Query         psy12909
Match_columns 63
No_of_seqs    111 out of 445
Neff          4.9 
Searched_HMMs 46136
Date          Fri Aug 16 22:51:16 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy12909.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12909hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0778|consensus               99.9 4.3E-28 9.4E-33  184.4   3.6   60    1-60    343-402 (511)
  2 COG5160 ULP1 Protease, Ulp1 fa  99.8   8E-22 1.7E-26  151.1   3.4   60    1-60    406-465 (578)
  3 PLN03189 Protease specific for  99.7 1.2E-18 2.6E-23  132.5   3.7   60    1-60    313-381 (490)
  4 PF02902 Peptidase_C48:  Ulp1 p  99.1 5.5E-11 1.2E-15   77.5   2.7   59    2-60     13-96  (216)
  5 KOG0779|consensus               98.2 6.1E-07 1.3E-11   69.8   1.3   47   14-60    392-450 (595)
  6 KOG3246|consensus               87.7    0.56 1.2E-05   33.5   2.7   18   42-59     82-99  (223)
  7 PF14162 YozD:  YozD-like prote  59.5       6 0.00013   22.8   1.2   13   22-34     15-27  (57)
  8 PF08644 SPT16:  FACT complex s  43.2      17 0.00036   24.3   1.6   15   47-61      6-20  (152)
  9 PF07582 AP_endonuc_2_N:  AP en  32.5      25 0.00055   19.8   1.0   13   24-36      5-17  (55)
 10 PF02180 BH4:  Bcl-2 homology r  26.9      49  0.0011   16.4   1.3   13   23-35     12-24  (27)
 11 KOG1852|consensus               25.7      37  0.0008   23.9   1.0   23   36-58    188-213 (223)
 12 PHA02763 hypothetical protein;  25.6      58  0.0013   20.7   1.8   28   31-58     65-100 (102)
 13 PHA02510 X gene X product; Rev  25.3      29 0.00062   22.5   0.4   15   24-38     37-51  (116)
 14 KOG1160|consensus               23.4      36 0.00078   27.4   0.7   18   25-42    238-263 (601)
 15 PF06135 DUF965:  Bacterial pro  20.2      63  0.0014   19.7   1.2   17   24-40     24-40  (79)

No 1  
>KOG0778|consensus
Probab=99.94  E-value=4.3e-28  Score=184.41  Aligned_cols=60  Identities=40%  Similarity=0.629  Sum_probs=58.7

Q ss_pred             CcchhhhhccCCCCCeEEEEccHhHHHHhhccccchhhhhhccCcccCCeEEEeccCCcc
Q psy12909          1 MALIMERSKEKTDLPRAYGFNTFFHSALAEHGYSRVKRWTKKLNPLFYNNHKIPTYILVV   60 (63)
Q Consensus         1 m~Li~eRs~~~~~~~~~~~fntFFy~~L~~~gy~~V~RWtk~vdlf~~d~I~iPI~~~~~   60 (63)
                      |+||+||+++++++|+||+||||||++|.++||++|+|||+++|||++|+|+||||+++|
T Consensus       343 m~ll~ers~~~~~yp~~h~FnTFFy~kL~~~gy~~VkRWTk~v~if~~d~i~vPIH~~vH  402 (511)
T KOG0778|consen  343 MELLKERSKKDSKYPKVHAFNTFFYTKLVGRGYAGVKRWTKKVDIFDKDIIFVPIHLGVH  402 (511)
T ss_pred             HHHHHhhccccCCCceEEEEechhhhhhhhcchHHHHhHhhccCccccceeEeeeecCce
Confidence            789999999999999999999999999999999999999999999999999999999987


No 2  
>COG5160 ULP1 Protease, Ulp1 family [Posttranslational modification, protein turnover, chaperones]
Probab=99.84  E-value=8e-22  Score=151.15  Aligned_cols=60  Identities=37%  Similarity=0.491  Sum_probs=56.2

Q ss_pred             CcchhhhhccCCCCCeEEEEccHhHHHHhhccccchhhhhhccCcccCCeEEEeccCCcc
Q psy12909          1 MALIMERSKEKTDLPRAYGFNTFFHSALAEHGYSRVKRWTKKLNPLFYNNHKIPTYILVV   60 (63)
Q Consensus         1 m~Li~eRs~~~~~~~~~~~fntFFy~~L~~~gy~~V~RWtk~vdlf~~d~I~iPI~~~~~   60 (63)
                      |++|.++++.....++||+||||||++|.+.||++|+|||+++|||++|+|+||||+..|
T Consensus       406 ~k~ls~~sk~~s~~~~vh~FnTFFYT~LsrrGy~gVrrW~kk~dif~~k~I~iPIni~~H  465 (578)
T COG5160         406 MKLLSKISKNTSKREQVHLFNTFFYTKLSRRGYSGVRRWTKKTDIFSKKYIFIPINISYH  465 (578)
T ss_pred             HHHHHHhccCcccccceEEeehhhHHHHHHHHhHHHHHHHhccCccccceEEEEecccce
Confidence            678888888877789999999999999999999999999999999999999999999765


No 3  
>PLN03189 Protease specific for SMALL UBIQUITIN-RELATED MODIFIER (SUMO); Provisional
Probab=99.74  E-value=1.2e-18  Score=132.51  Aligned_cols=60  Identities=25%  Similarity=0.427  Sum_probs=53.3

Q ss_pred             CcchhhhhccCCC-CCeEEEEccHhHHHHhhc----cccchhhhhhc----cCcccCCeEEEeccCCcc
Q psy12909          1 MALIMERSKEKTD-LPRAYGFNTFFHSALAEH----GYSRVKRWTKK----LNPLFYNNHKIPTYILVV   60 (63)
Q Consensus         1 m~Li~eRs~~~~~-~~~~~~fntFFy~~L~~~----gy~~V~RWtk~----vdlf~~d~I~iPI~~~~~   60 (63)
                      |+||.+|++.+++ .+++|+||||||++|.+.    ||++|+|||++    ++||++|+||||||.++|
T Consensus       313 m~LL~er~~~~p~~~~k~h~FNTFFytkL~~~~~~ygY~~VrRWTk~kKigv~Lfs~D~IFIPIh~n~H  381 (490)
T PLN03189        313 LELLKEREAREPKKFLKCHFFNTFFYKKLVSGKSGYDYKAVRRWTTQKKLGYHLIDCDKIFVPIHQEIH  381 (490)
T ss_pred             HHHHHHhhhcCcccccceEEEehHHHHHHhhcCCcCChHHHHHHhhhcccccccccCceEEeeeecCCe
Confidence            5789999877664 689999999999999986    89999999974    579999999999999877


No 4  
>PF02902 Peptidase_C48:  Ulp1 protease family, C-terminal catalytic domain This family belongs to family C48 of the peptidase classification.;  InterPro: IPR003653 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of proteins contain cysteine peptidases belonging to MEROPS peptidase family C48 (Ulp1 endopeptidase family, clan CE). The protein fold of the peptidase domain for members of this family resembles that of adenain, the type example for clan CE. This group of sequences also contains a number of hypothetical proteins, which have not yet been characterised, and non-peptidase homologues. These are proteins that have either been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of the peptidases in the family. The Ulp1 endopeptidase family contain the deubiquitinating enzymes (DUB) that can de-conjugate ubiquitin or ubiquitin-like proteins from ubiquitin-conjugated proteins. They can be classified in 3 families according to sequence homology [, ]: Ubiquitin carboxyl-terminal hydrolase (UCH) (see PDOC00127 from PROSITEDOC), Ubiquitin-specific processing protease (UBP) (see PDOC00750 from PROSITEDOC), and ubiquitin-like protease (ULP) specific for de-conjugating ubiquitin-like proteins. In contrast to the UBP pathway, which is very redundant (16 UBP enzymes in yeast), there are few ubiquitin-like proteases (only one in yeast, Ulp1). Ulp1 catalyses two critical functions in the SUMO/Smt3 pathway via its cysteine protease activity. Ulp1 processes the Smt3 C-terminal sequence (-GGATY) to its mature form (-GG), and it de-conjugates Smt3 from the lysine epsilon-amino group of the target protein []. Crystal structure of yeast Ulp1 bound to Smt3 [] revealed that the catalytic and interaction interface is situated in a shallow and narrow cleft where conserved residues recognise the Gly-Gly motif at the C-terminal extremity of Smt3 protein. Ulp1 adopts a novel architecture despite some structural similarity with other cysteine protease. The secondary structure is composed of seven alpha helices and seven beta strands. The catalytic domain includes the central alpha helix, beta-strands 4 to 6, and the catalytic triad (Cys-His-Asp). This profile is directed against the C-terminal part of ULP proteins that displays full proteolytic activity [].; GO: 0008234 cysteine-type peptidase activity, 0006508 proteolysis; PDB: 1EUV_A 2HL8_A 2HKP_A 2HL9_A 1XT9_A 2BKQ_C 2BKR_A 2IO1_E 1TH0_B 1TGZ_A ....
Probab=99.09  E-value=5.5e-11  Score=77.52  Aligned_cols=59  Identities=25%  Similarity=0.323  Sum_probs=46.5

Q ss_pred             cchhhhhcc-CCCCCeEEEEccHhHHHHh--------------------hccccchhhhhhcc---CcccCCeEEEeccC
Q psy12909          2 ALIMERSKE-KTDLPRAYGFNTFFHSALA--------------------EHGYSRVKRWTKKL---NPLFYNNHKIPTYI   57 (63)
Q Consensus         2 ~Li~eRs~~-~~~~~~~~~fntFFy~~L~--------------------~~gy~~V~RWtk~v---dlf~~d~I~iPI~~   57 (63)
                      ++|.++... ....+++++|+|||+++|.                    +..+.++.+|+++.   +++++|+|++|||.
T Consensus        13 ~~l~~~~~~~~~~~~~~~~~~~~f~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~i~iPin~   92 (216)
T PF02902_consen   13 EYLRHRLESENKNSKRVHFFSSFFYQKLTECFKQFKKDKERSKFKWNESKDFYNGVQRWFRKKNKKNLFDKDYIFIPINI   92 (216)
T ss_dssp             HHHHHHTCCTHHTSTTEEEE-THHHHHHH----HHHCCH--S-----HHHHCHHHCGGGGTTCCTSTGGGSSEEEEEEEE
T ss_pred             HHHHHhhccCccCCCcEEEECceeeeccccccccccccccccccchhhhhHhhhhhhhhhhccccccccccCEEEEEEec
Confidence            345544322 2235799999999999999                    56789999999987   99999999999999


Q ss_pred             -Ccc
Q psy12909         58 -LVV   60 (63)
Q Consensus        58 -~~~   60 (63)
                       +.|
T Consensus        93 ~~~H   96 (216)
T PF02902_consen   93 NNNH   96 (216)
T ss_dssp             TTTE
T ss_pred             hhhc
Confidence             765


No 5  
>KOG0779|consensus
Probab=98.17  E-value=6.1e-07  Score=69.79  Aligned_cols=47  Identities=21%  Similarity=0.288  Sum_probs=41.7

Q ss_pred             CCeEEEEccHhHHHHhh------------ccccchhhhhhccCcccCCeEEEeccCCcc
Q psy12909         14 LPRAYGFNTFFHSALAE------------HGYSRVKRWTKKLNPLFYNNHKIPTYILVV   60 (63)
Q Consensus        14 ~~~~~~fntFFy~~L~~------------~gy~~V~RWtk~vdlf~~d~I~iPI~~~~~   60 (63)
                      .+.+|+|+||||..|.+            .....+++|++.+|+|.+++|++|+|...|
T Consensus       392 s~~~h~f~tffyk~l~~~~~~~~~d~~~~~~~~~~~~~~~~~d~~~k~yi~~P~~E~~h  450 (595)
T KOG0779|consen  392 SNDRHIFSTFFYKRLCRKLRQKSNDQIQDNRAVRLRTWTRHFDLFNKDYVFVPTHERFH  450 (595)
T ss_pred             CcchhhhhhHHHhhhhhhhhhhhhhhhhccccCceeeeeeccccccceeEEecCchHhh
Confidence            47999999999999996            246789999999999999999999997654


No 6  
>KOG3246|consensus
Probab=87.72  E-value=0.56  Score=33.50  Aligned_cols=18  Identities=11%  Similarity=-0.221  Sum_probs=15.9

Q ss_pred             ccCcccCCeEEEeccCCc
Q psy12909         42 KLNPLFYNNHKIPTYILV   59 (63)
Q Consensus        42 ~vdlf~~d~I~iPI~~~~   59 (63)
                      ..|+++||+||+|||.+.
T Consensus        82 pl~l~~k~~iflpiNDn~   99 (223)
T KOG3246|consen   82 PLDLNDKDFIFLPINDNS   99 (223)
T ss_pred             hhhcCCCceEEEEecCCC
Confidence            359999999999999875


No 7  
>PF14162 YozD:  YozD-like protein
Probab=59.53  E-value=6  Score=22.82  Aligned_cols=13  Identities=38%  Similarity=0.789  Sum_probs=11.5

Q ss_pred             cHhHHHHhhcccc
Q psy12909         22 TFFHSALAEHGYS   34 (63)
Q Consensus        22 tFFy~~L~~~gy~   34 (63)
                      -|||..|...||-
T Consensus        15 efFy~eL~kRGyv   27 (57)
T PF14162_consen   15 EFFYHELVKRGYV   27 (57)
T ss_pred             HHHHHHHHHccCC
Confidence            4999999999983


No 8  
>PF08644 SPT16:  FACT complex subunit (SPT16/CDC68);  InterPro: IPR013953  Proteins in this entry are subunits the FACT complex; the FACT complex is a stable heterodimer in Saccharomyces cerevisiae (Baker's yeast) comprising Spt16p and Pob3p. The complex plays a role in transcription initiation and promotes binding of TATA-binding protein (TBP) to a TATA box in chromatin []; it also facilitates RNA Polymerase II transcription elongation through nucleosomes by destabilising and then reassembling nucleosome structure [, ].  The proteins in this entry are non-peptidase homologues belonging to MEROPS peptidase family M24 (clan MG). 
Probab=43.17  E-value=17  Score=24.33  Aligned_cols=15  Identities=20%  Similarity=0.089  Sum_probs=13.4

Q ss_pred             cCCeEEEeccCCccc
Q psy12909         47 FYNNHKIPTYILVVP   61 (63)
Q Consensus        47 ~~d~I~iPI~~~~~~   61 (63)
                      .++-|++||+...||
T Consensus         6 k~esvllPI~G~~VP   20 (152)
T PF08644_consen    6 KNESVLLPINGRPVP   20 (152)
T ss_pred             cCCEEEEEeCCcccc
Confidence            568899999999988


No 9  
>PF07582 AP_endonuc_2_N:  AP endonuclease family 2 C terminus;  InterPro: IPR011418 DNA damaging agents such as the anti-tumour drugs bleomycin and neocarzinostatin or those that generate oxygen radicals produce a variety of lesions in DNA. Amongst these is base-loss which forms apurinic/apyrimidinic (AP) sites or strand breaks with atypical 3' termini. DNA repair at the AP sites is initiated by specific endonuclease cleavage of the phosphodiester backbone. Such endonucleases are also generally capable of removing blocking groups from the 3' terminus of DNA strand breaks. AP endonucleases can be classified into two families based on sequence similarity []. This entry represents a highly-conserved sequence found at the C terminus of several apurinic/apyrimidinic (AP) endonucleases in a range of Gram-positive and Gram-negative bacteria. ; PDB: 3LMZ_A 2ZDS_D.
Probab=32.47  E-value=25  Score=19.77  Aligned_cols=13  Identities=46%  Similarity=0.554  Sum_probs=8.9

Q ss_pred             hHHHHhhccccch
Q psy12909         24 FHSALAEHGYSRV   36 (63)
Q Consensus        24 Fy~~L~~~gy~~V   36 (63)
                      |++.|.+.||+++
T Consensus         5 i~~~L~~~GYdG~   17 (55)
T PF07582_consen    5 IFSALREIGYDGW   17 (55)
T ss_dssp             HHHHHHHTT--SE
T ss_pred             HHHHHHHcCCCce
Confidence            6788999999763


No 10 
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=26.89  E-value=49  Score=16.40  Aligned_cols=13  Identities=23%  Similarity=0.585  Sum_probs=10.3

Q ss_pred             HhHHHHhhccccc
Q psy12909         23 FFHSALAEHGYSR   35 (63)
Q Consensus        23 FFy~~L~~~gy~~   35 (63)
                      |+--||.++||..
T Consensus        12 yi~yKLsQrgy~w   24 (27)
T PF02180_consen   12 YISYKLSQRGYVW   24 (27)
T ss_dssp             HHHHHHHHTTSTS
T ss_pred             HHHHHhhhcCCCC
Confidence            6677899999863


No 11 
>KOG1852|consensus
Probab=25.75  E-value=37  Score=23.92  Aligned_cols=23  Identities=30%  Similarity=0.326  Sum_probs=18.5

Q ss_pred             hhhhhh---ccCcccCCeEEEeccCC
Q psy12909         36 VKRWTK---KLNPLFYNNHKIPTYIL   58 (63)
Q Consensus        36 V~RWtk---~vdlf~~d~I~iPI~~~   58 (63)
                      ..|.|+   +.||.+++-++|||+.+
T Consensus       188 c~rft~~v~kynlms~e~livpi~~~  213 (223)
T KOG1852|consen  188 CHRFTKFVSKYNLMSKENLIVPILPN  213 (223)
T ss_pred             HHHHHHHHHhhhhccccceeeecCcc
Confidence            445554   67999999999999876


No 12 
>PHA02763 hypothetical protein; Provisional
Probab=25.58  E-value=58  Score=20.65  Aligned_cols=28  Identities=25%  Similarity=0.392  Sum_probs=23.2

Q ss_pred             ccccchhhhhh--------ccCcccCCeEEEeccCC
Q psy12909         31 HGYSRVKRWTK--------KLNPLFYNNHKIPTYIL   58 (63)
Q Consensus        31 ~gy~~V~RWtk--------~vdlf~~d~I~iPI~~~   58 (63)
                      .|+++|.-|..        ++|--.+++|.|=||..
T Consensus        65 SGFe~VEeWl~eArrLh~~~id~~ryeiivi~in~~  100 (102)
T PHA02763         65 SGFENVEEWLNEARRLHNDKIDPERYEIIVIWINGR  100 (102)
T ss_pred             cchhhHHHHHHHHHHHhcCCCChhheEEEEEEEcCc
Confidence            79999999984        47888899999888753


No 13 
>PHA02510 X gene X product; Reviewed
Probab=25.33  E-value=29  Score=22.48  Aligned_cols=15  Identities=33%  Similarity=0.607  Sum_probs=13.0

Q ss_pred             hHHHHhhccccchhh
Q psy12909         24 FHSALAEHGYSRVKR   38 (63)
Q Consensus        24 Fy~~L~~~gy~~V~R   38 (63)
                      ||..|...||+.|+.
T Consensus        37 ~y~~l~~~g~~~vk~   51 (116)
T PHA02510         37 FYRRLVNEGYDNVAD   51 (116)
T ss_pred             HHHhhhhhhHHHHHH
Confidence            788999999988875


No 14 
>KOG1160|consensus
Probab=23.42  E-value=36  Score=27.39  Aligned_cols=18  Identities=56%  Similarity=0.892  Sum_probs=14.3

Q ss_pred             HHHHhhccc------cch--hhhhhc
Q psy12909         25 HSALAEHGY------SRV--KRWTKK   42 (63)
Q Consensus        25 y~~L~~~gy------~~V--~RWtk~   42 (63)
                      |..|+..||      ++|  =||||.
T Consensus       238 ~~aLTKQGYkviGSHSGVKiCRWTKs  263 (601)
T KOG1160|consen  238 YKALTKQGYKVIGSHSGVKICRWTKS  263 (601)
T ss_pred             HHHHHhccceEeeccCCeeeeeechH
Confidence            999999998      444  489974


No 15 
>PF06135 DUF965:  Bacterial protein of unknown function (DUF965);  InterPro: IPR009309 This family consists of several hypothetical bacterial proteins. The function of the family is unknown.
Probab=20.18  E-value=63  Score=19.72  Aligned_cols=17  Identities=29%  Similarity=0.542  Sum_probs=13.3

Q ss_pred             hHHHHhhccccchhhhh
Q psy12909         24 FHSALAEHGYSRVKRWT   40 (63)
Q Consensus        24 Fy~~L~~~gy~~V~RWt   40 (63)
                      =|..|.++||.-|..-.
T Consensus        24 Vy~AL~EKGYnPinQiv   40 (79)
T PF06135_consen   24 VYAALEEKGYNPINQIV   40 (79)
T ss_pred             HHHHHHHcCCChHHHHH
Confidence            47899999998776543


Done!