, and the epsilon chain binds eIF2.  Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma.  It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role.  eIF2-gamma is found only in eukaryotes and archaea.  It is closely related to SelB, the sel
Probab=21.79  E-value=65  Score=22.62  Aligned_cols=23  Identities=9%  Similarity=0.029  Sum_probs=17.5

Q ss_pred             eeEEEeeccccCcchHHHHhhhh
Q psy12841         35 VHIMIWESYTYASAFADTFKAFT   57 (88)
Q Consensus        35 v~Iv~Wdt~~Y~d~F~~tw~aFt   57 (88)
                      .+|.+|||-|+.++-++++.+..
T Consensus        83 ~~i~~iDtPG~~~~~~~~~~~~~  105 (203)
T cd01888          83 RHVSFVDCPGHEILMATMLSGAA  105 (203)
T ss_pred             cEEEEEECCChHHHHHHHHHhhh
Confidence            68899999888776666666653


No 60 
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=21.32  E-value=87  Score=21.33  Aligned_cols=23  Identities=22%  Similarity=0.518  Sum_probs=13.8

Q ss_pred             ceeEEEeeccccCcchHHHHhhhh
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFT   57 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt   57 (88)
                      .+++.+|||.+ .+.|...|+.+-
T Consensus        49 ~~~~~i~Dt~G-~~~~~~~~~~~~   71 (191)
T cd04112          49 KVKLQIWDTAG-QERFRSVTHAYY   71 (191)
T ss_pred             EEEEEEEeCCC-cHHHHHhhHHHc
Confidence            35788999955 234555555543


No 61 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=21.21  E-value=55  Score=18.76  Aligned_cols=16  Identities=25%  Similarity=0.563  Sum_probs=13.3

Q ss_pred             cchHHHHhhhhcCCcc
Q psy12841         47 SAFADTFKAFTRHPVW   62 (88)
Q Consensus        47 d~F~~tw~aFt~~~~~   62 (88)
                      +.+++.|+-|.+|+..
T Consensus         3 s~~~~~~~~f~~nk~a   18 (56)
T PF12911_consen    3 SPWKDAWRRFRRNKLA   18 (56)
T ss_pred             CHHHHHHHHHHhCchH
Confidence            5789999999998753


No 62 
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=21.20  E-value=65  Score=20.95  Aligned_cols=12  Identities=17%  Similarity=0.689  Sum_probs=9.3

Q ss_pred             CceeEEEeeccc
Q psy12841         33 TDVHIMIWESYT   44 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~   44 (88)
                      .++++.+|||.+
T Consensus        47 ~~~~l~i~Dt~G   58 (175)
T cd01870          47 KQVELALWDTAG   58 (175)
T ss_pred             EEEEEEEEeCCC
Confidence            457889999954


No 63 
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=21.06  E-value=95  Score=22.30  Aligned_cols=24  Identities=21%  Similarity=0.526  Sum_probs=15.6

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhc
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTR   58 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~   58 (88)
                      .+++-+|||.|- +.|...|+.+-+
T Consensus        48 ~v~l~iwDtaGq-e~~~~l~~~y~~   71 (202)
T cd04120          48 KIRLQIWDTAGQ-ERFNSITSAYYR   71 (202)
T ss_pred             EEEEEEEeCCCc-hhhHHHHHHHhc
Confidence            477789999553 346666665543


No 64 
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=20.95  E-value=93  Score=19.67  Aligned_cols=24  Identities=21%  Similarity=0.517  Sum_probs=15.5

Q ss_pred             ceeEEEeeccccCcchHHHHhhhhc
Q psy12841         34 DVHIMIWESYTYASAFADTFKAFTR   58 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aFt~   58 (88)
                      +++|.+|||.+ .+.|...++++-+
T Consensus        48 ~~~~~l~D~~G-~~~~~~~~~~~~~   71 (164)
T smart00175       48 RVKLQIWDTAG-QERFRSITSSYYR   71 (164)
T ss_pred             EEEEEEEECCC-hHHHHHHHHHHhC
Confidence            36788899965 3345566666654


No 65 
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins. bacterial proteins, eukaryotic ones are in PBPe
Probab=20.90  E-value=54  Score=20.38  Aligned_cols=19  Identities=21%  Similarity=0.372  Sum_probs=15.0

Q ss_pred             cCCcccccccCCceeeecc
Q psy12841         58 RHPVWDLKTFTGLTVCFKN   76 (88)
Q Consensus        58 ~~~~~~L~~~~gKrVCFk~   76 (88)
                      +.|+.+++|++||+|+.-.
T Consensus        95 ~~~~~~~~dL~g~~i~~~~  113 (219)
T smart00062       95 DSPIKSLEDLKGKKVAVVA  113 (219)
T ss_pred             CCCCCChHHhCCCEEEEec
Confidence            3457788999999999753


No 66 
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=20.60  E-value=98  Score=18.90  Aligned_cols=26  Identities=19%  Similarity=0.434  Sum_probs=17.5

Q ss_pred             CceeEEEeeccccCcchHHHHhhhhcC
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFTRH   59 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt~~   59 (88)
                      ..+++.+||+.+.. .|...|+++-++
T Consensus        47 ~~~~~~l~D~~g~~-~~~~~~~~~~~~   72 (159)
T cd00154          47 KTVKLQIWDTAGQE-RFRSITPSYYRG   72 (159)
T ss_pred             EEEEEEEEecCChH-HHHHHHHHHhcC
Confidence            45778899996653 455677776654


No 67 
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=20.40  E-value=88  Score=20.07  Aligned_cols=22  Identities=14%  Similarity=0.190  Sum_probs=12.8

Q ss_pred             ceeEEEeeccccCcchHHHHhhh
Q psy12841         34 DVHIMIWESYTYASAFADTFKAF   56 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aF   56 (88)
                      .+.+-+|||.+ .+.|...|..+
T Consensus        48 ~~~l~i~Dt~G-~~~~~~~~~~~   69 (163)
T cd04176          48 PSVLEILDTAG-TEQFASMRDLY   69 (163)
T ss_pred             EEEEEEEECCC-cccccchHHHH
Confidence            34566899955 23355555553


No 68 
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=20.38  E-value=96  Score=20.00  Aligned_cols=22  Identities=9%  Similarity=0.163  Sum_probs=13.2

Q ss_pred             ceeEEEeeccccCcchHHHHhhh
Q psy12841         34 DVHIMIWESYTYASAFADTFKAF   56 (88)
Q Consensus        34 Dv~Iv~Wdt~~Y~d~F~~tw~aF   56 (88)
                      .+.+.+|||.+- +.|...|+.+
T Consensus        48 ~~~l~i~Dt~G~-~~~~~~~~~~   69 (164)
T cd04175          48 QCMLEILDTAGT-EQFTAMRDLY   69 (164)
T ss_pred             EEEEEEEECCCc-ccchhHHHHH
Confidence            456678999653 2355555553


No 69 
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=20.38  E-value=86  Score=19.63  Aligned_cols=24  Identities=8%  Similarity=0.303  Sum_probs=15.3

Q ss_pred             CceeEEEeeccccCcchHHHHhhhh
Q psy12841         33 TDVHIMIWESYTYASAFADTFKAFT   57 (88)
Q Consensus        33 ~Dv~Iv~Wdt~~Y~d~F~~tw~aFt   57 (88)
                      ..+++.+|||.+- +.|...|+.+-
T Consensus        47 ~~~~~~~~D~~g~-~~~~~~~~~~~   70 (162)
T cd04123          47 KRIDLAIWDTAGQ-ERYHALGPIYY   70 (162)
T ss_pred             EEEEEEEEECCch-HHHHHhhHHHh
Confidence            3467889999662 23556666653


No 70 
>PF12974 Phosphonate-bd:  ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A.
Probab=20.20  E-value=40  Score=23.85  Aligned_cols=21  Identities=24%  Similarity=0.420  Sum_probs=14.4

Q ss_pred             cCCcccccccCCceeeecccc
Q psy12841         58 RHPVWDLKTFTGLTVCFKNLV   78 (88)
Q Consensus        58 ~~~~~~L~~~~gKrVCFk~a~   78 (88)
                      +.++-+|+|..||||++-+.-
T Consensus        94 ds~i~~l~dL~Gk~v~~~~~~  114 (243)
T PF12974_consen   94 DSPITSLADLKGKRVAFPDPS  114 (243)
T ss_dssp             TSS--SHHHHGGSEEEEE-TT
T ss_pred             CCCCCChhhcCCCEEEEecCC
Confidence            445668999999999996543


Done!