Diaphorina citri psyllid: psy12905


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-
PEYCRTLDENEVTDNAFSLIFAFDEIVALGYRESVNLAQVRTFVEMDSHEEKVYQAVRKVCYLSRTCRSIGIAIVSRQFVEMTRARIEGLLAAFPKLMSSGKQHTFVETDSVRYVYQPLEKLYMLLITTKTSNILEDLETLRLFSRVIPEYCRTLDENEVTDNAFSLIFAFDEIVALGYRESVNLAQVRTFVEMDSHEEKVYQAVRKREAENKMREKAKELKRQRMESAKKFPKMGSGVGVGSNPYFGSSSYSSSPVTPVLESADISIRSSYIAQTVQREKKFRDIRIGRKSLENESYPLRIKIAQAILWKPAVSAKAMKLGSKSHDVESFVDQLKSEGEKVISGPALSKVSTLSSKIPTTNISNMDSYSIFLFTLVMQVPKPRSFRFENTLKTPFATSVNYHVNFSHLNKLLSIMFLLHRIHLRQEEQLIISVGRNGGIETFELHGLLTLRISDEKYGYFGDLGHRLQIHLRQEEQLIISVGRNGGIETFELHGLLTLRISDEKYGRIKVLLANKDTRGIQMQTHPNVDKELFKSKTEIGLKNPSKPFPLNNDIGVLKWRFTSTDESCLPLSINCWPSDNGSGGCDVNIEYELEHEEKELNQVTISIPLP
ccccccccHHHHHHHHcHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHcccccccccccEEECccEEEEEEEcccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHccccccEEEEcccEEEEccccccccEEEEEEEEEEEEccccccccccccccccEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEccccccEEEEEEcccccccccccccccccHHHHccccEEEEccccccccccccccEEEEEEcccccccccEEEEEEccccccccEEEEEEEEEccccccccEEEEEcccc
PEYCRTLDENEVTDNAFSLIFAFDEIVALGYRESVNLAQVRTFVEMDSHEEKVYQAVRKVCYLSRTCRSIGIAIVSRQFVEMTRARIEGLLAAFPKLMSSGKQHTFVETDSVRYVYQPLEKLYMLLITTKTSNILEDLETLRLFSRVIPEYCRTLDENEVTDNAFSLIFAFDEIVALGYRESVNLAQVRTFVEMDSHE***************************************************************************************************************************************************************************SIFLFTLVMQVPK*******NTLKTPFATSVNYHVNFSHLNKLLSIMFLLHRIHLRQEEQLIISVGRNGGIETFELHGLLTLRISDEKYGYFGDLGHRLQIHLRQEEQLIISVGRNGGIETFELHGLLTLRISDEKYGRIKVLLANKDTRGIQMQTHPNVDKELFKSKTEIGLKNPSKPFPLNNDIGVLKWRFTSTDESCLPLSINCWPSDNGSGGCDVNIEYELEHEEKELNQVTISIPLP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PEYCRTLDENEVTDNAFSLIFAFDEIVALGYRESVNLAQVRTFVEMDSHEEKVYQAVRKVCYLSRTCRSIGIAIVSRQFVEMTRARIEGLLAAFPKLMSSGKQHTFVETDSVRYVYQPLEKLYMLLITTKTSNILEDLETLRLFSRVIPEYCRTLDENEVTDNAFSLIFAFDEIVALGYRESVNLAQVRTFVEMDSHEEKVYQxxxxxxxxxxxxxxxxxxxxxxxxxxxxFPKMGSGVGVGSNPYFGSSSYSSSPVTPVLESADISIRSSYIAQTVQREKKFRDIRIGRKSLENESYPLRIKIAQAILWKPAVSAKAMKLGSKSHDVESFVDQLKSEGEKVISGPALSKVSTLSSKIPTTNISNMDSYSIFLFTLVMQVPKPRSFRFENTLKTPFATSVNYHVNFSHLNKLLSIMFLLHRIHLRQEEQLIISVGRNGGIETFELHGLLTLRISDEKYGYFGDLGHRLQIHLRQEEQLIISVGRNGGIETFELHGLLTLRISDEKYGRIKVLLANKDTRGIQMQTHPNVDKELFKSKTEIGLKNPSKPFPLNNDIGVLKWRFTSTDESCLPLSINCWPSDNGSGGCDVNIEYELEHEEKELNQVTISIPLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coatomer subunit delta The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.confidentQ66H80
Coatomer subunit delta The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.confidentQ5ZL57
Coatomer subunit delta The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.confidentQ5RA77

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006890 [BP]retrograde vesicle-mediated transport, Golgi to ERprobableGO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0030126 [CC]COPI vesicle coatprobableGO:0012506, GO:0043229, GO:0030117, GO:0005622, GO:0030135, GO:0043226, GO:0030137, GO:0005737, GO:0005575, GO:0030660, GO:0030663, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0031982, GO:0048475, GO:0005794, GO:0005798, GO:0030659, GO:0012505, GO:0043227, GO:0030120, GO:0031090, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VGL, chain M
Confidence level:very confident
Coverage over the Query: 61-199,307-312,438-439,463-611
View the alignment between query and template
View the model in PyMOL
Template: 2VGL, chain M
Confidence level:confident
Coverage over the Query: 2-52
View the alignment between query and template
View the model in PyMOL