RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy12855
         (87 letters)



>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in
           Synaptotagmin 4.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains.  Synaptotagmin 4, a member of
           class 4 synaptotagmins, is located in the brain.  It
           functions are unknown. It, like synaptotagmin-11, has an
           Asp to Ser substitution in its C2A domain. Previously
           all synaptotagmins were thought to be calcium sensors in
           the regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 136

 Score =  124 bits (313), Expect = 2e-38
 Identities = 44/75 (58%), Positives = 57/75 (76%)

Query: 7   DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
           DPYVKV L Y  +R++KKKTHVKK TLNPV+NESFVF++P++ L+ +S+E L+LD DRVT
Sbjct: 37  DPYVKVNLYYGKKRISKKKTHVKKCTLNPVFNESFVFDIPSEELEDISVEFLVLDSDRVT 96

Query: 67  KNEKIFFFFFSSSSS 81
           KNE I        +S
Sbjct: 97  KNEVIGRLVLGPKAS 111


>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in
           Synaptotagmin 7.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 7, a member of
           class 2 synaptotagmins, is located in presynaptic plasma
           membranes in neurons, dense-core vesicles in endocrine
           cells, and lysosomes in fibroblasts.  It has been shown
           to play a role in regulation of Ca2+-dependent lysosomal
           exocytosis in fibroblasts and may also function as a
           vesicular Ca2+-sensor.  It is distinguished from the
           other synaptotagmins by having over 12 splice forms.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 136

 Score = 94.4 bits (235), Expect = 1e-26
 Identities = 36/65 (55%), Positives = 52/65 (80%)

Query: 7   DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
           DPYVKV+L+YK +RV KKKT +KKRTLNPV+NESF+F +P + L   +L + ++D DR++
Sbjct: 37  DPYVKVWLMYKDKRVEKKKTVIKKRTLNPVFNESFIFNIPLERLRETTLIITVMDKDRLS 96

Query: 67  KNEKI 71
           +N+ I
Sbjct: 97  RNDLI 101


>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat
           present in Synaptotagmins 3, 5, 6, 9, and 10.
           Synaptotagmin is a membrane-trafficking protein
           characterized by a N-terminal transmembrane region, a
           linker, and 2 C-terminal C2 domains. Synaptotagmin 3, a
           member of class 3 synaptotagmins, is located in the
           brain and localized to the active zone and plasma
           membrane.  It functions as a Ca2+ sensor for fast
           exocytosis. It, along with synaptotagmins 5,6, and 10,
           has disulfide bonds at its N-terminus. Synaptotagmin 9,
           a class 5 synaptotagmins, is located in the brain and
           localized to the synaptic vesicles.  It is thought to be
           a Ca2+-sensor for dense-core vesicle exocytosis.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 134

 Score = 94.5 bits (235), Expect = 1e-26
 Identities = 39/65 (60%), Positives = 52/65 (80%)

Query: 7   DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
           DPYVKV L+ +G+R+ KKKT VKK TLNP YNE+ VF+VP +N+D+VSL + ++D+DRV 
Sbjct: 36  DPYVKVSLMCEGRRLKKKKTSVKKNTLNPTYNEALVFDVPPENVDNVSLIIAVVDYDRVG 95

Query: 67  KNEKI 71
            NE I
Sbjct: 96  HNELI 100


>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in
           Synaptotagmin.  Synaptotagmin is a membrane-trafficking
           protein characterized by a N-terminal transmembrane
           region, a linker, and 2 C-terminal C2 domains. There are
           several classes of Synaptotagmins. Previously all
           synaptotagmins were thought to be calcium sensors in the
           regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 134

 Score = 93.8 bits (234), Expect = 2e-26
 Identities = 38/66 (57%), Positives = 50/66 (75%)

Query: 6   LDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRV 65
            DPYVKV LL  G+++ KKKT VKK TLNPV+NE+F F+VPA+ L+ VSL + ++D D V
Sbjct: 35  SDPYVKVSLLQGGKKLKKKKTSVKKGTLNPVFNEAFSFDVPAEQLEEVSLVITVVDKDSV 94

Query: 66  TKNEKI 71
            +NE I
Sbjct: 95  GRNEVI 100


>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in
           Synaptotagmin 1.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains.  Synaptotagmin 1, a member of the
           class 1 synaptotagmins, is located in the brain and
           endocranium and localized to the synaptic vesicles and
           secretory granules.  It functions as a Ca2+ sensor for
           fast exocytosis. It, like synaptotagmin-2, has an
           N-glycosylated N-terminus. Synaptotagmin 4, a member of
           class 4 synaptotagmins, is located in the brain.  It
           functions are unknown. It, like synaptotagmin-11, has an
           Asp to Ser substitution in its C2A domain. Previously
           all synaptotagmins were thought to be calcium sensors in
           the regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 136

 Score = 92.1 bits (229), Expect = 8e-26
 Identities = 37/65 (56%), Positives = 50/65 (76%)

Query: 7   DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
           DPYVK++L+  G+R+ KKKT +KKRTLNP YNESF FEVP + +  V L + +LD+DR+ 
Sbjct: 37  DPYVKIHLMQNGKRLKKKKTTIKKRTLNPYYNESFSFEVPFEQIQKVHLIVTVLDYDRIG 96

Query: 67  KNEKI 71
           KN+ I
Sbjct: 97  KNDPI 101


>gnl|CDD|215765 pfam00168, C2, C2 domain. 
          Length = 85

 Score = 69.2 bits (170), Expect = 2e-17
 Identities = 32/65 (49%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          DPYVKV L   GQ+   KKT V K TLNPV+NE+F FEV    L    L + + D+DR  
Sbjct: 21 DPYVKVSLG--GQKKDTKKTKVVKNTLNPVWNETFTFEVTLPELA--ELRIEVYDYDRFG 76

Query: 67 KNEKI 71
          K++ I
Sbjct: 77 KDDFI 81


>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in
          Rabphilin and Double C2 domain.  Rabphilin is found
          neurons and in neuroendrocrine cells, while Doc2 is
          found not only in the brain but in tissues, including
          mast cells, chromaffin cells, and osteoblasts.
          Rabphilin and Doc2s share highly homologous tandem C2
          domains, although their N-terminal structures are
          completely different: rabphilin contains an N-terminal
          Rab-binding domain (RBD),7 whereas Doc2 contains an
          N-terminal Munc13-1-interacting domain (MID). C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-I topology.
          Length = 133

 Score = 66.6 bits (163), Expect = 8e-16
 Identities = 26/65 (40%), Positives = 40/65 (61%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          DP+VK+YL     + +K KT VKK+TLNP +NE F +++   +L   +LE+ + D D   
Sbjct: 35 DPFVKLYLKPDAGKKSKHKTQVKKKTLNPEFNEEFFYDIKHSDLAKKTLEITVWDKDIGK 94

Query: 67 KNEKI 71
           N+ I
Sbjct: 95 SNDYI 99


>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC)
          alpha and gamma.  A single C2 domain is found in PKC
          alpha and gamma. The PKC family of serine/threonine
          kinases regulates apoptosis, proliferation, migration,
          motility, chemo-resistance, and differentiation.  There
          are 3 groups: group 1(alpha, betaI, beta II, gamma)
          which require phospholipids and calcium, group 2
          (delta, epsilon, theta, eta) which do not require
          calcium for activation, and group 3 (xi, iota/lambda)
          which are atypical and can be activated in the absence
          of diacylglycerol and calcium. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members here have a type-I topology.
          Length = 131

 Score = 66.5 bits (163), Expect = 8e-16
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 3/64 (4%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEV-PADNLDSVSLELLLLDWDRV 65
          DPYVK+ L+   +   K+KT   K+TLNPV+NE+F F++ PAD    +S+E  + DWDR 
Sbjct: 35 DPYVKLKLIPDPKNETKQKTKTIKKTLNPVWNETFTFDLKPADKDRRLSIE--VWDWDRT 92

Query: 66 TKNE 69
          T+N+
Sbjct: 93 TRND 96


>gnl|CDD|176051 cd08406, C2B_Synaptotagmin-12, C2 domain second repeat present in
          Synaptotagmin 12.  Synaptotagmin is a
          membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. Synaptotagmin 12, a member of
          class 6 synaptotagmins, is located in the brain.  It
          functions are unknown. It, like synaptotagmins 8 and
          13, do not have any consensus Ca2+ binding sites.
          Previously all synaptotagmins were thought to be
          calcium sensors in the regulation of neurotransmitter
          release and hormone secretion, but it has been shown
          that not all of them bind calcium.  Of the 17
          identified synaptotagmins only 8 bind calcium (1-3,
          5-7, 9, 10).  The function of the two C2 domains that
          bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-I topology.
          Length = 136

 Score = 66.7 bits (163), Expect = 8e-16
 Identities = 26/51 (50%), Positives = 38/51 (74%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLEL 57
          DP+VKVYLL  G++++KKKT VK+   NP++NE+ +F VPA  L  +SL +
Sbjct: 37 DPFVKVYLLQDGRKISKKKTSVKRDDTNPIFNEAMIFSVPAIVLQDLSLRV 87


>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in
           Synaptotagmin-like proteins 1-4.  All Slp members
           basically share an N-terminal Slp homology domain (SHD)
           and C-terminal tandem C2 domains (named the C2A domain
           and the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length.
           Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
           to the plasma membrane.  Additionally, their C2A domains
           are both Ca2+ independent, unlike the case in Slp3 and
           Slp4/granuphilin in which their C2A domains are Ca2+
           dependent.  It is thought that SHD (except for the
           Slp4-SHD) functions as a specific Rab27A/B-binding
           domain. In addition to Slps, rabphilin, Noc2, and
           Munc13-4 also function as Rab27-binding proteins. It has
           been demonstrated that Slp3 and Slp4/granuphilin promote
           dense-core vesicle exocytosis. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.   This cd contains the second
           C2 repeat, C2B, and has a type-I topology.
          Length = 162

 Score = 65.0 bits (159), Expect = 5e-15
 Identities = 25/70 (35%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 3   DNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFE-VPADNLDSVSLELLLLD 61
               D +VK YLL    + +K+KT V K+++NPV+N +FV++ V  ++L    LEL + D
Sbjct: 45  GGTSDSFVKCYLLPDKSKKSKQKTPVVKKSVNPVWNHTFVYDGVSPEDLSQACLELTVWD 104

Query: 62  WDRVTKNEKI 71
            D+++ N+ +
Sbjct: 105 HDKLSSNDFL 114


>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in
          uncharacterized human KIAA1228-like proteins.  KIAA
          proteins are uncharacterized human proteins. They were
          compiled by the Kazusa mammalian cDNA project which
          identified more than 2000 human genes. They are
          identified by 4 digit codes that precede the KIAA
          designation.  Many KIAA genes are still functionally
          uncharacterized including KIAA1228. C2 domains fold
          into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the third C2 repeat,
          C2C, and has a type-II topology.
          Length = 127

 Score = 63.1 bits (154), Expect = 1e-14
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 2  KDNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLEL 57
            +  DPYV++YLL    +  ++KT VKK  LNPV++E+F F V  + L   +L++
Sbjct: 33 SSDIPDPYVRLYLLPDKSKSTRRKTSVKKDNLNPVFDETFEFPVSLEELKRRTLDV 88


>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in
          Synaptotagmin-like proteins.  All Slp members basically
          share an N-terminal Slp homology domain (SHD) and
          C-terminal tandem C2 domains (named the C2A domain and
          the C2B domain) with the SHD and C2 domains being
          separated by a linker sequence of various length.
          Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
          to the plasma membrane.  Additionally, their C2A
          domains are both Ca2+ independent, unlike the case in
          Slp3 and Slp4/granuphilin in which their C2A domains
          are Ca2+ dependent.  It is thought that SHD (except for
          the Slp4-SHD) functions as a specific Rab27A/B-binding
          domain. In addition to Slps, rabphilin, Noc2, and
          Munc13-4 also function as Rab27-binding proteins. It
          has been demonstrated that Slp3 and Slp4/granuphilin
          promote dense-core vesicle exocytosis. Slp5 mRNA has
          been shown to be restricted to human placenta and liver
          suggesting a role in Rab27A-dependent membrane
          trafficking in specific tissues. C2 domains fold into
          an 8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions. 
          This cd contains the first C2 repeat, C2A, and has a
          type-I topology.
          Length = 123

 Score = 61.5 bits (150), Expect = 7e-14
 Identities = 23/51 (45%), Positives = 35/51 (68%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLEL 57
          +PYVKVYLL    + +K+KT VKK T NPV+NE+  + +    L++ +L+L
Sbjct: 37 NPYVKVYLLPDKSKQSKRKTSVKKNTTNPVFNETLKYHISKSQLETRTLQL 87


>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in
           class II phosphatidylinositol 3-kinases (PI3Ks).  There
           are 3 classes of PI3Ks based on structure, regulation,
           and specificity.  All classes contain a N-terminal C2
           domain, a PIK domain, and a kinase catalytic domain.
           Unlike class I and class III, class II PI3Ks have
           additionally a PX domain and a C-terminal C2 domain
           containing a nuclear localization signal both of which
           bind phospholipids though in a slightly different
           fashion.  PI3Ks (AKA phosphatidylinositol (PtdIns)
           3-kinases) regulate cell processes such as cell growth,
           differentiation, proliferation, and motility. PI3Ks work
           on phosphorylation of phosphatidylinositol,
           phosphatidylinositide (4)P (PtdIns (4)P),2 or
           PtdIns(4,5)P2. Specifically they phosphorylate the D3
           hydroxyl group of phosphoinositol lipids on the inositol
           ring. C2 domains fold into an 8-standed beta-sandwich
           that can adopt 2 structural arrangements: Type I and
           Type II, distinguished by a circular permutation
           involving their N- and C-terminal beta strands. Many C2
           domains are Ca2+-dependent membrane-targeting modules
           that bind a wide variety of substances including bind
           phospholipids, inositol polyphosphates, and
           intracellular proteins. Most C2 domain proteins are
           either signal transduction enzymes that contain a single
           C2 domain, such as protein kinase C, or membrane
           trafficking proteins which contain at least two C2
           domains, such as synaptotagmin 1.  However, there are a
           few exceptions to this including RIM isoforms and some
           splice variants of piccolo/aczonin and intersectin which
           only have a single C2 domain.  C2 domains with a calcium
           binding region have negatively charged residues,
           primarily aspartates, that serve as ligands for calcium
           ions. This cd contains the second C2 repeat, C2B, and
           has a type-I topology.
          Length = 122

 Score = 60.0 bits (146), Expect = 2e-13
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 7   DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFE-VPADNLDSVSLELLLLDWDRV 65
           DPYVK YLL   Q+  K+KT V ++T NP +NE  V++ +P ++L    L++ +   D +
Sbjct: 34  DPYVKTYLLPDPQKTTKRKTKVVRKTRNPTFNEMLVYDGLPVEDLQQRVLQVSVWSHDSL 93

Query: 66  TKNEKIFFFF 75
            +NE +    
Sbjct: 94  VENEFLGGVC 103


>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in
          Synaptotagmin-like proteins 1 and 2.  All Slp members
          basically share an N-terminal Slp homology domain (SHD)
          and C-terminal tandem C2 domains (named the C2A domain
          and the C2B domain) with the SHD and C2 domains being
          separated by a linker sequence of various length.
          Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
          to the plasma membrane.  Additionally, their C2A
          domains are both Ca2+ independent, unlike Slp3 and
          Slp4/granuphilin which are Ca2+ dependent.  It is
          thought that SHD (except for the Slp4-SHD) functions as
          a specific Rab27A/B-binding domain.  In addition to
          Slps, rabphilin, Noc2, and  Munc13-4 also function as
          Rab27-binding proteins.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-I topology.
          Length = 125

 Score = 60.1 bits (146), Expect = 2e-13
 Identities = 27/62 (43%), Positives = 38/62 (61%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          DPYVK YLL       K+KT VKK+TLNPV+NE+  ++V  + L +  L L +   D + 
Sbjct: 38 DPYVKTYLLPDKSNRGKRKTSVKKKTLNPVFNETLRYKVEREELPTRVLNLSVWHRDSLG 97

Query: 67 KN 68
          +N
Sbjct: 98 RN 99


>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB).
          Ca2+-binding motif present in phospholipases, protein
          kinases C, and synaptotagmins (among others). Some do
          not appear to contain Ca2+-binding sites. Particular
          C2s appear to bind phospholipids, inositol
          polyphosphates, and intracellular proteins. Unusual
          occurrence in perforin. Synaptotagmin and PLC C2s are
          permuted in sequence with respect to N- and C-terminal
          beta strands. SMART detects C2 domains using one or
          both of two profiles.
          Length = 101

 Score = 59.4 bits (144), Expect = 3e-13
 Identities = 32/65 (49%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          DPYVKV L   G    KKKT V K TLNPV+NE+F FEVP   L  + +E  + D DR  
Sbjct: 22 DPYVKVSLD--GDPKEKKKTKVVKNTLNPVWNETFEFEVPPPELAELEIE--VYDKDRFG 77

Query: 67 KNEKI 71
          +++ I
Sbjct: 78 RDDFI 82


>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in
           Synaptotagmin 8.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Previously all synaptotagmins
           were thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium.  Of
           the 17 identified synaptotagmins only 8 bind calcium
           (1-3, 5-7, 9, 10).  The function of the two C2 domains
           that bind calcium are: regulating the fusion step of
           synaptic vesicle exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles. 
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 124

 Score = 59.3 bits (144), Expect = 4e-13
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 2/65 (3%)

Query: 7   DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
           DPY KV LL        K++ + K+TLNP ++ESFVFEVP   L   +LE+LL D+D+ +
Sbjct: 38  DPYCKVRLLPDRSNT--KQSKIHKKTLNPEFDESFVFEVPPQELPKRTLEVLLYDFDQFS 95

Query: 67  KNEKI 71
           ++E I
Sbjct: 96  RDECI 100


>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present
          in Synaptotagmins 15 and 17.  Synaptotagmin is a
          membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. It is thought to be involved in
          the trafficking and exocytosis of secretory vesicles in
          non-neuronal tissues and is Ca2+ independent. Human
          synaptotagmin 15 has 2 alternatively spliced forms that
          encode proteins with different C-termini.  The larger,
          SYT15a, contains a N-terminal TM region, a putative
          fatty-acylation site, and 2 tandem C terminal C2
          domains.  The smaller, SYT15b, lacks the C-terminal
          portion of the second C2 domain.  Unlike most other
          synaptotagmins it is nearly absent in the brain and
          rather is found in the heart, lungs, skeletal muscle,
          and testis. Synaptotagmin 17 is located in the brain,
          kidney, and prostate and is thought to be a peripheral
          membrane protein. Previously all synaptotagmins were
          thought to be calcium sensors in the regulation of
          neurotransmitter release and hormone secretion, but it
          has been shown that not all of them bind calcium.  Of
          the 17 identified synaptotagmins only 8 bind calcium
          (1-3, 5-7, 9, 10).  The function of the two C2 domains
          that bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the first C2 repeat,
          C2A, and has a type-I topology.
          Length = 123

 Score = 59.2 bits (144), Expect = 5e-13
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDR 64
          DP+VKV LL   +R    ++ VK++T NP ++E+FVF+V    L   +L L + D DR
Sbjct: 37 DPFVKVCLLPDERRS--LQSKVKRKTQNPNFDETFVFQVSFKELQRRTLRLSVYDVDR 92


>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat
           present in Synaptotagmins 1, 5, 6, 9, and 10.
           Synaptotagmin is a membrane-trafficking protein
           characterized by a N-terminal transmembrane region, a
           linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a
           member of class 1 synaptotagmins, is located in the
           brain and endocranium and localized to the synaptic
           vesicles and secretory granules.  It functions as a Ca2+
           sensor for fast exocytosis as do synaptotagmins 5, 6,
           and 10. It is distinguished from the other
           synaptotagmins by having an N-glycosylated N-terminus.
           Synaptotagmins 5, 6, and 10, members of class 3
           synaptotagmins, are located primarily in the brain and
           localized to the active zone and plasma membrane.  They
           is distinguished from the other synaptotagmins by having
           disulfide bonds at its N-terminus.  Synaptotagmin 6 also
           regulates the acrosome reaction, a unique Ca2+-regulated
           exocytosis, in sperm. Synaptotagmin 9, a class 5
           synaptotagmins, is located in the brain and localized to
           the synaptic vesicles.  It is thought to be a
           Ca2+-sensor for dense-core vesicle exocytosis.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles. 
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 124

 Score = 59.2 bits (144), Expect = 5e-13
 Identities = 30/65 (46%), Positives = 44/65 (67%), Gaps = 2/65 (3%)

Query: 7   DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
           DPYVKVYLL    +  K +T V ++TLNPV+NE+F F+VP   L + +L   + D+DR +
Sbjct: 38  DPYVKVYLL--PDKKKKFETKVHRKTLNPVFNETFTFKVPYSELGNKTLVFSVYDFDRFS 95

Query: 67  KNEKI 71
           K++ I
Sbjct: 96  KHDLI 100


>gnl|CDD|175973 cd00030, C2, C2 domain.  The C2 domain was first identified in
          PKC. C2 domains fold into an 8-standed beta-sandwich
          that can adopt 2 structural arrangements: Type I and
          Type II, distinguished by a circular permutation
          involving their N- and C-terminal beta strands. Many C2
          domains are Ca2+-dependent membrane-targeting modules
          that bind a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 102

 Score = 58.2 bits (141), Expect = 6e-13
 Identities = 29/65 (44%), Positives = 40/65 (61%), Gaps = 6/65 (9%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          DPYVKV L  K     K KT V K TLNPV+NE+F F V   + +S +L + + D DR +
Sbjct: 21 DPYVKVSLGGK----QKFKTKVVKNTLNPVWNETFEFPVL--DPESDTLTVEVWDKDRFS 74

Query: 67 KNEKI 71
          K++ +
Sbjct: 75 KDDFL 79


>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in
          Tricalbin-like proteins.  5 to 6 copies of the C2
          domain are present in Tricalbin, a yeast homolog of
          Synaptotagmin, which is involved in membrane
          trafficking and sorting.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the fifth C2 repeat, C2E, and has a
          type-II topology.
          Length = 115

 Score = 58.7 bits (143), Expect = 7e-13
 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 6/65 (9%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          DP+VK YL   G++V K  T   K+TLNPV+NESF   VP+     + +E  + DWDR  
Sbjct: 21 DPFVKFYL--NGEKVFK--TKTIKKTLNPVWNESFEVPVPSRVRAVLKVE--VYDWDRGG 74

Query: 67 KNEKI 71
          K++ +
Sbjct: 75 KDDLL 79


>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in
           Synaptotagmin 7.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 7, a member of
           class 2 synaptotagmins, is located in presynaptic plasma
           membranes in neurons, dense-core vesicles in endocrine
           cells, and lysosomes in fibroblasts.  It has been shown
           to play a role in regulation of Ca2+-dependent lysosomal
           exocytosis in fibroblasts and may also function as a
           vesicular Ca2+-sensor.  It is distinguished from the
           other synaptotagmins by having over 12 splice forms.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 125

 Score = 56.6 bits (137), Expect = 5e-12
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 3/66 (4%)

Query: 7   DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFE-VPADNLDSVSLELLLLDWDRV 65
           DP+VK+YLL   +   K +T VK++ LNP +NE+F+FE  P + L    L L +LD+DR 
Sbjct: 38  DPFVKIYLLPDKKH--KLETKVKRKNLNPHWNETFLFEGFPYEKLQQRVLYLQVLDYDRF 95

Query: 66  TKNEKI 71
           ++N+ I
Sbjct: 96  SRNDPI 101


>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in
           Synaptotagmin 17.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 17 is located in
           the brain, kidney, and prostate and is thought to be a
           peripheral membrane protein. Previously all
           synaptotagmins were thought to be calcium sensors in the
           regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 135

 Score = 56.4 bits (136), Expect = 8e-12
 Identities = 29/79 (36%), Positives = 48/79 (60%), Gaps = 5/79 (6%)

Query: 7   DPYVKVYLLYKGQRVAK-KKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRV 65
           DP+VK+ L++ G ++ K KKT   + T++P YNESF F+VP + L++VSL   +   +  
Sbjct: 36  DPFVKIQLVH-GLKLIKTKKTSCMRGTIDPFYNESFSFKVPQEELENVSLVFTVYGHNVK 94

Query: 66  TKNE---KIFFFFFSSSSS 81
           + N+   +I    +SS  S
Sbjct: 95  SSNDFIGRIVIGQYSSGPS 113


>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in
           Rab3-interacting molecule (RIM) proteins.  RIMs are
           believed to organize specialized sites of the plasma
           membrane called active zones.  They also play a role in
           controlling neurotransmitter release, plasticity
           processes, as well as memory and learning.  RIM contains
           an N-terminal zinc finger domain, a PDZ domain, and two
           C-terminal C2 domains (C2A, C2B).  C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology and do not bind Ca2+.
          Length = 125

 Score = 55.3 bits (134), Expect = 2e-11
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 7   DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVF-EVPADNLDSVSLELLLLDWDRV 65
           +PYVKVYLL      +K++T   K+TLNP +N++F +  V  + L   +LE+ + D+DR 
Sbjct: 38  NPYVKVYLLPDRSEKSKRRTKTVKKTLNPEWNQTFEYSNVRRETLKERTLEVTVWDYDRD 97

Query: 66  TKNE 69
            +N+
Sbjct: 98  GEND 101


>gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in
          Synaptotagmin-like proteins 4 and 5.  All Slp members
          basically share an N-terminal Slp homology domain (SHD)
          and C-terminal tandem C2 domains (named the C2A domain
          and the C2B domain) with the SHD and C2 domains being
          separated by a linker sequence of various length. SHD
          of Slp (except for the Slp4-SHD) function as a specific
          Rab27A/B-binding domain.  In addition to Slp,
          rabphilin, Noc2, and  Munc13-4 also function as
          Rab27-binding proteins. It has been demonstrated that
          Slp4/granuphilin promotes dense-core vesicle
          exocytosis. The C2A domain of Slp4 is Ca2+ dependent.
          Slp5 mRNA has been shown to be restricted to human
          placenta and liver suggesting a role in
          Rab27A-dependent membrane trafficking in specific
          tissues. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-I topology.
          Length = 125

 Score = 54.0 bits (130), Expect = 6e-11
 Identities = 25/62 (40%), Positives = 40/62 (64%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          +PYVK YLL    R +K+KT +K+ T NPVYNE+  + +    L++ +L+L +  +DR  
Sbjct: 38 NPYVKTYLLPDKSRQSKRKTSIKRNTTNPVYNETLKYSISHSQLETRTLQLSVWHYDRFG 97

Query: 67 KN 68
          +N
Sbjct: 98 RN 99


>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13
           (mammalian uncoordinated)-like proteins.  C2-like
           domains are thought to be involved in phospholipid
           binding in a Ca2+ independent manner in both Unc13 and
           Munc13. Caenorabditis elegans Unc13 has a central domain
           with sequence similarity to PKC, which includes C1 and
           C2-related domains. Unc13 binds phorbol esters and DAG
           with high affinity in a phospholipid manner.  Mutations
           in Unc13 results in abnormal neuronal connections and
           impairment in cholinergic neurotransmission in the
           nematode.  Munc13 is the mammalian homolog which are
           expressed in the brain.  There are 3 isoforms (Munc13-1,
           -2, -3) and are thought to play a role in
           neurotransmitter release and are hypothesized to be
           high-affinity receptors for phorbol esters.  Unc13 and
           Munc13 contain both C1 and C2 domains.  There are two C2
           related domains present, one central and one at the
           carboxyl end.  Munc13-1 contains a third C2-like domain.
            Munc13 interacts with syntaxin, synaptobrevin, and
           synaptotagmin suggesting a role for these as scaffolding
           proteins. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the third C2
           repeat, C2C, and has a type-II topology.
          Length = 133

 Score = 53.8 bits (130), Expect = 7e-11
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 5/74 (6%)

Query: 1   MKDNEL-DPYVKVYLL--YKGQRVAKKKTHVKKRTLNPVYNESFVFEVPAD--NLDSVSL 55
           +  N   DP+VKV LL  +    V   KT VKK+TL P+++ESF F VP +  +++   L
Sbjct: 31  LDSNGSSDPFVKVELLPRHLFPDVPTPKTQVKKKTLFPLFDESFEFNVPPEQCSVEGALL 90

Query: 56  ELLLLDWDRVTKNE 69
              + D+D +  N+
Sbjct: 91  LFTVKDYDLLGSND 104


>gnl|CDD|176053 cd08408, C2B_Synaptotagmin-14_16, C2 domain second repeat present
           in Synaptotagmins 14 and 16.  Synaptotagmin 14 and 16
           are membrane-trafficking proteins in specific tissues
           outside the brain.   Both of these contain C-terminal
           tandem C2 repeats, but only Synaptotagmin 14 has an
           N-terminal transmembrane domain and a putative
           fatty-acylation site. Previously all synaptotagmins were
           thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium and
           this is indeed the case here.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 138

 Score = 51.6 bits (124), Expect = 5e-10
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 7   DPYVKVYLLYK-GQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRV 65
           D YVK+ LL   GQ ++K KT +++   +P + E+FVF+V    L  V+L   + +  ++
Sbjct: 37  DTYVKLTLLNSDGQEISKSKTSIRRGQPDPEFKETFVFQVALFQLSEVTLMFSVYNKRKM 96

Query: 66  TKNEKIFFFFFSSSSS 81
            + E I +F    +SS
Sbjct: 97  KRKEMIGWFSLGLNSS 112


>gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in
          Synaptotagmin 15.  Synaptotagmin is a
          membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. It is thought to be involved in
          the trafficking and exocytosis of secretory vesicles in
          non-neuronal tissues and is Ca2+ independent. Human
          synaptotagmin 15 has 2 alternatively spliced forms that
          encode proteins with different C-termini.  The larger,
          SYT15a, contains a N-terminal TM region, a putative
          fatty-acylation site, and 2 tandem C terminal C2
          domains.  The smaller, SYT15b, lacks the C-terminal
          portion of the second C2 domain.  Unlike most other
          synaptotagmins it is nearly absent in the brain and
          rather is found in the heart, lungs, skeletal muscle,
          and testis.  Previously all synaptotagmins were thought
          to be calcium sensors in the regulation of
          neurotransmitter release and hormone secretion, but it
          has been shown that not all of them bind calcium.  Of
          the 17 identified synaptotagmins only 8 bind calcium
          (1-3, 5-7, 9, 10).  The function of the two C2 domains
          that bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-I topology.
          Length = 137

 Score = 51.2 bits (123), Expect = 9e-10
 Identities = 22/60 (36%), Positives = 32/60 (53%)

Query: 1  MKDNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLL 60
          +       YVKV L+   + V  KKT V     +P +NESF F+V +  LD+ SL L ++
Sbjct: 30 LDHAHTSVYVKVSLMIHNKVVKTKKTEVVDGAASPSFNESFSFKVTSRQLDTASLSLSVM 89


>gnl|CDD|176038 cd08392, C2A_SLP-3, C2 domain first repeat present in
          Synaptotagmin-like protein 3.  All Slp members
          basically share an N-terminal Slp homology domain (SHD)
          and C-terminal tandem C2 domains (named the C2A domain
          and the C2B domain) with the SHD and C2 domains being
          separated by a linker sequence of various length. SHD
          of Slp (except for the Slp4-SHD) function as a specific
          Rab27A/B-binding domain.  In addition to Slp,
          rabphilin, Noc2, and  Munc13-4 also function as
          Rab27-binding proteins. Little is known about the
          expression or localization of Slp3.  The C2A domain of
          Slp3 is Ca2+ dependent.  It has been demonstrated that
          Slp3 promotes dense-core vesicle exocytosis.  C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.  This cd contains the first C2
          repeat, C2A, and has a type-I topology.
          Length = 128

 Score = 50.6 bits (121), Expect = 1e-09
 Identities = 26/56 (46%), Positives = 35/56 (62%)

Query: 2  KDNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLEL 57
          K  +  PYVKV LL      +K+KT VKK T+NPV+NE+  + V AD L S  L++
Sbjct: 33 KKKKCHPYVKVCLLPDKSHNSKRKTAVKKGTVNPVFNETLKYVVEADLLSSRQLQV 88


>gnl|CDD|175994 cd04028, C2B_RIM1alpha, C2 domain second repeat contained in
          Rab3-interacting molecule (RIM) proteins.  RIMs are
          believed to organize specialized sites of the plasma
          membrane called active zones.  They also play a role in
          controlling neurotransmitter release, plasticity
          processes, as well as memory and learning.  RIM
          contains an N-terminal zinc finger domain, a PDZ
          domain, and two C-terminal C2 domains (C2A, C2B).  C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. Members here have a type-I topology
          and do not bind Ca2+.
          Length = 146

 Score = 50.5 bits (121), Expect = 2e-09
 Identities = 20/38 (52%), Positives = 29/38 (76%)

Query: 8  PYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEV 45
          PYVKVYLL   + +AKKKT + ++TL+P+Y +  VF+V
Sbjct: 53 PYVKVYLLEGKKCIAKKKTKIARKTLDPLYQQQLVFDV 90


>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in
          Rabphilin and Double C2 domain.  Rabphilin is found
          neurons and in neuroendrocrine cells, while Doc2 is
          found not only in the brain but in tissues, including
          mast cells, chromaffin cells, and osteoblasts.
          Rabphilin and Doc2s share highly homologous tandem C2
          domains, although their N-terminal structures are
          completely different: rabphilin contains an N-terminal
          Rab-binding domain (RBD),7 whereas Doc2 contains an
          N-terminal Munc13-1-interacting domain (MID). C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the first C2 repeat,
          C2A, and has a type-I topology.
          Length = 123

 Score = 49.2 bits (118), Expect = 4e-09
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFE-VPADNLDSVSLELLLLDWDR 64
          DPYVK+ LL    +  K +T    +T NP +NE+  +  +  +++   +L LL+LD DR
Sbjct: 37 DPYVKLNLLPGASKATKLRTKTVHKTRNPEFNETLTYYGITEEDIQRKTLRLLVLDEDR 95


>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2
            domain [General function prediction only].
          Length = 1227

 Score = 49.4 bits (118), Expect = 2e-08
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 7    DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
            DP+VK  L    + V K K    K+TLNPV+NE F  EV     D +   + + DWD   
Sbjct: 1062 DPFVK--LFLNEKSVYKTKVV--KKTLNPVWNEEFTIEVLNRVKDVL--TINVNDWDSGE 1115

Query: 67   KNEKI 71
            KN+ +
Sbjct: 1116 KNDLL 1120



 Score = 31.7 bits (72), Expect = 0.033
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 7/71 (9%)

Query: 1   MKDNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLL 60
             +  +DPY+ V    +       KT VKK TLNPV+NE+F   +  ++     L L L 
Sbjct: 454 TINGTVDPYITVTFSDRV----IGKTRVKKNTLNPVWNETFY--ILLNSFTD-PLNLSLY 506

Query: 61  DWDRVTKNEKI 71
           D++    ++ +
Sbjct: 507 DFNSFKSDKVV 517


>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in
           Synaptotagmins 4 and 11.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains.  Synaptotagmins 4 and 11, class 4
           synaptotagmins, are located in the brain.  Their
           functions are unknown. They are distinguished from the
           other synaptotagmins by having and Asp to Ser
           substitution in their C2A domains. Previously all
           synaptotagmins were thought to be calcium sensors in the
           regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles.  C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 128

 Score = 47.7 bits (114), Expect = 2e-08
 Identities = 27/67 (40%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 6   LDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVF-EVPADNLDSVSLELLLLDWDR 64
            DPYVK+ LL + +   K KT V ++T NPVY+E+F F  +P + L  +SL   +L +DR
Sbjct: 38  SDPYVKLQLLPEKEH--KVKTRVLRKTRNPVYDETFTFYGIPYNQLQDLSLHFAVLSFDR 95

Query: 65  VTKNEKI 71
            ++++ I
Sbjct: 96  YSRDDVI 102


>gnl|CDD|176052 cd08407, C2B_Synaptotagmin-13, C2 domain second repeat present in
          Synaptotagmin 13.  Synaptotagmin is a
          membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. Synaptotagmin 13, a member of
          class 6 synaptotagmins, is located in the brain.  It
          functions are unknown. It, like synaptotagmins 8 and
          12, does not have any consensus Ca2+ binding sites.
          Previously all synaptotagmins were thought to be
          calcium sensors in the regulation of neurotransmitter
          release and hormone secretion, but it has been shown
          that not all of them bind calcium.  Of the 17
          identified synaptotagmins only 8 bind calcium (1-3,
          5-7, 9, 10).  The function of the two C2 domains that
          bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-I topology.
          Length = 138

 Score = 47.7 bits (113), Expect = 2e-08
 Identities = 23/57 (40%), Positives = 38/57 (66%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWD 63
          D  VKV L ++  ++ KK+T   K  +NPV+NE  +FE+P++ L + S+EL +L+ D
Sbjct: 39 DVSVKVTLKHQNAKLKKKQTKRAKHKINPVWNEMIMFELPSELLAASSVELEVLNQD 95


>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin.  Ferlins
          are involved in vesicle fusion events.  Ferlins and
          other proteins, such as Synaptotagmins, are implicated
          in facilitating the fusion process when cell membranes
          fuse together.  There are six known human Ferlins:
          Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
          (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
          genes can lead to a wide range of diseases including
          muscular dystrophy (dysferlin), deafness (otoferlin),
          and infertility (fer-1, fertilization factor-1).
          Structurally they have 6 tandem C2 domains, designated
          as (C2A-C2F) and a single C-terminal transmembrane
          domain, though there is a new study that disputes this
          and claims that there are actually 7 tandem C2 domains
          with another C2 domain inserted between C2D and C2E. 
          In a subset of them (Dysferlin, Myoferlin, and Fer1)
          there is an additional conserved domain called DysF. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the fifth C2 repeat,
          C2E, and has a type-II topology.
          Length = 124

 Score = 46.0 bits (110), Expect = 6e-08
 Identities = 17/67 (25%), Positives = 38/67 (56%), Gaps = 9/67 (13%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFE--VPADNLDSVSLELLLLDWDR 64
          DPY+K+ L    +++  +  ++   TLNPV+ + F  E  +P +++  +S    ++D+D 
Sbjct: 22 DPYLKIKLG--KKKINDRDNYIPN-TLNPVFGKMFELEATLPGNSILKIS----VMDYDL 74

Query: 65 VTKNEKI 71
          +  ++ I
Sbjct: 75 LGSDDLI 81


>gnl|CDD|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21
          protein activator 3 (RasA3).  RasA3 are members of
          GTPase activating protein 1 (GAP1), a Ras-specific GAP,
          which suppresses Ras function by enhancing the GTPase
          activity of Ras proteins resulting in the inactive
          GDP-bound form of Ras.  In this way it can control
          cellular proliferation and differentiation.  RasA3
          contains an N-terminal C2 domain,  a Ras-GAP domain, a
          plextrin homology (PH)-like domain, and a Bruton's
          Tyrosine Kinase (BTK) zinc binding domain. C2 domains
          fold into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-I topology.
          Length = 148

 Score = 45.5 bits (108), Expect = 2e-07
 Identities = 19/43 (44%), Positives = 29/43 (67%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADN 49
          DPY  V L+Y  ++   K+T VKK+T NP ++E+F F+V  D+
Sbjct: 20 DPYASVTLIYSNKKQDTKRTKVKKKTNNPQFDEAFYFDVTIDS 62


>gnl|CDD|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine
          decarboxylase (PSD).  PSD is involved in the
          biosynthesis of aminophospholipid by converting
          phosphatidylserine (PtdSer) to phosphatidylethanolamine
          (PtdEtn). There is a single C2 domain present and it is
          thought to confer PtdSer binding motif that is common
          to PKC and synaptotagmin. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Length = 108

 Score = 44.6 bits (106), Expect = 2e-07
 Identities = 21/67 (31%), Positives = 39/67 (58%), Gaps = 6/67 (8%)

Query: 5  ELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDR 64
          ++DP+V +     G+RV +  T  ++ TLNPV+NE   FEV   +  +  ++  +LD D+
Sbjct: 25 DMDPFVIISF---GRRVFR--TSWRRHTLNPVFNERLAFEV-YPHEKNFDIQFKVLDKDK 78

Query: 65 VTKNEKI 71
           + N+ +
Sbjct: 79 FSFNDYV 85


>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528
          cDNA clone.  The members of this CD are named after the
          Human KIAA0528 cDNA clone.  All members here contain a
          single C2 repeat.  No other information on this protein
          is currently known. The C2 domain was first identified
          in PKC.  C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Length = 110

 Score = 43.1 bits (102), Expect = 6e-07
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 25 KTHVKKRTLNPVYN-ESFVFEVPADNLDSVSLELLLLDWDRVTKNEKI 71
          KT V K++LNPV+N E F FEV  + L    L++ ++D D  + N+ I
Sbjct: 35 KTDVVKKSLNPVWNSEWFRFEVDDEELQDEPLQIRVMDHDTYSANDAI 82


>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third
          repeat in Synaptotagmin-like proteins.  Synaptotagmin
          is a membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. Previously all synaptotagmins
          were thought to be calcium sensors in the regulation of
          neurotransmitter release and hormone secretion, but it
          has been shown that not all of them bind calcium.  Of
          the 17 identified synaptotagmins only 8 bind calcium
          (1-3, 5-7, 9, 10).  The function of the two C2 domains
          that bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains either the first or
          third repeat in Synaptotagmin-like proteins with a
          type-I topology.
          Length = 121

 Score = 43.0 bits (102), Expect = 7e-07
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 11/66 (16%)

Query: 1  MKDNELDPYVKVYLLYKGQRVAKK--KTHVKKRTLNPVYNESFVFEVPADNLDSVSLELL 58
          +   + DPYV V       RV  +  K+ V K  LNP +NE  V+E   D +    LE+ 
Sbjct: 23 LVKGKSDPYVIV-------RVGAQTFKSKVIKENLNPKWNE--VYEAVVDEVPGQELEIE 73

Query: 59 LLDWDR 64
          L D D 
Sbjct: 74 LFDEDP 79


>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating
          Proteins (GAP).  ArfGAP is a GTPase activating protein
          which regulates the ADP ribosylation factor Arf, a
          member of the Ras superfamily of GTP-binding proteins. 
          The GTP-bound form of Arf is involved in Golgi
          morphology and is involved in recruiting coat proteins.
           ArfGAP is responsible for the GDP-bound form of Arf
          which is necessary for uncoating the membrane and
          allowing the Golgi to fuse with an acceptor
          compartment.  These proteins contain an N-terminal
          ArfGAP domain containing the characteristic zinc finger
          motif (Cys-x2-Cys-x(16,17)-x2-Cys) and C-terminal C2
          domain. C2 domains were first identified in Protein
          Kinase C (PKC). C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Length = 145

 Score = 43.5 bits (103), Expect = 7e-07
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          DPYV + L   G +  K KT V K+ LNPV+NE     VP        L+L + D D  +
Sbjct: 23 DPYVVLTL---GNQ--KVKTRVIKKNLNPVWNEELTLSVPNPMA---PLKLEVFDKDTFS 74

Query: 67 KNEK 70
          K++ 
Sbjct: 75 KDDS 78


>gnl|CDD|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase
          activating proteins (GAPs).  RasGAPs suppress Ras
          function by enhancing the GTPase activity of Ras
          proteins resulting in the inactive GDP-bound form of
          Ras.  In this way it can control cellular proliferation
          and differentiation.  The proteins here all contain two
          tandem C2 domains,  a Ras-GAP domain, and a pleckstrin
          homology (PH)-like domain. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members here have a type-I topology.
          Length = 137

 Score = 43.1 bits (102), Expect = 1e-06
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADN 49
          DP+ +V L Y  +   K+ T VKK+T NP ++E+F FE+    
Sbjct: 20 DPFARVTLNYSSKTDTKR-TKVKKKTNNPRFDEAFYFELTIGF 61


>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin.  Ferlins
          are involved in vesicle fusion events.  Ferlins and
          other proteins, such as Synaptotagmins, are implicated
          in facilitating the fusion process when cell membranes
          fuse together.  There are six known human Ferlins:
          Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
          (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
          genes can lead to a wide range of diseases including
          muscular dystrophy (dysferlin), deafness (otoferlin),
          and infertility (fer-1, fertilization factor-1).
          Structurally they have 6 tandem C2 domains, designated
          as (C2A-C2F) and a single C-terminal transmembrane
          domain, though there is a new study that disputes this
          and claims that there are actually 7 tandem C2 domains
          with another C2 domain inserted between C2D and C2E. 
          In a subset of them (Dysferlin, Myoferlin, and Fer1)
          there is an additional conserved domain called DysF. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-II topology.
          Length = 111

 Score = 41.8 bits (99), Expect = 2e-06
 Identities = 25/73 (34%), Positives = 33/73 (45%), Gaps = 7/73 (9%)

Query: 4  NELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEV--PADNLDSVSLELLLLD 61
            +DP VKV +   GQ   KK T VKK T  P YNE F F      D L    +++ + D
Sbjct: 19 GNIDPVVKVEVG--GQ---KKYTSVKKGTNCPFYNEYFFFNFHESPDELFDKIIKISVYD 73

Query: 62 WDRVTKNEKIFFF 74
             +  +  I  F
Sbjct: 74 SRSLRSDTLIGSF 86


>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural
          precursor cell-expressed, developmentally
          down-regulated 4 (NEDD4) and NEDD4-like
          (NEDD4L/NEDD42).  Nedd4 and Nedd4-2 are two of the nine
          members of the Human Nedd4 family.  All vertebrates
          appear to have both Nedd4 and Nedd4-2 genes. They are
          thought to participate in the regulation of epithelial
          Na+ channel (ENaC) activity. They also have identical
          specificity for ubiquitin conjugating enzymes (E2).
          Nedd4 and Nedd4-2 are composed of a C2 domain, 2-4 WW
          domains, and a ubiquitin ligase Hect domain. Their WW
          domains can bind PPxY (PY) or LPSY motifs, and in vitro
          studies suggest that WW3 and WW4 of both proteins bind
          PY motifs in the key substrates, with WW3 generally
          exhibiting higher affinity. Most Nedd4 family members,
          especially Nedd4-2, also have multiple splice variants,
          which might play different roles in regulating their
          substrates. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Length = 133

 Score = 42.3 bits (100), Expect = 2e-06
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 9/65 (13%)

Query: 7  DPYVKVYLLYKGQR---VAKKKTHVKKRTLNPVYNESFVFEV-PADNLDSVSLELLLLDW 62
          DPYVK+ L Y       +   +T   K+TLNP +NE F F V P ++     L   + D 
Sbjct: 22 DPYVKISL-YDPDGNGEIDSVQTKTIKKTLNPKWNEEFFFRVNPREH----RLLFEVFDE 76

Query: 63 DRVTK 67
          +R+T+
Sbjct: 77 NRLTR 81


>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in
          RasA1 and RasA4.  RasA1 and RasA4 are GAP1s (GTPase
          activating protein 1s ), Ras-specific GAP members,
          which suppresses Ras function by enhancing the GTPase
          activity of Ras proteins resulting in the inactive
          GDP-bound form of Ras.  In this way it can control
          cellular proliferation and differentiation.  Both
          proteins contain two C2 domains,  a Ras-GAP domain, a
          plextrin homology (PH)-like domain, and a Bruton's
          Tyrosine Kinase (BTK) zinc binding domain. C2 domains
          fold into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-I topology.
          Length = 123

 Score = 40.5 bits (95), Expect = 7e-06
 Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 7/63 (11%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          DP+V+V+  Y GQ     +T V K++  P +NE F FE+       +S+E  + DWD V+
Sbjct: 22 DPFVRVF--YNGQ---TLETSVVKKSCYPRWNEVFEFELMEGADSPLSVE--VWDWDLVS 74

Query: 67 KNE 69
          KN+
Sbjct: 75 KND 77


>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13
           (mammalian uncoordinated)-like proteins.  C2-like
           domains are thought to be involved in phospholipid
           binding in a Ca2+ independent manner in both Unc13 and
           Munc13. Caenorabditis elegans Unc13 has a central domain
           with sequence similarity to PKC, which includes C1 and
           C2-related domains. Unc13 binds phorbol esters and DAG
           with high affinity in a phospholipid manner.  Mutations
           in Unc13 results in abnormal neuronal connections and
           impairment in cholinergic neurotransmission in the
           nematode.  Munc13 is the mammalian homolog which are
           expressed in the brain.  There are 3 isoforms (Munc13-1,
           -2, -3) and are thought to play a role in
           neurotransmitter release and are hypothesized to be
           high-affinity receptors for phorbol esters.  Unc13 and
           Munc13 contain both C1 and C2 domains.  There are two C2
           related domains present, one central and one at the
           carboxyl end.  Munc13-1 contains a third C2-like domain.
            Munc13 interacts with syntaxin, synaptobrevin, and
           synaptotagmin suggesting a role for these as scaffolding
           proteins. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-II topology.
          Length = 153

 Score = 40.0 bits (94), Expect = 2e-05
 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 6/42 (14%)

Query: 24  KKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLD-WDR 64
           K T VK +TLNPV+NE+F FEV     + VS + L LD WD 
Sbjct: 91  KVTEVKPQTLNPVWNETFRFEV-----EDVSNDQLHLDIWDH 127


>gnl|CDD|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin.  Ferlins
          are involved in vesicle fusion events.  Ferlins and
          other proteins, such as Synaptotagmins, are implicated
          in facilitating the fusion process when cell membranes
          fuse together.  There are six known human Ferlins:
          Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
          (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
          genes can lead to a wide range of diseases including
          muscular dystrophy (dysferlin), deafness (otoferlin),
          and infertility (fer-1, fertilization factor-1).
          Structurally they have 6 tandem C2 domains, designated
          as (C2A-C2F) and a single C-terminal transmembrane
          domain, though there is a new study that disputes this
          and claims that there are actually 7 tandem C2 domains
          with another C2 domain inserted between C2D and C2E. 
          In a subset of them (Dysferlin, Myoferlin, and Fer1)
          there is an additional conserved domain called DysF. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the third C2 repeat,
          C2C, and has a type-II topology.
          Length = 151

 Score = 38.4 bits (90), Expect = 8e-05
 Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 10/72 (13%)

Query: 2  KDNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSV--SLELLL 59
          K   +DPYV+V   + GQ+V   KT VKK + NP +NE  VF    +    +   +++ +
Sbjct: 31 KKELVDPYVEVS--FAGQKV---KTSVKKNSYNPEWNEQIVF---PEMFPPLCERIKIQI 82

Query: 60 LDWDRVTKNEKI 71
           DWDRV  ++ I
Sbjct: 83 RDWDRVGNDDVI 94


>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin.  Ferlins
          are involved in vesicle fusion events.  Ferlins and
          other proteins, such as Synaptotagmins, are implicated
          in facilitating the fusion process when cell membranes
          fuse together.  There are six known human Ferlins:
          Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
          (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
          genes can lead to a wide range of diseases including
          muscular dystrophy (dysferlin), deafness (otoferlin),
          and infertility (fer-1, fertilization factor-1).
          Structurally they have 6 tandem C2 domains, designated
          as (C2A-C2F) and a single C-terminal transmembrane
          domain, though there is a new study that disputes this
          and claims that there are actually 7 tandem C2 domains
          with another C2 domain inserted between C2D and C2E. 
          In a subset of them (Dysferlin, Myoferlin, and Fer1)
          there is an additional conserved domain called DysF. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the fourth C2
          repeat, C2D, and has a type-II topology.
          Length = 135

 Score = 37.9 bits (89), Expect = 1e-04
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 16/77 (20%)

Query: 2  KDNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVF---EVP------ADNLDS 52
          K    DP+ +V  L + Q     +T V K TL+P ++++ +F   E+       A N   
Sbjct: 18 KSGLSDPFARVSFLNQSQ-----ETEVIKETLSPTWDQTLIFDEVELYGSPEEIAQNPPL 72

Query: 53 VSLELLLLDWDRVTKNE 69
          V +E  L D D V K+E
Sbjct: 73 VVVE--LFDQDSVGKDE 87


>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase
          activating proteins (GAPs).  RasGAPs suppress Ras
          function by enhancing the GTPase activity of Ras
          proteins resulting in the inactive GDP-bound form of
          Ras.  In this way it can control cellular proliferation
          and differentiation.  The proteins here all contain
          either a single C2 domain or two tandem C2 domains,  a
          Ras-GAP domain, and a pleckstrin homology (PH)-like
          domain. C2 domains fold into an 8-standed beta-sandwich
          that can adopt 2 structural arrangements: Type I and
          Type II, distinguished by a circular permutation
          involving their N- and C-terminal beta strands. Many C2
          domains are Ca2+-dependent membrane-targeting modules
          that bind a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. Members here have a type-I topology.
          Length = 117

 Score = 36.9 bits (86), Expect = 2e-04
 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 5/57 (8%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWD 63
          DPY  V L     +V   +T   ++ LNP + E FVF+ P  ++   +L     D  
Sbjct: 19 DPYCTVSL----DQVEVARTKTVEK-LNPFWGEEFVFDDPPPDVTFFTLSFYNKDKR 70


>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin.  Ferlins
          are involved in vesicle fusion events.  Ferlins and
          other proteins, such as Synaptotagmins, are implicated
          in facilitating the fusion process when cell membranes
          fuse together.  There are six known human Ferlins:
          Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
          (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
          genes can lead to a wide range of diseases including
          muscular dystrophy (dysferlin), deafness (otoferlin),
          and infertility (fer-1, fertilization factor-1).
          Structurally they have 6 tandem C2 domains, designated
          as (C2A-C2F) and a single C-terminal transmembrane
          domain, though there is a new study that disputes this
          and claims that there are actually 7 tandem C2 domains
          with another C2 domain inserted between C2D and C2E. 
          In a subset of them (Dysferlin, Myoferlin, and Fer1)
          there is an additional conserved domain called DysF. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the first C2 repeat,
          C2A, and has a type-II topology.
          Length = 127

 Score = 37.2 bits (87), Expect = 2e-04
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 5/62 (8%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          D   KV   ++G    KKKT V +  LNPV+NE+F + +        SLE+++ D+++V 
Sbjct: 16 DRIAKV--TFRG---VKKKTRVLENELNPVWNETFEWPLAGSPDPDESLEIVVKDYEKVG 70

Query: 67 KN 68
          +N
Sbjct: 71 RN 72


>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian
          uncoordinated) proteins; fungal group.  C2-like domains
          are thought to be involved in phospholipid binding in a
          Ca2+ independent manner in both Unc13 and Munc13.
          Caenorabditis elegans Unc13 has a central domain with
          sequence similarity to PKC, which includes C1 and
          C2-related domains. Unc13 binds phorbol esters and DAG
          with high affinity in a phospholipid manner.  Mutations
          in Unc13 results in abnormal neuronal connections and
          impairment in cholinergic neurotransmission in the
          nematode.  Munc13 is the mammalian homolog which are
          expressed in the brain.  There are 3 isoforms
          (Munc13-1, -2, -3) and are thought to play a role in
          neurotransmitter release and are hypothesized to be
          high-affinity receptors for phorbol esters.  Unc13 and
          Munc13 contain both C1 and C2 domains.  There are two
          C2 related domains present, one central and one at the
          carboxyl end.  Munc13-1 contains a third C2-like
          domain.  Munc13 interacts with syntaxin, synaptobrevin,
          and synaptotagmin suggesting a role for these as
          scaffolding proteins. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the second C2 repeat, C2B, and has a
          type-II topology.
          Length = 126

 Score = 36.9 bits (86), Expect = 2e-04
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 6  LDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDR 64
           DPYV +      +R+AK +T     TLNP ++E F  EVPA       L +    WDR
Sbjct: 22 SDPYVTLVDTNGKRRIAKTRT--IYDTLNPRWDEEFELEVPAGE----PLWISATVWDR 74


>gnl|CDD|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC)
          epsilon.  A single C2 domain is found in PKC epsilon.
          The PKC family of serine/threonine kinases regulates
          apoptosis, proliferation, migration, motility,
          chemo-resistance, and differentiation.  There are 3
          groups: group 1 (alpha, betaI, beta II, gamma) which
          require phospholipids and calcium, group 2 (delta,
          epsilon, theta, eta) which do not require calcium for
          activation, and group 3 (xi, iota/lambda) which are
          atypical and can be activated in the absence of
          diacylglycerol and calcium. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members here have a type-II topology.
          Length = 132

 Score = 36.9 bits (86), Expect = 2e-04
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 4/45 (8%)

Query: 1  MKDNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEV 45
               LDPYV + +      + K  T  K +T +PV+NE F  EV
Sbjct: 30 KGSQLLDPYVSIDV--DDTHIGK--TSTKPKTNSPVWNEEFTTEV 70


>gnl|CDD|176072 cd08690, C2_Freud-1, C2 domain found in 5' repressor element
          under dual repression binding protein-1 (Freud-1).
          Freud-1 is a novel calcium-regulated repressor that
          negatively regulates basal 5-HT1A receptor expression
          in neurons.  It may also play a role in the altered
          regulation of 5-HT1A receptors associated with anxiety
          or major depression. Freud-1 contains two DM-14 basic
          repeats, a helix-loop-helix DNA binding domain, and a
          C2 domain. The Freud-1 C2 domain is thought to be
          calcium insensitive and it lacks several acidic
          residues that mediate calcium binding of the PKC C2
          domain. In addition, it contains a poly-basic insert
          that is not present in calcium-dependent C2 domains and
          may function as a nuclear localization signal. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.  This cd contains the first C2
          repeat, C2A, and has a type-II topology.
          Length = 155

 Score = 36.9 bits (86), Expect = 3e-04
 Identities = 16/42 (38%), Positives = 20/42 (47%)

Query: 4  NELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEV 45
           +LD YVK    Y  +     KT   K T +P YNESF   +
Sbjct: 23 KDLDTYVKFEFPYPNEEPQSGKTSTIKDTNSPEYNESFKLNI 64


>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in
          Phosphoinositide-specific phospholipases C (PLC).  PLCs
          are involved in the hydrolysis of
          phosphatidylinositol-4,5-bisphosphate (PIP2) to
          d-myo-inositol-1,4,5-trisphosphate (1,4,5-IP3) and
          sn-1,2-diacylglycerol (DAG).   1,4,5-IP3 and DAG are
          second messengers in eukaryotic signal transduction
          cascades. PLC is composed of a N-terminal PH domain
          followed by a series of EF hands, a catalytic TIM
          barrel and a C-terminal C2 domain. C2 domains fold into
          an 8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members here have a type-II topology.
          Length = 128

 Score = 36.4 bits (85), Expect = 3e-04
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 7  DPYVKVYLLYKG---QRVAKKKTHVKKR-TLNPVYNESFVFEV 45
          DPYV+V +   G      AK KT V K    NPV+NE+F F+V
Sbjct: 26 DPYVEVEIH--GLPADDSAKFKTKVVKNNGFNPVWNETFEFDV 66


>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in
          Multiple C2 domain and Transmembrane region Proteins
          (MCTP); plant subset.  MCTPs are involved in Ca2+
          signaling at the membrane.  Plant-MCTPs are composed of
          a variable N-terminal sequence, four C2 domains, two
          transmembrane regions (TMRs), and a short C-terminal
          sequence.  It is one of four protein classes that are
          anchored to membranes via a transmembrane region; the
          others being synaptotagmins, extended synaptotagmins,
          and ferlins. MCTPs are the only membrane-bound C2
          domain proteins that contain two functional TMRs. MCTPs
          are unique in that they bind Ca2+ but not
          phospholipids. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-II topology.
          Length = 127

 Score = 35.8 bits (83), Expect = 5e-04
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 8  PYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEV 45
           YV++   + GQ+   K+T  K + LNPV+NE  VF V
Sbjct: 23 AYVELD--FDGQK---KRTRTKPKDLNPVWNEKLVFNV 55


>gnl|CDD|176067 cd08685, C2_RGS-like, C2 domain of the Regulator Of G-Protein
          Signaling (RGS) family.  This CD contains members of
          the regulator of G-protein signaling (RGS) family. RGS
          is a GTPase activating protein which inhibits G-protein
          mediated signal transduction. The protein is largely
          cytosolic, but G-protein activation leads to
          translocation of this protein to the plasma membrane. A
          nuclear form of this protein has also been described,
          but its sequence has not been identified. There are
          multiple alternatively spliced transcript variants in
          this family with some members having additional domains
          (ex. PDZ and RGS) downstream of the C2 domain. The C2
          domain was first identified in PKC. C2 domains fold
          into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 119

 Score = 34.7 bits (80), Expect = 0.001
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          + YVK+ L    +   ++KT     + NP+++E+F F+V   N       LL+  W++++
Sbjct: 33 NSYVKISLSPDKEVRFRQKTSTVPDSANPLFHETFSFDV---NERDYQKRLLVTVWNKLS 89

Query: 67 KNEKIFF 73
          K+     
Sbjct: 90 KSRDSGL 96


>gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian
          uncoordinated) proteins.  C2-like domains are thought
          to be involved in phospholipid binding in a Ca2+
          independent manner in both Unc13 and Munc13.
          Caenorabditis elegans Unc13 has a central domain with
          sequence similarity to PKC, which includes C1 and
          C2-related domains. Unc13 binds phorbol esters and DAG
          with high affinity in a phospholipid manner.  Mutations
          in Unc13 results in abnormal neuronal connections and
          impairment in cholinergic neurotransmission in the
          nematode.  Munc13 is the mammalian homolog which are
          expressed in the brain.  There are 3 isoforms
          (Munc13-1, -2, -3) and are thought to play a role in
          neurotransmitter release and are hypothesized to be
          high-affinity receptors for phorbol esters.  Unc13 and
          Munc13 contain both C1 and C2 domains.  There are two
          C2 related domains present, one central and one at the
          carboxyl end.  Munc13-1 contains a third C2-like
          domain.  Munc13 interacts with syntaxin, synaptobrevin,
          and synaptotagmin suggesting a role for these as
          scaffolding proteins. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the second C2 repeat, C2B, and has a
          type-II topology.
          Length = 127

 Score = 34.1 bits (78), Expect = 0.003
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFE 44
          DPYV V +   G+   KK+T    + LNPV+NE F FE
Sbjct: 23 DPYVTVQV---GK--TKKRTKTIPQNLNPVWNEKFHFE 55


>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple
          C2 domain and Transmembrane region Proteins (MCTP).
          MCTPs are involved in Ca2+ signaling at the membrane.
          MCTP is composed of a variable N-terminal sequence,
          three C2 domains, two transmembrane regions (TMRs), and
          a short C-terminal sequence.  It is one of four protein
          classes that are anchored to membranes via a
          transmembrane region; the others being synaptotagmins,
          extended synaptotagmins, and ferlins. MCTPs are the
          only membrane-bound C2 domain proteins that contain two
          functional TMRs. MCTPs are unique in that they bind
          Ca2+ but not phospholipids. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-II topology.
          Length = 121

 Score = 33.4 bits (77), Expect = 0.004
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 4/39 (10%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEV 45
          DPYVK    Y G+ V K KT  K   LNPV++E F   +
Sbjct: 22 DPYVKFK--YGGKTVYKSKTIYK--NLNPVWDEKFTLPI 56


>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in
          Tricalbin-like proteins.  5 to 6 copies of the C2
          domain are present in Tricalbin, a yeast homolog of
          Synaptotagmin, which is involved in membrane
          trafficking and sorting.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the second C2 repeat, C2B, and has a
          type-II topology.
          Length = 111

 Score = 32.2 bits (74), Expect = 0.008
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 2  KDNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVP 46
          K   L PY ++YL   G+ V    T VKK+T NP +N S  F V 
Sbjct: 9  KTGLLSPYAELYL--NGKLV--YTTRVKKKTNNPSWNASTEFLVT 49


>gnl|CDD|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in
          Tricalbin-like proteins.  5 to 6 copies of the C2
          domain are present in Tricalbin, a yeast homolog of
          Synaptotagmin, which is involved in membrane
          trafficking and sorting.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the third C2 repeat, C2C, and has a
          type-II topology.
          Length = 120

 Score = 32.2 bits (74), Expect = 0.010
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLEL 57
          DPYV+V +      + K +T     TLNPV++E     V + N   ++LE+
Sbjct: 23 DPYVRVLV----NGIVKGRTVTISNTLNPVWDEVLYVPVTSPN-QKITLEV 68


>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present
          in Synaptotagmin-like proteins.  Synaptotagmin is a
          membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. Previously all synaptotagmins
          were thought to be calcium sensors in the regulation of
          neurotransmitter release and hormone secretion, but it
          has been shown that not all of them bind calcium.  Of
          the 17 identified synaptotagmins only 8 bind calcium
          (1-3, 5-7, 9, 10).  The function of the two C2 domains
          that bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-I topology.
          Length = 105

 Score = 31.8 bits (73), Expect = 0.011
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 5/51 (9%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLEL 57
           PYV++ +   G+    +K+ VK+RT NPV+ E F F V       + +E+
Sbjct: 22 SPYVELTV---GK--TTQKSKVKERTNNPVWEEGFTFLVRNPENQELEIEV 67


>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x)
           SDRs.  Ketoreductase, a module of the multidomain
           polyketide synthase (PKS), has 2 subdomains, each
           corresponding  to a SDR family monomer. The C-terminal
           subdomain catalyzes the NADPH-dependent reduction of the
           beta-carbonyl of a polyketide to a hydroxyl group, a
           step in the biosynthesis of polyketides, such as
           erythromycin. The N-terminal subdomain, an interdomain
           linker, is a truncated Rossmann fold which acts to
           stabilizes the catalytic subdomain. Unlike typical SDRs,
           the isolated domain does not oligomerize but is composed
           of 2 subdomains, each resembling an SDR monomer. The
           active site resembles that of typical SDRs, except that
           the usual positions of the catalytic Asn and Tyr are
           swapped, so that the canonical YXXXK motif changes to
           YXXXN. Modular PKSs are multifunctional structures in
           which the makeup recapitulates that found in (and may
           have evolved from) FAS. Polyketide synthesis also
           proceeds via the addition of 2-carbon units as in fatty
           acid synthesis. The complex SDR NADP-binding motif,
           GGXGXXG, is often present, but is not strictly conserved
           in each instance of the module. This subfamily includes
           both KR domains of the Bacillus subtilis Pks J,-L, and
           PksM, and all three KR domains of PksN, components of
           the megacomplex bacillaene synthase, which synthesizes
           the antibiotic bacillaene. SDRs are a functionally
           diverse family of oxidoreductases that have a single
           domain with a structurally conserved Rossmann fold
           (alpha/beta folding pattern with a central beta-sheet),
           an NAD(P)(H)-binding region, and a structurally diverse
           C-terminal region. Classical SDRs are typically about
           250 residues long, while extended SDRs are approximately
           350 residues. Sequence identity between different SDR
           enzymes are typically in the 15-30% range, but the
           enzymes share the Rossmann fold NAD-binding motif and
           characteristic NAD-binding and catalytic sequence
           patterns. These enzymes catalyze a wide range of
           activities including the metabolism of steroids,
           cofactors, carbohydrates, lipids, aromatic compounds,
           and amino acids, and act in redox sensing. Classical
           SDRs have an TGXXX[AG]XG cofactor binding motif and a
           YXXXK active site motif, with the Tyr residue of the
           active site motif serving as a critical catalytic
           residue (Tyr-151, human prostaglandin dehydrogenase
           (PGDH) numbering). In addition to the Tyr and Lys, there
           is often an upstream Ser (Ser-138, PGDH numbering)
           and/or an Asn (Asn-107, PGDH numbering) contributing to
           the active site; while substrate binding is in the
           C-terminal region, which determines specificity. The
           standard reaction mechanism is a 4-pro-S hydride
           transfer and proton relay involving the conserved Tyr
           and Lys, a water molecule stabilized by Asn, and
           nicotinamide. Extended SDRs have additional elements in
           the C-terminal region, and typically have a TGXXGXXG
           cofactor binding motif. Complex (multidomain) SDRs such
           as ketoreductase domains of fatty acid synthase have a
           GGXGXXG NAD(P)-binding motif and an altered active site
           motif (YXXXN). Fungal type KRs have a TGXXXGX(1-2)G
           NAD(P)-binding motif. Some atypical SDRs have lost
           catalytic activity and/or have an unusual NAD(P)-binding
           motif and missing or unusual active site residues.
           Reactions catalyzed within the SDR family include
           isomerization, decarboxylation, epimerization, C=N bond
           reduction, dehydratase activity, dehalogenation,
           Enoyl-CoA reduction, and carbonyl-alcohol
           oxidoreduction.
          Length = 436

 Score = 32.7 bits (75), Expect = 0.012
 Identities = 9/22 (40%), Positives = 13/22 (59%), Gaps = 1/22 (4%)

Query: 63  DRVTKNEKI-FFFFFSSSSSFF 83
            +   +E + FF  FSS S+FF
Sbjct: 327 AQALADEPLDFFVLFSSVSAFF 348


>gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present
           in Synaptotagmins 14 and 16.  Synaptotagmin 14 and 16
           are membrane-trafficking proteins in specific tissues
           outside the brain.   Both of these contain C-terminal
           tandem C2 repeats, but only Synaptotagmin 14 has an
           N-terminal transmembrane domain and a putative
           fatty-acylation site. Previously all synaptotagmins were
           thought to be calcium sensors in the regulation of
           neurotransmitter release and hormone secretion, but it
           has been shown that not all of them bind calcium and
           this is indeed the case here.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 124

 Score = 31.8 bits (73), Expect = 0.013
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 9/68 (13%)

Query: 12  VYLLYKGQRVAKKKTHVKKRTLNPVYNESFVF-EVPADNLDSVSLELLLLDWDRVTKN-- 68
           V L  K QR    KT V++   NPV+NE+F F  V  + L++++L   L   +R+ K   
Sbjct: 44  VLLPSKKQR---AKTKVQRGP-NPVFNETFTFSRVEPEELNNMALRFRLYGVERMRKERL 99

Query: 69  --EKIFFF 74
             EK+   
Sbjct: 100 IGEKVVPL 107


>gnl|CDD|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins.  A
          single C2 domain is found in calpains (EC 3.4.22.52, EC
          3.4.22.53), calcium-dependent, non-lysosomal cysteine
          proteases.  Caplains are classified as belonging to
          Clan CA by MEROPS and include six families: C1, C2,
          C10, C12, C28, and C47.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Length = 126

 Score = 31.9 bits (73), Expect = 0.016
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 5/37 (13%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVF 43
          DPYV +    +G+ V   ++ V+K TL+P ++   +F
Sbjct: 25 DPYVIIKC--EGESV---RSPVQKDTLSPEFDTQAIF 56


>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in
          Multiple C2 domain and Transmembrane region Proteins
          (MCTP); plant subset.  MCTPs are involved in Ca2+
          signaling at the membrane.  Plant-MCTPs are composed of
          a variable N-terminal sequence, four C2 domains, two
          transmembrane regions (TMRs), and a short C-terminal
          sequence.  It is one of four protein classes that are
          anchored to membranes via a transmembrane region; the
          others being synaptotagmins, extended synaptotagmins,
          and ferlins. MCTPs are the only membrane-bound C2
          domain proteins that contain two functional TMRs. MCTPs
          are unique in that they bind Ca2+ but not
          phospholipids. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the second C2 repeat, C2B, and has a
          type-II topology.
          Length = 121

 Score = 31.1 bits (71), Expect = 0.022
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 9/70 (12%)

Query: 2  KDNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLD 61
            N  DP V+V L   G      K  ++ RT NP +N+ F F    D L   +LE+ +  
Sbjct: 13 PANSNDPVVEVKL---GNYKGSTK-AIE-RTSNPEWNQVFAFS--KDRLQGSTLEVSV-- 63

Query: 62 WDRVTKNEKI 71
          WD+    +  
Sbjct: 64 WDKDKAKDDF 73


>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in
          Tricalbin-like proteins.  5 to 6 copies of the C2
          domain are present in Tricalbin, a yeast homolog of
          Synaptotagmin, which is involved in membrane
          trafficking and sorting.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-II topology.
          Length = 124

 Score = 31.4 bits (72), Expect = 0.023
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%)

Query: 1  MKDNELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESF 41
          +    +DPYV   +     R    +T VKK T NPV+NE+ 
Sbjct: 19 IIGGTVDPYVTFSI---SNRRELARTKVKKDTSNPVWNETK 56


>gnl|CDD|175982 cd04015, C2_plant_PLD, C2 domain present in plant phospholipase D
          (PLD).  PLD hydrolyzes terminal phosphodiester bonds in
          diester glycerophospholipids resulting in the
          degradation of phospholipids.  In vitro PLD transfers
          phosphatidic acid to primary alcohols.  In plants PLD
          plays a role in germination, seedling growth,
          phosphatidylinositol metabolism, and changes in
          phospholipid composition.  There is a single
          Ca(2+)/phospholipid-binding C2 domain in PLD. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 158

 Score = 31.5 bits (72), Expect = 0.024
 Identities = 18/35 (51%), Positives = 22/35 (62%), Gaps = 4/35 (11%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESF 41
          DPY  V L   G RVA+  T V + + NPV+NESF
Sbjct: 59 DPYATVDL--AGARVAR--TRVIENSENPVWNESF 89


>gnl|CDD|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human
          chromosome 21 open reading frame 25 (C21orf25) protein.
           The members in this cd are named after the Human
          C21orf25 which contains a single C2 domain.  Several
          other members contain a C1 domain downstream of the C2
          domain.  No other information on this protein is
          currently known. The C2 domain was first identified in
          PKC. C2 domains fold into an 8-standed beta-sandwich
          that can adopt 2 structural arrangements: Type I and
          Type II, distinguished by a circular permutation
          involving their N- and C-terminal beta strands. Many C2
          domains are Ca2+-dependent membrane-targeting modules
          that bind a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 126

 Score = 31.2 bits (71), Expect = 0.030
 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          +PY  + +    Q   K ++  +K T NP ++E F+FE     L   S ELL   +D   
Sbjct: 19 NPYCVLEMDEPPQ---KYQSSTQKNTSNPFWDEHFLFE-----LSPNSKELLFEVYDNGK 70

Query: 67 KNEKIFF 73
          K++  F 
Sbjct: 71 KSDSKFL 77


>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase
          A2 (cPLA2).  A single copy of the C2 domain is present
          in cPLA2 which releases arachidonic acid from membranes
          initiating the biosynthesis of potent inflammatory
          mediators such as prostaglandins, leukotrienes, and
          platelet-activating factor.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members of this cd have a type-II topology.
          Length = 119

 Score = 30.7 bits (70), Expect = 0.038
 Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRV 65
          D YV+++L        KK+T   K ++NPV+NE+F F + +  + +V LEL ++D D V
Sbjct: 22 DCYVELWLPTASDE--KKRTKTIKNSINPVWNETFEFRIQS-QVKNV-LELTVMDEDYV 76


>gnl|CDD|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine.  There
          are 2 copies of the C2 domain present in copine, a
          protein involved in membrane trafficking,
          protein-protein interactions, and perhaps even cell
          division and growth.  C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the second C2 repeat, C2B, and has a
          type-I topology.
          Length = 110

 Score = 30.2 bits (69), Expect = 0.043
 Identities = 20/76 (26%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 7  DPYVKVYLLYK-GQRVAKKKTHVKKRTLNPVYNESFVFEVPADNL----DSVSLELLLLD 61
          DP++++    + G  V   +T V K TLNPV+     F +P   L        +++ + D
Sbjct: 22 DPFLEISRQSEDGTWVLVYRTEVIKNTLNPVWKP---FTIPLQKLCNGDYDRPIKIEVYD 78

Query: 62 WDRVTKNEKIFFFFFS 77
          +D   K++ I  F  +
Sbjct: 79 YDSSGKHDLIGEFETT 94


>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple
          C2 domain and Transmembrane region Proteins (MCTP).
          MCTPs are involved in Ca2+ signaling at the membrane.
          MCTP is composed of a variable N-terminal sequence,
          three C2 domains, two transmembrane regions (TMRs), and
          a short C-terminal sequence.  It is one of four protein
          classes that are anchored to membranes via a
          transmembrane region; the others being synaptotagmins,
          extended synaptotagmins, and ferlins. MCTPs are the
          only membrane-bound C2 domain proteins that contain two
          functional TMRs. MCTPs are unique in that they bind
          Ca2+ but not phospholipids. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the second C2 repeat, C2B, and has a
          type-II topology.
          Length = 116

 Score = 29.9 bits (68), Expect = 0.065
 Identities = 29/72 (40%), Positives = 36/72 (50%), Gaps = 8/72 (11%)

Query: 1  MKDNEL-DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLL 59
          M DN L DPYVK  L   G    K K+ V  +TLNP + E F   +  D   S  LE+ +
Sbjct: 15 MDDNGLSDPYVKFRL---GNE--KYKSKVCSKTLNPQWLEQFDLHLFDDQ--SQILEIEV 67

Query: 60 LDWDRVTKNEKI 71
           D D   K+E I
Sbjct: 68 WDKDTGKKDEFI 79


>gnl|CDD|176045 cd08400, C2_Ras_p21A1, C2 domain present in RAS p21 protein
          activator 1 (RasA1).  RasA1 is a GAP1 (GTPase
          activating protein 1), a Ras-specific GAP member, which
          suppresses Ras function by enhancing the GTPase
          activity of Ras proteins resulting in the inactive
          GDP-bound form of Ras.  In this way it can control
          cellular proliferation and differentiation.  RasA1
          contains a C2 domain,  a Ras-GAP domain, a pleckstrin
          homology (PH)-like domain, a SH3 domain, and 2 SH2
          domains. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members here have a type-I topology.
          Length = 126

 Score = 29.3 bits (66), Expect = 0.11
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 8  PYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFE-VPADNLDSVSLELLLLDWDRVT 66
          PY  + L      V   +T V++   NPV++E FVF+ +P    D  S  + L +  + +
Sbjct: 24 PYCVISL----NEVKVARTKVRE-GPNPVWSEEFVFDDLPP---DVNSFTISLSNKAKRS 75

Query: 67 KNEKIFF 73
          K+ +I  
Sbjct: 76 KDSEIAE 82


>gnl|CDD|176068 cd08686, C2_ABR, C2 domain in the Active BCR (Breakpoint cluster
          region) Related protein.  The ABR protein is similar to
          the breakpoint cluster region protein.  It has homology
          to guanine nucleotide exchange proteins and
          GTPase-activating proteins (GAPs).  ABR is expressed
          primarily in the brain, but also includes non-neuronal
          tissues such as the heart.  It has been associated with
          human diseases such as Miller-Dieker syndrome in which
          mental retardation and malformations of the heart are
          present.  ABR contains a RhoGEF domain and a PH-like
          domain upstream of its C2 domain and a RhoGAP domain
          downstream of this domain.  A few members also contain
          a Bcr-Abl oncoprotein oligomerization domain at the
          very N-terminal end. Splice variants of ABR have been
          identified. ABR is found in a wide variety of organisms
          including chimpanzee, dog, mouse, rat, fruit fly, and
          mosquito. The C2 domain was first identified in PKC. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 118

 Score = 29.4 bits (66), Expect = 0.13
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 6/53 (11%)

Query: 18 GQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVTKNEK 70
          G  V K KT V + T  P +NE F  E+        S  L +L +++     K
Sbjct: 27 GYFVKKAKTRVCRDTTEPNWNEEFEIELEG------SQTLRILCYEKCYSKVK 73


>gnl|CDD|178538 PLN02952, PLN02952, phosphoinositide phospholipase C.
          Length = 599

 Score = 29.6 bits (66), Expect = 0.14
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 7   DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLEL 57
           D Y K+Y++      AKKKT + +    P +NE F F +    L  + +E+
Sbjct: 498 DFYTKMYIVGVPADNAKKKTKIIEDNWYPAWNEEFSFPLTVPELALLRIEV 548


>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present
          in Synaptotagmin-like proteins.  Synaptotagmin is a
          membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. Previously all synaptotagmins
          were thought to be calcium sensors in the regulation of
          neurotransmitter release and hormone secretion, but it
          has been shown that not all of them bind calcium.  Of
          the 17 identified synaptotagmins only 8 bind calcium
          (1-3, 5-7, 9, 10).  The function of the two C2 domains
          that bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the first C2 repeat,
          C2A, and has a type-I topology.
          Length = 128

 Score = 29.3 bits (66), Expect = 0.14
 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 7/63 (11%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVT 66
          DPY  + +   G    + KT     TLNP +N     E P  +  +  L+L+L D DR  
Sbjct: 25 DPYAILSV---GA--QRFKTQTIPNTLNPKWNYW--CEFPIFSAQNQLLKLILWDKDRFA 77

Query: 67 KNE 69
            +
Sbjct: 78 GKD 80


>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present
          in the putative elicitor-responsive gene.  In plants
          elicitor-responsive proteins are triggered in response
          to specific elicitor molecules such as glycolproteins,
          peptides, carbohydrates and lipids. A host of defensive
          responses are also triggered resulting in localized
          cell death.  Antimicrobial secondary metabolites, such
          as phytoalexins, or defense-related proteins, including
          pathogenesis-related (PR) proteins  are also produced. 
          There is a single C2 domain present here.  C2 domains
          fold into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. Members have a type-II topology.
          Length = 124

 Score = 29.2 bits (66), Expect = 0.15
 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 4/43 (9%)

Query: 4  NELDPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEVP 46
           ++DPYV   +  + Q   +K    K    NP +NE F F V 
Sbjct: 20 GKIDPYVI--IQCRTQE--RKSKVAKGDGRNPEWNEKFKFTVE 58


>gnl|CDD|176059 cd08677, C2A_Synaptotagmin-13, C2 domain.  Synaptotagmin is a
          membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. Synaptotagmin 13, a member of
          class 6 synaptotagmins, is located in the brain.  It
          functions are unknown. It, like synaptotagmins 8 and
          12, does not have any consensus Ca2+ binding sites.
          Previously all synaptotagmins were thought to be
          calcium sensors in the regulation of neurotransmitter
          release and hormone secretion, but it has been shown
          that not all of them bind calcium.  Of the 17
          identified synaptotagmins only 8 bind calcium (1-3,
          5-7, 9, 10).  The function of the two C2 domains that
          bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This CD contains the first C2 repeat,
          C2A, and has a type-I topology.
          Length = 118

 Score = 29.1 bits (65), Expect = 0.16
 Identities = 13/44 (29%), Positives = 23/44 (52%)

Query: 25 KTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVTKN 68
          +T +KK  L+  + E  VF +P +     +L L L   DR +++
Sbjct: 50 QTALKKLALHTQWEEELVFPLPEEESLDGTLTLTLRCCDRFSRH 93


>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes
          Regulated by Cold 2 (SRC2)-like proteins.  SRC2
          production is a response to pathogen infiltration.  The
          initial response of increased Ca2+ concentrations are
          coupled to downstream signal transduction pathways via
          calcium binding proteins.  SRC2 contains a single C2
          domain which localizes to the plasma membrane and is
          involved in Ca2+ dependent protein binding. C2 domains
          fold into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 125

 Score = 28.4 bits (64), Expect = 0.26
 Identities = 12/53 (22%), Positives = 20/53 (37%), Gaps = 5/53 (9%)

Query: 6  LDPYVKVYLLYKGQRVAKKKTHV-KKRTLNPVYNESFVFEVPADNLDSVSLEL 57
          +  Y  V++     +     T V +    NP +NE+  F +    L    L L
Sbjct: 21 MKVYAVVWI-DPSHKQ---STPVDRDGGTNPTWNETLRFPLDERLLQQGRLAL 69


>gnl|CDD|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2
          and RasA3.  RasA2 and RasA3 are GAP1s (GTPase
          activating protein 1s ), Ras-specific GAP members,
          which suppresses Ras function by enhancing the GTPase
          activity of Ras proteins resulting in the inactive
          GDP-bound form of Ras. In this way it can control
          cellular proliferation and differentiation.  RasA2 and
          RasA3 are both inositol
          1,3,4,5-tetrakisphosphate-binding proteins and contain
          an N-terminal C2 domain, a Ras-GAP domain, a
          pleckstrin-homology (PH) domain which localizes it to
          the plasma membrane, and Bruton's Tyrosine Kinase (BTK)
          a zinc binding domain. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-I topology.
          Length = 121

 Score = 28.6 bits (64), Expect = 0.27
 Identities = 8/22 (36%), Positives = 14/22 (63%)

Query: 25 KTHVKKRTLNPVYNESFVFEVP 46
          +T   +++L P + E F FE+P
Sbjct: 37 RTKTVEKSLCPFFGEDFYFEIP 58


>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple
          C2 domain and Transmembrane region Proteins (MCTP).
          MCTPs are involved in Ca2+ signaling at the membrane.
          The cds in this family contain multiple C2 domains as
          well as a C-terminal PRT domain.  It is one of four
          protein classes that are anchored to membranes via a
          transmembrane region; the others being synaptotagmins,
          extended synaptotagmins, and ferlins. MCTPs are the
          only membrane-bound C2 domain proteins that contain two
          functional TMRs. MCTPs are unique in that they bind
          Ca2+ but not phospholipids. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the third C2 repeat, C2C, and has a
          type-II topology.
          Length = 119

 Score = 28.0 bits (63), Expect = 0.33
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 22 AKKKTHVKKRTLNPVYNESFVFEVPADNLDSVSLELLLLDWDRVTKNE 69
          A+ +TH   +TLNP +N+ F F  P  ++  V LE+ + D D+  K E
Sbjct: 33 ARLQTHTIYKTLNPEWNKIFTF--PIKDIHDV-LEVTVYDEDKDKKPE 77


>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3
          ubiquitin ligase.  E3 ubiquitin ligase is part of the
          ubiquitylation mechanism responsible for controlling
          surface expression of membrane proteins.  The
          sequential action of several enzymes are involved:
          ubiquitin-activating enzyme E1, ubiquitin-conjugating
          enzyme E2, and ubiquitin-protein ligase E3 which is
          responsible for substrate recognition and promoting the
          transfer of ubiquitin to the target protein.  E3
          ubiquitin ligase is composed of an N-terminal C2
          domain, 4 WW domains, and a HECTc domain.  C2 domains
          fold into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 125

 Score = 28.0 bits (63), Expect = 0.39
 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESF 41
          DPYV+V     GQ    KKT V K+T NP +NE F
Sbjct: 23 DPYVEV--TVDGQ--PPKKTEVSKKTSNPKWNEHF 53


>gnl|CDD|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group.  C2
          domains were first identified in Protein Kinase C
          (PKC). C2 domains fold into an 8-standed beta-sandwich
          that can adopt 2 structural arrangements: Type I and
          Type II, distinguished by a circular permutation
          involving their N- and C-terminal beta strands. Many C2
          domains are Ca2+-dependent membrane-targeting modules
          that bind a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 111

 Score = 27.6 bits (62), Expect = 0.41
 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 15/67 (22%)

Query: 7  DPYVKV------YLLYKGQRVAKKKTHVKKRTLNPVYNES-FVFEVPADNLDSVSLELLL 59
          DPYV          LY         T + ++ LNPV+ E+ FV   P +      L   L
Sbjct: 24 DPYVTASFAKFGKPLYS--------TRIIRKDLNPVWEETWFVLVTPDEVKAGERLSCRL 75

Query: 60 LDWDRVT 66
           D DR T
Sbjct: 76 WDSDRFT 82


>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad
          ubiquitination-related factor (Smurf)-like proteins.  A
          single C2 domain is found in Smurf proteins,
          C2-WW-HECT-domain E3s, which play an important role in
          the downregulation of the TGF-beta signaling pathway.
          Smurf proteins also regulate cell shape, motility, and
          polarity by degrading small guanosine triphosphatases
          (GTPases). C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members here have type-II topology.
          Length = 123

 Score = 27.7 bits (62), Expect = 0.51
 Identities = 9/18 (50%), Positives = 12/18 (66%)

Query: 24 KKTHVKKRTLNPVYNESF 41
            T V K+TL+P +NE F
Sbjct: 35 HSTDVAKKTLDPKWNEHF 52


>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in
          Multiple C2 domain and Transmembrane region Proteins
          (MCTP); plant subset.  MCTPs are involved in Ca2+
          signaling at the membrane.  Plant-MCTPs are composed of
          a variable N-terminal sequence, four C2 domains, two
          transmembrane regions (TMRs), and a short C-terminal
          sequence.  It is one of four protein classes that are
          anchored to membranes via a transmembrane region; the
          others being synaptotagmins, extended synaptotagmins,
          and ferlins. MCTPs are the only membrane-bound C2
          domain proteins that contain two functional TMRs. MCTPs
          are unique in that they bind Ca2+ but not
          phospholipids. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the third C2 repeat, C2C, and has a
          type-II topology.
          Length = 150

 Score = 27.6 bits (62), Expect = 0.56
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 14/66 (21%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVF---EVPADNLDSVSLELLLLDWD 63
          + +VK  L   G +V + +   + R  NP +NE  +F   E   D+L  +S+E      D
Sbjct: 22 EVFVKAQL---GNQVLRTRP-SQTRNGNPSWNEELMFVAAEPFEDHL-ILSVE------D 70

Query: 64 RVTKNE 69
          RV  N+
Sbjct: 71 RVGPNK 76


>gnl|CDD|176041 cd08395, C2C_Munc13, C2 domain third repeat in Munc13 (mammalian
          uncoordinated) proteins.  C2-like domains are thought
          to be involved in phospholipid binding in a Ca2+
          independent manner in both Unc13 and Munc13.
          Caenorabditis elegans Unc13 has a central domain with
          sequence similarity to PKC, which includes C1 and
          C2-related domains. Unc13 binds phorbol esters and DAG
          with high affinity in a phospholipid manner.  Mutations
          in Unc13 results in abnormal neuronal connections and
          impairment in cholinergic neurotransmission in the
          nematode.  Munc13 is the mammalian homolog which are
          expressed in the brain.  There are 3 isoforms
          (Munc13-1, -2, -3) and are thought to play a role in
          neurotransmitter release and are hypothesized to be
          high-affinity receptors for phorbol esters.  Unc13 and
          Munc13 contain both C1 and C2 domains.  There are two
          C2 related domains present, one central and one at the
          carboxyl end.  Munc13-1 contains a third C2-like
          domain.  Munc13 interacts with syntaxin, synaptobrevin,
          and synaptotagmin suggesting a role for these as
          scaffolding proteins.C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the third C2 repeat, C2C, and has a
          type-II topology.
          Length = 120

 Score = 27.4 bits (61), Expect = 0.57
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 6/40 (15%)

Query: 8  PYVKVYLLYKGQRVAKKK----THVKKRTLNPVYNESFVF 43
          P+V+V L+  G  ++ KK    T  K    +P YNE+F F
Sbjct: 22 PFVEVNLI--GPHLSDKKRKFATKSKNNNWSPKYNETFQF 59


>gnl|CDD|214833 smart00822, PKS_KR, This enzymatic domain is part of bacterial
           polyketide synthases.  It catalyses the first step in
           the reductive modification of the beta-carbonyl centres
           in the growing polyketide chain. It uses NADPH to reduce
           the keto group to a hydroxy group.
          Length = 180

 Score = 26.7 bits (60), Expect = 1.3
 Identities = 6/22 (27%), Positives = 10/22 (45%), Gaps = 1/22 (4%)

Query: 63  DRVTKNEKI-FFFFFSSSSSFF 83
             +T +  + FF  FSS +   
Sbjct: 120 HELTADLPLDFFVLFSSIAGVL 141


>gnl|CDD|132882 cd07025, Peptidase_S66, LD-Carboxypeptidase, a serine protease,
          includes microcin C7 self immunity protein.
          LD-carboxypeptidase (Muramoyltetrapeptide
          carboxypeptidase; EC 3.4.17.13; Merops family S66;
          initially described as Carboxypeptidase II) family also
          includes the microcin c7 self-immunity protein (MccF)
          as well as uncharacterized proteins including
          hypothetical proteins. LD-carboxypeptidase hydrolyzes
          the amide bond that links the dibasic amino acids to
          C-terminal  D-amino acids. The physiological substrates
          of LD-carboxypeptidase are tetrapeptide fragments (such
          as UDP-MurNAc-tetrapeptides) that are produced when
          bacterial cell walls are degraded; they contain an
          L-configured residue (L-lysine or meso-diaminopimelic
          acid residue) as the penultimate residue and D-alanine
          as the ultimate residue.  A possible role of
          LD-carboxypeptidase is in peptidoglycan recycling
          whereby the resulting tripeptide (precursor for murein
          synthesis) can be reconverted into peptidoglycan by
          attachment of preformed D-Ala-D-Ala dipeptides. Some
          enzymes possessing LD-carboxypeptidase activity also
          act as LD-transpeptidase by replacing the terminal
          D-Ala with another D-amino acid. MccF contributes to
          self-immunity towards microcin C7 (MccC7), a
          ribosomally encoded peptide antibiotic that contains a
          phosphoramidate linkage to adenosine monophosphate at
          its C-terminus. Its possible biological role is to
          defend producer cells against exogenous microcin from
          re-entering after having been exported.  It is
          suggested that MccF is involved in microcin degradation
          or sequestration in the periplasm.
          Length = 282

 Score = 26.8 bits (60), Expect = 1.5
 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 1/21 (4%)

Query: 54 SLELL-LLDWDRVTKNEKIFF 73
          +  LL  LD+D +  N KIF 
Sbjct: 75 ANRLLPYLDYDLIRANPKIFV 95


>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein;
            Provisional.
          Length = 2102

 Score = 26.6 bits (59), Expect = 1.5
 Identities = 7/25 (28%), Positives = 13/25 (52%), Gaps = 2/25 (8%)

Query: 24   KKTHVKKRTLNPVYNESFV--FEVP 46
            ++T V   + +P + E F   F+ P
Sbjct: 2013 RQTKVVSHSSSPEWKEGFTWAFDSP 2037


>gnl|CDD|237164 PRK12664, PRK12664, putative monovalent cation/H+ antiporter
          subunit D; Reviewed.
          Length = 527

 Score = 26.6 bits (59), Expect = 1.5
 Identities = 13/37 (35%), Positives = 17/37 (45%), Gaps = 1/37 (2%)

Query: 52 SVSLELLLLDWDRVTKN-EKIFFFFFSSSSSFFFLII 87
           + L LLL DW     N + + F   S S +  FL I
Sbjct: 19 FIVLPLLLYDWSEPVYNLDLVLFIVLSFSLALIFLYI 55


>gnl|CDD|132883 cd07062, Peptidase_S66_mccF_like, Microcin C7 self-immunity
          protein determines resistance to exogenous microcin C7.
           Microcin C7 self-immunity protein (mccF): MccF, a
          homolog of the LD-carboxypeptidase family, mediates
          resistance against exogenously added microcin C7
          (MccC7), a ribosomally-encoded peptide antibiotic that
          contains a phosphoramidate linkage to adenosine
          monophosphate at its C-terminus. The plasmid-encoded
          mccF gene is transcribed in the opposite direction to
          the other five genes (mccA-E) and is required for the
          full expression of immunity but not for production. The
          catalytic triad residues (Ser, His, Glu) of
          LD-carboxypeptidase are also conserved in MccF,
          strongly suggesting that MccF shares the hydrolytic
          activity with LD-carboxypeptidases. Substrates of MccF
          have not been deduced, but could likely be microcin C7
          precursors. The possible role of MccF is to defend
          producer cells against exogenous microcin from
          re-entering after having been exported.  It is
          suggested that MccF is involved in microcin degradation
          or sequestration in the periplasm.
          Length = 308

 Score = 26.4 bits (59), Expect = 1.7
 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 1/21 (4%)

Query: 54 SLELL-LLDWDRVTKNEKIFF 73
          S ELL  LD++ + KN KIF 
Sbjct: 79 SNELLPYLDYELIKKNPKIFI 99


>gnl|CDD|237915 PRK15123, PRK15123, lipopolysaccharide core heptose(I) kinase RfaP;
           Provisional.
          Length = 268

 Score = 26.5 bits (59), Expect = 1.7
 Identities = 11/32 (34%), Positives = 15/32 (46%), Gaps = 2/32 (6%)

Query: 31  RTLNPVYNESFVFEVPADNLDSVSLELLLLDW 62
           R  NP    SF+  +  D   ++SLE    DW
Sbjct: 101 RGSNPATRTSFI--ITEDLAPTISLEDYCADW 130


>gnl|CDD|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine.  There are
          2 copies of the C2 domain present in copine, a protein
          involved in membrane trafficking, protein-protein
          interactions, and perhaps even cell division and
          growth.  C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-I topology.
          Length = 120

 Score = 26.0 bits (58), Expect = 2.0
 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 2/40 (5%)

Query: 7  DPYVKVYLLYKGQRVAKK--KTHVKKRTLNPVYNESFVFE 44
          DP+V VY+   G     +  +T V K  LNP +  +F  +
Sbjct: 22 DPFVVVYVKTGGSGQWVEIGRTEVIKNNLNPDFVTTFTVD 61


>gnl|CDD|216847 pfam02016, Peptidase_S66, LD-carboxypeptidase.
          Muramoyl-tetrapeptide carboxypeptidase hydrolyses a
          peptide bond between a di-basic amino acid and the
          C-terminal D-alanine in the tetrapeptide moiety in
          peptidoglycan. This cleaves the bond between an L- and
          a D-amino acid. The function of this activity is in
          murein recycling. This family also includes the
          microcin c7 self-immunity protein. This family
          corresponds to Merops family S66.
          Length = 281

 Score = 26.0 bits (58), Expect = 2.4
 Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 1/21 (4%)

Query: 54 SLELL-LLDWDRVTKNEKIFF 73
          +  LL  LD+D +  N KIF 
Sbjct: 74 ANRLLPYLDYDLIRANPKIFV 94


>gnl|CDD|236549 PRK09528, lacY, galactoside permease; Reviewed.
          Length = 420

 Score = 26.0 bits (58), Expect = 2.5
 Identities = 10/17 (58%), Positives = 10/17 (58%)

Query: 71 IFFFFFSSSSSFFFLII 87
           FFFFF  SS F F  I
Sbjct: 19 FFFFFFIWSSWFSFFPI 35


>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family
          interacting proteins (FIP) class I.  Rab GTPases
          recruit various effector proteins to organelles and
          vesicles.  Rab11-family interacting proteins (FIPs) are
          involved in mediating the role of Rab11. FIPs can be
          divided into three classes: class I FIPs (Rip11a,
          Rip11b, RCP, and FIP2) which contain a C2 domain after
          N-terminus of the protein, class II FIPs (FIP3 and
          FIP4) which contain two EF-hands and a proline rich
          region, and class III FIPs (FIP1) which exhibits no
          homology to known protein domains. All FIP proteins
          contain a highly conserved, 20-amino acid motif at the
          C-terminus of the protein, known as Rab11/25 binding
          domain (RBD).  Class I FIPs are thought to bind to
          endocytic membranes via their C2 domain, which
          interacts directly with phospholipids. Class II FIPs do
          not have any membrane binding domains leaving much to
          speculate about the mechanism involving FIP3 and FIP4
          interactions with endocytic membranes. The members in
          this CD are class I FIPs.  The exact function of the
          Rab11 and FIP interaction is unknown, but there is
          speculation that it involves the role of forming a
          targeting complex that recruits a group of proteins
          involved in membrane transport to organelles. The C2
          domain was first identified in PKC. C2 domains fold
          into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins. Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain. C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 126

 Score = 25.9 bits (57), Expect = 2.6
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 23 KKKTHVKKRTLNPVYNESFVFEVP 46
          K  T VK++T +PV+ E   FE+P
Sbjct: 32 KYSTSVKEKTTSPVWKEECSFELP 55


>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin.  A
          single instance of the C2 domain is located C
          terminally in the intersectin protein.  Intersectin
          functions as a scaffolding protein, providing a link
          between the actin cytoskeleton and the components of
          endocytosis and plays a role in signal transduction. 
          In addition to C2, intersectin contains several
          additional domains including: Eps15 homology domains,
          SH3 domains, a RhoGEF domain, and a PH domain.  C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. The members here have topology I.
          Length = 136

 Score = 24.7 bits (54), Expect = 6.6
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 5/39 (12%)

Query: 7  DPYVKVYLLYKGQRVAKKKTHVKKRTLNPVYNESFVFEV 45
          DPY +V +        + KT V   TLNP +N S  F V
Sbjct: 37 DPYCEVSM-----GSQEHKTKVVSDTLNPKWNSSMQFFV 70


>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal
          Ingression 1 (Inn1) proteins.  Saccharomyces cerevisiae
          Inn1 associates with the contractile actomyosin ring at
          the end of mitosis and is needed for cytokinesis. The
          C2 domain of Inn1, located at the N-terminus, is
          required for ingression of the plasma membrane. The
          C-terminus is relatively unstructured and contains
          eight PXXP motifs that are thought to mediate
          interaction of Inn1 with other proteins with SH3
          domains in the cytokinesis proteins Hof1 (an F-BAR
          protein) and Cyk3 (whose overexpression can restore
          primary septum formation in Inn1Delta cells) as well as
          recruiting Inn1 to the bud-neck by binding to Cyk3.
          Inn1 and Cyk3 appear to cooperate in activating chitin
          synthase Chs2 for primary septum formation, which
          allows coordination of actomyosin ring contraction with
          ingression of the cleavage furrow. It is thought that
          the C2 domain of Inn1 helps to preserve the link
          between the actomyosin ring and the plasma membrane,
          contributing both to membrane ingression, as well as to
          stability of the contracting ring. Additionally, Inn1
          might induce curvature of the plasma membrane adjacent
          to the contracting ring, thereby promoting ingression
          of the membrane. It has been shown that the C2 domain
          of human synaptotagmin induces curvature in target
          membranes and thereby contributes to fusion of these
          membranes with synaptic vesicles. The C2 domain was
          first identified in PKC. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins. Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin1.  However,
          there are a few exceptions to this including RIM
          isoforms and some splice variants of piccolo/aczonin
          and intersectin which only have a single C2 domain. C2
          domains with a calcium binding region have negatively
          charged residues, primarily aspartates, that serve as
          ligands for calcium ions.
          Length = 118

 Score = 24.1 bits (53), Expect = 8.1
 Identities = 13/45 (28%), Positives = 19/45 (42%), Gaps = 10/45 (22%)

Query: 7  DPYVKVYLLYKGQRVA--KKKTHVKKRT-LNPVYNESFVFEVPAD 48
          DPY  +       R+    KKT    R   +P ++E   FE+  D
Sbjct: 23 DPYCVL-------RIGGVTKKTKTDFRGGQHPEWDEELRFEITED 60


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.324    0.140    0.406 

Gapped
Lambda     K      H
   0.267   0.0845    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,447,990
Number of extensions: 361803
Number of successful extensions: 793
Number of sequences better than 10.0: 1
Number of HSP's gapped: 751
Number of HSP's successfully gapped: 114
Length of query: 87
Length of database: 10,937,602
Length adjustment: 55
Effective length of query: 32
Effective length of database: 8,498,132
Effective search space: 271940224
Effective search space used: 271940224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (24.0 bits)