Diaphorina citri psyllid: psy12861


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
HNDLPWNIRKFIHNHLVNFNLSSDLSVTEPWSKSSWSHTDLPRLRKGMVGAQFWSAYVPCSSQHMDAVQITMEQVDVIRRFTELYSDDLKLVTSAQGKDILIVFFVVCSTAKGLEDVSHYPDLLAALLDHPTWTETQVKKLAGLNFLRVLSKAEQESGRLSPNATRVYSNLLSSFHLYATGMVGAQFWSAYVPCSSQHMDAVQITMEQVDVIRRFTELYSDDLKLVTSAQGKDIGVTLMALNDGIVMVSFYSLYLTCSLNSSIDDVIAHLDHIKNVAGEDHVGLGAGYDGIN
cccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHccccccEEEEEECccccccccHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHcccEEEEccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHccccEEEEcccHHHcccccccccccccccHHHHHHHHcccEEEEEcccccccccccccHHHHHHHHHHHHHHHcccEEEEcccccccc
HNDLPWNIRKFIHNHLVNFNLSSDLSVTEPWSKSSWSHTDLPRLRKGMVGAQFWSAYVPCSSQHMDAVQITMEQVDVIRRFTELYSDDLKLVTSAQGKDILIVFFVVCSTAKGLEDVSHYPDLLAALLDHPTWTETQVKKLAGLNFLRVLSKAEQESGRLSPNATRVYSNLLSSFHLYATGMVGAQFWSAYVPCSSQHMDAVQITMEQVDVIRRFTELYSDDLKLVTSAQGKDIGVTLMALNDGIVMVSFYSLYLTCSLNSSIDDVIAHLDHIKNVAGEDHVGLGAGYDGIN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HNDLPWNIRKFIHNHLVNFNLSSDLSVTEPWSKSSWSHTDLPRLRKGMVGAQFWSAYVPCSSQHMDAVQITMEQVDVIRRFTELYSDDLKLVTSAQGKDILIVFFVVCSTAKGLEDVSHYPDLLAALLDHPTWTETQVKKLAGLNFLRVLSKAEQESGRLSPNATRVYSNLLSSFHLYATGMVGAQFWSAYVPCSSQHMDAVQITMEQVDVIRRFTELYSDDLKLVTSAQGKDIGVTLMALNDGIVMVSFYSLYLTCSLNSSIDDVIAHLDHIKNVAGEDHVGLGAGYDGIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dipeptidase 1 Hydrolyzes a wide range of dipeptides. Implicated in the renal metabolism of glutathione and its conjugates. Converts leukotriene D4 to leukotriene E4; it may play an important role in the regulation of leukotriene activity.confidentP31428
Dipeptidase 1 Hydrolyzes a wide range of dipeptides. Implicated in the renal metabolism of glutathione and its conjugates. Converts leukotriene D4 to leukotriene E4; it may play an important role in the regulation of leukotriene activity.confidentP16444

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0016999 [BP]antibiotic metabolic processprobableGO:0009987, GO:0017144, GO:0008150, GO:0008152, GO:0044237
GO:0070573 [MF]metallodipeptidase activityprobableGO:0016787, GO:0003824, GO:0016805, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008235, GO:0008237
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0035690 [BP]cellular response to drugprobableGO:0051716, GO:0050896, GO:0009987, GO:0042493, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0050667 [BP]homocysteine metabolic processprobableGO:0044238, GO:0044710, GO:0000096, GO:1901564, GO:0006575, GO:0006082, GO:0006520, GO:0044237, GO:0071704, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0009987, GO:1901605, GO:0044281
GO:0072341 [MF]modified amino acid bindingprobableGO:0043168, GO:0031406, GO:0043167, GO:0003674, GO:0005488, GO:0016597

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ID7, chain A
Confidence level:very confident
Coverage over the Query: 1-198,218-223,236-292
View the alignment between query and template
View the model in PyMOL
Template: 3ID7, chain A
Confidence level:very confident
Coverage over the Query: 172-286
View the alignment between query and template
View the model in PyMOL