Diaphorina citri psyllid: psy12843


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MVGPGTGIAPFRSYIHTRISNQTASAQRLHLFFGCRNQGADFYFNQEWQNAIQANQLTLYTAFSRDQEEKITNNLSFESRVEAKIPYLGWDSTYIILIIRPES
cccccccHHHHHHHHHHHHHccccccccEEEEEcccccccccccHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHcHHHHHHHHccccCEEEEEEcccc
MVGPGTGIAPFRSYIHTRISNQTASAQRLHLFFGCRNQGADFYFNQEWQNAIQANQLTLYTAFSRDQEEKITNNLSFESRVEAKIPYLGWDSTYIILIIRP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGPGTGIAPFRSYIHTRISNQTASAQRLHLFFGCRNQGADFYFNQEWQNAIQANQLTLYTAFSRDQEEKITNNLSFESRVEAKIPYLGWDSTYIILIIRPES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sulfite reductase [NADPH] flavoprotein alpha-component Component of the sulfite reductase complex that catalyzes the 6-electron reduction of sulfite to sulfide. This is one of several activities required for the biosynthesis of L-cysteine from sulfate. The flavoprotein component catalyzes the electron flow from NADPH -> FAD -> FMN to the hemoprotein component.confidentQ87L90
NADPH-dependent diflavin oxidoreductase 1 Oxidoreductase that catalyzes the NADP-dependent reduction of cytochrome c and one-electron acceptors, such as doxorubicin, potassium ferricyanide and menadione (in vitro).confidentQ6PFP6
NADPH-dependent diflavin oxidoreductase 1 Oxidoreductase that catalyzes the NADP-dependent reduction of cytochrome c and one-electron acceptors, such as doxorubicin, potassium ferricyanide and menadione (in vitro).confidentA2AI05

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0016651 [MF]oxidoreductase activity, acting on NAD(P)HprobableGO:0003824, GO:0003674, GO:0016491
GO:0008219 [BP]cell deathprobableGO:0010259, GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0010181 [MF]FMN bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:1901265, GO:0003674, GO:0043167, GO:1901363, GO:0032553, GO:0005488
GO:0033993 [BP]response to lipidprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0036245 [BP]cellular response to menadioneprobableGO:1901700, GO:1901701, GO:0051716, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:1901654, GO:1901655, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0006527 [BP]arginine catabolic processprobableGO:0044282, GO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0009065, GO:0009064, GO:0044712, GO:1901575, GO:0006520, GO:0006525, GO:0071704, GO:1901605, GO:1901606, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019222 [BP]regulation of metabolic processprobableGO:0008150, GO:0065007, GO:0050789
GO:0045111 [CC]intermediate filament cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0012506 [CC]vesicle membraneprobableGO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0031988, GO:0005575, GO:0012505, GO:0043227, GO:0043226, GO:0044422, GO:0031982
GO:0018193 [BP]peptidyl-amino acid modificationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004517 [MF]nitric-oxide synthase activityprobableGO:0004497, GO:0016709, GO:0016705, GO:0003824, GO:0003674, GO:0016491
GO:0009055 [MF]electron carrier activityprobableGO:0003674
GO:0043169 [MF]cation bindingprobableGO:0003674, GO:0005488, GO:0043167
GO:0050661 [MF]NADP bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0050660 [MF]flavin adenine dinucleotide bindingprobableGO:0043168, GO:0050662, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0006809 [BP]nitric oxide biosynthetic processprobableGO:0044271, GO:0009987, GO:0009058, GO:0044237, GO:0044249, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0046209
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QFS, chain A
Confidence level:very confident
Coverage over the Query: 1-102
View the alignment between query and template
View the model in PyMOL