RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy12865
         (227 letters)



>gnl|CDD|241394 cd13240, PH1_Kalirin_Trio_like, Triple functional domain pleckstrin
           homology pleckstrin homology (PH) domain, repeat 1.
           RhoGEFs, Kalirin and Trio, the mammalian homologs of
           Drosophila Trio and Caenorhabditis elegans UNC-73
           regulate a novel step in secretory granule maturation.
           Their signaling modulates the extent to which regulated
           cargo enter and remain in the regulated secretory
           pathway. This allows for fine tuning of peptides
           released by a single secretory cell type with impaired
           signaling leading to pathological states. Trio plays an
           essential role in regulating the actin cytoskeleton
           during axonal guidance and branching. Kalirin and Trio
           are encoded by separate genes in mammals and by a single
           one in invertebrates. Kalirin and Trio share the same
           complex multidomain structure and display several splice
           variants. The longest Kalirin and Trio proteins have a
           Sec14 domain, a stretch of spectrin repeats, a
           RhoGEF(DH)/PH cassette (also called GEF1), an SH3
           domain, a second RhoGEF(DH)/PH cassette (also called
           GEF2), a second SH3 domain, Ig/FNIII domains, and a
           kinase domain. The first RhoGEF(DH)/PH cassette
           catalyzes exchange on Rac1 and RhoG while the second
           RhoGEF(DH)/PH cassette is specific for RhoA. Kalirin and
           Trio are closely related to p63RhoGEF and have PH
           domains of similar function. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.not conserved
           across all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinases,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, cytoskeletal associated molecules,
           and in lipid associated enzymes.
          Length = 123

 Score =  121 bits (305), Expect = 3e-35
 Identities = 47/61 (77%), Positives = 52/61 (85%)

Query: 2   KGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQET 61
           K +LMTSELGVTEHIEGD CKFA+WTGR P SD +I+LKASSLE KQ WVK+LREVIQE 
Sbjct: 63  KSKLMTSELGVTEHIEGDPCKFALWTGRVPTSDNKIVLKASSLEVKQEWVKKLREVIQER 122

Query: 62  Y 62
            
Sbjct: 123 I 123



 Score = 47.3 bits (113), Expect = 3e-07
 Identities = 21/36 (58%), Positives = 23/36 (63%), Gaps = 5/36 (13%)

Query: 104 SGNTTDSD-----KASSLEAKQLWVKRLREVIQETY 134
           +G    SD     KASSLE KQ WVK+LREVIQE  
Sbjct: 88  TGRVPTSDNKIVLKASSLEVKQEWVKKLREVIQERI 123



 Score = 44.2 bits (105), Expect = 5e-06
 Identities = 17/22 (77%), Positives = 18/22 (81%)

Query: 151 ASSLEAKQLWVKRLREVIQETY 172
           ASSLE KQ WVK+LREVIQE  
Sbjct: 102 ASSLEVKQEWVKKLREVIQERI 123


>gnl|CDD|241261 cd01227, PH_Dbs, DBL's big sister protein pleckstrin homology (PH)
           domain.  Dbs (also called MCF2-transforming
           sequence-like protein 2) is a guanine nucleotide
           exchange factor (GEF), which contains spectrin repeats,
           a rhoGEF (DH) domain and a PH domain. The Dbs PH domain
           participates in binding to both the Cdc42 and RhoA
           GTPases. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 132

 Score = 48.4 bits (115), Expect = 2e-07
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 5/58 (8%)

Query: 2   KGRLMTSELGVTEHIEGDECKFAVW-TGRAPISDCRILLKASSLEAKQLWVKRLREVI 58
           K  L  S +G+TE+++GD  KF +W  GR  +     +++A + E K  WV  +R+V+
Sbjct: 76  KNSLKMSAVGITENVKGDNKKFEIWYNGREEV----YIIQAPTPEIKAAWVNEIRKVL 129


>gnl|CDD|241393 cd13239, PH_Obscurin, Obscurin pleckstrin homology (PH) domain.
           Obscurin (also called Obscurin-RhoGEF; Obscurin-myosin
           light chain kinase/Obscurin-MLCK) is a giant muscle
           protein that is concentrated at the peripheries of
           Z-disks and M-lines. It binds small ankyrin I, a
           component of the sarcoplasmic reticulum (SR) membrane.
           It is associated with the contractile apparatus through
           binding with titin and sarcomeric myosin. It plays
           important roles in the organization and assembly of the
           myofibril and the SR. Obscurin has been observed as
           alternatively-spliced isoforms. The major isoform in
           sleletal muscle, approximately 800 kDa in size, is
           composed of many adhesion modules and signaling domains.
           It harbors 49 Ig and 2 FNIII repeats at the N-terminues,
           a complex middle region with additional Ig domains, an
           IQ motif, and a conserved SH3 domain near RhoGEF and PH
           domains, and a non-modular C-terminus with
           phosphorylation motifs. The obscurin gene also encodes
           two kinase domains, which are not part of the 800 kDa
           form of the protein, but is part of smaller spliced
           products that present in heart muscle. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 125

 Score = 48.2 bits (115), Expect = 2e-07
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 2   KGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQET 61
           K ++  +++ V + +EGD+  F +W  R   S  +  L+A ++  K  WVK +R++ Q T
Sbjct: 67  KNKMKLNDIDVNDTVEGDDRAFELWHER-EDSVRKYTLQARTIIVKNSWVKEIRDIQQRT 125


>gnl|CDD|241396 cd13242, PH_puratrophin-1, Puratrophin-1 pleckstrin homology (PH)
           domain.  Puratrophin-1 (also called Purkinje cell
           atrophy-associated protein 1 or PLEKHG4/Pleckstrin
           homology domain-containing family G member 4) contains a
           spectrin repeat, a RhoGEF (DH) domain, and a PH domain.
           It is thought to function in intracellular signaling and
           cytoskeleton dynamics at the Golgi. Puratrophin-1 is
           expressed in kidney, Leydig cells in the testis,
           epithelial cells in the prostate gland and Langerhans
           islet in the pancreas. A single nucleotide substitution
           in the puratrophin-1 gene were once thought to result in
           autosomal dominant cerebellar ataxia (ADCA), but now it
           has been demonstrated that this ataxia is a result of
           defects in the BEAN gene. Puratrophin contains a domain
           architecture similar to that of Dbl family members Dbs
           and Trio. Dbs is a guanine nucleotide exchange factor
           (GEF), which contains spectrin repeats, a RhoGEF (DH)
           domain and a PH domain. The Dbs PH domain participates
           in binding to both the Cdc42 and RhoA GTPases. Trio
           plays an essential role in regulating the actin
           cytoskeleton during axonal guidance and branching. Trio
           is a multidomain signaling protein that contains two
           RhoGEF(DH)-PH domains in tandem. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 136

 Score = 40.7 bits (96), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 2   KGRLMTSELGVTEHIEGDE-CKFAVWTGRAPISDCRILLKASSLEAKQLWV 51
           K  + T+++G+TE++ GD   KF +W  R    D   +L+A+S E K+ W 
Sbjct: 73  KHSIKTADIGLTENV-GDSGLKFEIWFRRRKSRDT-YILQATSPEIKEAWT 121


>gnl|CDD|241395 cd13241, PH2_Kalirin_Trio_p63RhoGEF, p63RhoGEF pleckstrin homology
           (PH) domain, repeat 2.  The guanine nucleotide exchange
           factor p63RhoGEF is an effector of the heterotrimeric G
           protein, Galphaq and linking Galphaq-coupled receptors
           (GPCRs) to the activation of RhoA. The Dbl(DH) and PH
           domains of p63RhoGEF interact with the effector-binding
           site and the C-terminal region of Galphaq and appear to
           relieve autoinhibition of the catalytic DH domain by the
           PH domain. Trio, Duet, and p63RhoGEF are shown to
           constitute a family of Galphaq effectors that appear to
           activate RhoA both in vitro and in intact cells. Dbs is
           a guanine nucleotide exchange factor (GEF), which
           contains spectrin repeats, a rhoGEF (DH) domain and a PH
           domain. The Dbs PH domain participates in binding to
           both the Cdc42 and RhoA GTPases. Trio plays an essential
           role in regulating the actin cytoskeleton during axonal
           guidance and branching. Trio is a multidomain signaling
           protein that contains two RhoGEF(DH)-PH domains in
           tandem. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 140

 Score = 40.3 bits (95), Expect = 1e-04
 Identities = 14/58 (24%), Positives = 32/58 (55%)

Query: 2   KGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQ 59
           K  +  +++ + E+++GD C+FA+ +          +L+A S E +Q WV  + +++ 
Sbjct: 68  KNSIKVNKMSLEENVDGDPCRFALRSRDPNKPGESFVLQAPSPEIRQEWVDTINQILD 125


>gnl|CDD|241397 cd13243, PH_PLEKHG1_G2_G3, Pleckstrin homology domain-containing
           family G members 1, 2, and 3 pleckstrin homology (PH)
           domain.  PLEKHG1 (also called ARHGEF41), PLEKHG2 (also
           called ARHGEF42 or CLG/common-site lymphoma/leukemia
           guanine nucleotide exchange factor2), and PLEKHG3 (also
           called ARHGEF43) have RhoGEF DH/double-homology domains
           in tandem with a PH domain which is involved in
           phospholipid binding. They function as a guanine
           nucleotide exchange factor (GEF) and are involved in the
           regulation of Rho protein signal transduction. Mutations
           in PLEKHG1 have been associated panic disorder (PD), an
           anxiety disorder characterized by panic attacks and
           anticipatory anxiety. PH domains have diverse functions,
           but in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 147

 Score = 34.6 bits (80), Expect = 0.015
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 2   KGRLMTSELGVTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVIQE 60
           K  +M S L + E I  D   F V          +  L+A +LE K+LW + L+ +I E
Sbjct: 90  KTHIMCSNLMLVESIPKDPLSFQVL--PFDNPKAQYTLQAKNLEQKRLWTQHLKRLILE 146


>gnl|CDD|241437 cd13283, PH_GPBP, Goodpasture antigen binding protein Pleckstrin
          homology (PH) domain.  The GPBP (also called Collagen
          type IV alpha-3-binding protein/hCERT; START
          domain-containing protein 11/StARD11; StAR-related
          lipid transfer protein 11) is a kinase that
          phosphorylates an N-terminal region of the alpha 3
          chain of type IV collagen, which is commonly known as
          the goodpasture antigen. Its splice variant the
          ceramide transporter (CERT) mediates the cytosolic
          transport of ceramide. There have been additional
          splice variants identified, but all of them function as
          ceramide transport proteins. GPBP and CERT both contain
          an N-terminal PH domain, followed by a serine rich
          domain, and a C-terminal START domain. However, GPBP
          has an additional serine rich domain just upstream of
          its START domain. They are members of the oxysterol
          binding protein (OSBP) family which includes OSBP,
          OSBP-related proteins (ORP), Goodpasture antigen
          binding protein (GPBP), and Four phosphate adaptor
          protein 1 (FAPP1). They have a wide range of purported
          functions including sterol transport, cell cycle
          control, pollen development and vessicle transport from
          Golgi recognize both PI lipids and ARF proteins. PH
          domains have diverse functions, but in general are
          involved in targeting proteins to the appropriate
          cellular location or in the interaction with a binding
          partner. They share little sequence conservation, but
          all have a common fold, which is electrostatically
          polarized. Less than 10% of PH domains bind
          phosphoinositide phosphates (PIPs) with high affinity
          and specificity. PH domains are distinguished from
          other PIP-binding domains by their specific
          high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 100

 Score = 31.8 bits (73), Expect = 0.067
 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 6/44 (13%)

Query: 12 VTEHIEGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLR 55
          +  H E DEC+F V        D    L+A S E +Q WV  L 
Sbjct: 51 IKPH-EFDECRFDVSVN-----DSVWYLRAESPEERQRWVDALE 88


>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain.  Domain commonly found
           in eukaryotic signalling proteins. The domain family
           possesses multiple functions including the abilities to
           bind inositol phosphates, and various proteins. PH
           domains have been found to possess inserted domains
           (such as in PLC gamma, syntrophins) and to be inserted
           within other domains. Mutations in Brutons tyrosine
           kinase (Btk) within its PH domain cause X-linked
           agammaglobulinaemia (XLA) in patients. Point mutations
           cluster into the positively charged end of the molecule
           around the predicted binding site for
           phosphatidylinositol lipids.
          Length = 102

 Score = 30.2 bits (68), Expect = 0.29
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 8/62 (12%)

Query: 2   KGRLMTSELGVTEHIEGDECK----FAVWTGRAPISDCRILLKASSLEAKQLWVKRLREV 57
           KG +  S   V E  + D  K    F + T         +LL+A S E ++ WV+ LR+ 
Sbjct: 45  KGSIDLSGCTVREAPDPDSSKKPHCFEIKTS----DRKTLLLQAESEEEREKWVEALRKA 100

Query: 58  IQ 59
           I 
Sbjct: 101 IA 102


>gnl|CDD|241447 cd13293, PH_CpORP2-like, Cryptosporidium-like Oxysterol binding
          protein related protein 2 Pleckstrin homology (PH)
          domain.  There are 2 types of ORPs found in
          Cryptosporidium: CpORP1 and CpORP2. Cryptosporium
          differs from other apicomplexans like Plasmodium,
          Toxoplasma, and Eimeria which possess only a single
          long-type ORP consisting of an N-terminal PH domain
          followed by a C-terminal ligand binding (LB) domain.
          CpORP2 is like this, but CpORP1 differs and has a
          truncated N-terminus resulting in only having a LB
          domain present. The exact functions of these proteins
          are largely unknown though CpORP1 is thought to be
          involved in lipid transport across the parasitophorous
          vacuole membrane. Oxysterol binding proteins are a
          multigene family that is conserved in yeast, flies,
          worms, mammals and plants. In general OSBPs and ORPs
          have been found to be involved in the transport and
          metabolism of cholesterol and related lipids in
          eukaryotes. They all contain a C-terminal oxysterol
          binding domain, and most contain an N-terminal PH
          domain. OSBP PH domains bind to membrane
          phosphoinositides and thus likely play an important
          role in intracellular targeting. They are members of
          the oxysterol binding protein (OSBP) family which
          includes OSBP, OSBP-related proteins (ORP), Goodpasture
          antigen binding protein (GPBP), and Four phosphate
          adaptor protein 1 (FAPP1). They have a wide range of
          purported functions including sterol transport, cell
          cycle control, pollen development and vessicle
          transport from Golgi recognize both PI lipids and ARF
          proteins. PH domains have diverse functions, but in
          general are involved in targeting proteins to the
          appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 88

 Score = 29.2 bits (66), Expect = 0.46
 Identities = 11/38 (28%), Positives = 18/38 (47%), Gaps = 5/38 (13%)

Query: 19 DECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLRE 56
          D  +  + TG       ++ L+ASS+E K  W   L+ 
Sbjct: 54 DPLRIIINTG-----TNQLHLRASSVEEKLKWYNALKY 86


>gnl|CDD|215766 pfam00169, PH, PH domain.  PH stands for pleckstrin homology.
          Length = 101

 Score = 29.4 bits (66), Expect = 0.61
 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 4/42 (9%)

Query: 17  EGDECKFAVWTGRAPISDCRILLKASSLEAKQLWVKRLREVI 58
              +  F + TG         LL+A S E ++ WVK +R  I
Sbjct: 63  GKRKNCFEIRTGDRE----TFLLQAESEEERKEWVKAIRSAI 100


>gnl|CDD|241540 cd13389, PH1_FGD5_FGD6, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia proteins 5 and 6
           Pleckstrin Homology (PH) domain.  FGD5 regulates
           promotes angiogenesis of vascular endothelial growth
           factor (VEGF) in vascular endothelial cells, including
           network formation, permeability, directional movement,
           and proliferation. The specific function of FGD6 is
           unknown. In general, FGDs have a RhoGEF (DH) domain,
           followed by a PH domain, a FYVE domain and a C-terminal
           PH domain. All FGDs are guanine nucleotide exchange
           factors that activate the Rho GTPase Cdc42, an important
           regulator of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the PH
           domain is involved in intracellular targeting of the DH
           domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 28.8 bits (65), Expect = 0.98
 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 1/30 (3%)

Query: 32  ISDCR-ILLKASSLEAKQLWVKRLREVIQE 60
            S  R   L ASS E +  WVK L   I++
Sbjct: 81  ESTKRSFTLSASSAEERDEWVKALSRAIED 110


>gnl|CDD|226358 COG3838, VirB2, Type IV secretory pathway, VirB2 components
           (pilins) [Intracellular trafficking and secretion].
          Length = 108

 Score = 28.5 bits (64), Expect = 1.2
 Identities = 11/47 (23%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 123 VKRLREVIQETYFSSALPLAAPPKSPASASSLEAKQLWVKRLREVIQ 169
             R+R  I     + AL L A   +PA+A S   +   ++++ + + 
Sbjct: 5   SSRIRPAIAALIVAVALLLLAAFVAPAAAQSAPWET-PLQQILQSLT 50


>gnl|CDD|241445 cd13291, PH_ORP10_ORP11, Human Oxysterol binding protein (OSBP)
           related proteins 10 and 11 (ORP10 and ORP11) Pleckstrin
           homology (PH) domain.  Human ORP10 is involvedt in
           intracellular transport or organelle positioning and is
           proposed to function as a regulator of cellular lipid
           metabolism. Human ORP11 localizes at the Golgi-late
           endosome interface and is thought to form a dimer with
           ORP9 functioning as an intracellular lipid sensor or
           transporter. Both ORP10 and ORP11 contain a N-terminal
           PH domain, a FFAT motif (two phenylalanines in an acidic
           tract), and a C-terminal OSBP-related domain. Oxysterol
           binding proteins are a multigene family that is
           conserved in yeast, flies, worms, mammals and plants. In
           general OSBPs and ORPs have been found to be involved in
           the transport and metabolism of cholesterol and related
           lipids in eukaryotes. They all contain a C-terminal
           oxysterol binding domain, and most contain an N-terminal
           PH domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 27.2 bits (61), Expect = 2.9
 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 2/35 (5%)

Query: 39  LKASSLEAKQLWVKRLREVIQETYFSSALPLAAPP 73
           L+A+  + +Q WV RLR V +  + + A+  + P 
Sbjct: 75  LRAADAKERQEWVNRLRAVAE--HHTEAIAKSNPS 107


>gnl|CDD|241279 cd01248, PH_PLC_ELMO1, Phospholipase C and Engulfment and cell
           motility protein 1 pleckstrin homology domain.  The
           C-terminal region of ELMO1, the PH domain and Pro-rich
           sequences, binds the SH3-containing region of DOCK2
           forming a intermolecular five-helix bundle allowing for
           DOCK mediated Rac1 activation. ELMO1, a mammalian
           homolog of C. elegans CED-12, contains an N-terminal
           RhoG-binding region, a ELMO domain, a PH domain, and a
           C-terminal sequence with three PxxP motifs. Specificaly,
           PLCs catalyze the cleavage of
           phosphatidylinositol-4,5-bisphosphate (PIP2) and result
           in the release of 1,2-diacylglycerol (DAG) and inositol
           1,4,5-triphosphate (IP3). These products trigger the
           activation of protein kinase C (PKC) and the release of
           Ca2+ from intracellular stores. There are fourteen kinds
           of mammalian phospholipase C which are are classified
           into six isotypes (beta, gamma, delta, epsilon, zeta,
           eta). All PLCs, except for PLCzeta, have a PH domain
           which is for most part N-terminally located, though
           lipid binding specificity is not conserved between them.
           In addition PLC gamma contains a split PH domain within
           its catalytic domain that is separated by 2 SH2 domains
           and a single SH3 domain. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 108

 Score = 26.9 bits (60), Expect = 4.0
 Identities = 20/81 (24%), Positives = 32/81 (39%), Gaps = 3/81 (3%)

Query: 47  KQLWVKRLREVIQETYFSSALPLAAPPKSPAKLKSRSNQPNMEDEDNCDRGSLASYGSGN 106
            Q+  +  ++  ++     +      P    K   R  + N   E+ C   S+  YGS N
Sbjct: 28  TQITWESSKKKSEKKSIDISDIKEVRPGKDTKGFKRKKKSNKPKEERC--FSI-IYGSHN 84

Query: 107 TTDSDKASSLEAKQLWVKRLR 127
            T    A S +   LWV+ LR
Sbjct: 85  KTLDLVAPSEDEANLWVEGLR 105


>gnl|CDD|241432 cd13278, PH_Bud4, Bud4 Pleckstrin homology (PH) domain.  Bud4 is an
           anillin-like yeast protein involved in the formation and
           the disassembly of the double ring structure formed by
           the septins during cytokinesis. Bud4 acts with Bud3 and
           and in parallel with septin phosphorylation by the
           p21-activated kinase Cla4 and the septin-dependent
           kinase Gin4. Bud4 is regulated by the cyclin-dependent
           protein kinase Cdk1, the master regulator of cell cycle
           progression. Bud4 contains an anillin-like domain
           followed by a PH domain. In addition there are two
           consensus Cdk phosphorylation sites: one at the
           N-terminus and one right before the C-terminal PH
           domain. Anillins also have C-terminal PH domains. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 139

 Score = 26.8 bits (60), Expect = 5.6
 Identities = 9/24 (37%), Positives = 13/24 (54%)

Query: 36  RILLKASSLEAKQLWVKRLREVIQ 59
            I   A S E K  W  +L+EV++
Sbjct: 105 VIDFYADSKEEKADWYSKLKEVVE 128


>gnl|CDD|232853 TIGR00169, leuB, 3-isopropylmalate dehydrogenase.  Several NAD- or
           NADP-dependent dehydrogenases, including
           3-isopropylmalate dehydrogenase, tartrate dehydrogenase,
           and the dimeric forms of isocitrate dehydrogenase, share
           a nucleotide binding domain unrelated to that of lactate
           dehydrogenase and its homologs. These enzymes
           dehydrogenate their substates at a H-C-OH site adjacent
           to a H-C-COOH site; the latter carbon, now adjacent to a
           carbonyl group, readily decarboxylates.Among these
           decarboxylating dehydrogenases of hydroxyacids, overall
           sequence homology indicates evolutionary history rather
           than actual substrate or cofactor specifity, which may
           be toggled experimentally by replacement of just a few
           amino acids. 3-isopropylmalate dehydrogenase is an
           NAD-dependent enzyme and should have a sequence
           resembling HGSAPDI around residue 340. The subtrate
           binding loop should include a sequence resembling
           E[KQR]X(0,1)LLXXR around residue 115. Other contacts of
           importance are known from crystallography but not
           detailed here.This model will not find all
           isopropylmalate dehydrogenases; the enzyme from
           Sulfolobus sp. strain 7 is more similar to mitochondrial
           NAD-dependent isocitrate dehydrogenases than to other
           known isopropylmalate dehydrogenases and was omitted to
           improve the specificity of the model. It scores below
           the cutoff and below some enzymes known not to be
           isopropylmalate dehydrogenase [Amino acid biosynthesis,
           Pyruvate family].
          Length = 346

 Score = 27.4 bits (61), Expect = 7.0
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 108 TDSDKASSLEAKQLWVKRLREVIQE 132
           T  DKA+ LE+ +LW K + E+ +E
Sbjct: 181 TSVDKANVLESSRLWRKTVEEIAKE 205


>gnl|CDD|198413 cd10431, GHITM, Growth-hormone inducible transmembrane protein.
           GHITM appears to be ubiquitiously expressed in mammalian
           cells and expression has also been observed in various
           cancer cell lines. A cytoprotective function has been
           suggested. It is closely related to the BAX inhibitor
           (BI)-1 like family of small transmembrane proteins,
           which have been shown to have an antiapoptotic effect.
          Length = 264

 Score = 27.0 bits (60), Expect = 7.3
 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 3/56 (5%)

Query: 97  GSLASYGSGNTTDSDKASSLEAKQLWVKRLREVIQETYFSSALPLAAPPKSPASAS 152
           G+L  YG G    S +  ++E   +W + +R+ I  TY      L     +  + S
Sbjct: 14  GALCYYGLGL---SSEIGAIEKAVIWPQYVRDRIHSTYMYFGGSLGLTALAAVALS 66


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.310    0.125    0.360 

Gapped
Lambda     K      H
   0.267   0.0618    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 11,032,651
Number of extensions: 977643
Number of successful extensions: 631
Number of sequences better than 10.0: 1
Number of HSP's gapped: 625
Number of HSP's successfully gapped: 31
Length of query: 227
Length of database: 10,937,602
Length adjustment: 93
Effective length of query: 134
Effective length of database: 6,812,680
Effective search space: 912899120
Effective search space used: 912899120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 57 (26.0 bits)