Query psy12909
Match_columns 63
No_of_seqs 111 out of 445
Neff 4.9
Searched_HMMs 46136
Date Fri Aug 16 22:51:16 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy12909.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/12909hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG0778|consensus 99.9 4.3E-28 9.4E-33 184.4 3.6 60 1-60 343-402 (511)
2 COG5160 ULP1 Protease, Ulp1 fa 99.8 8E-22 1.7E-26 151.1 3.4 60 1-60 406-465 (578)
3 PLN03189 Protease specific for 99.7 1.2E-18 2.6E-23 132.5 3.7 60 1-60 313-381 (490)
4 PF02902 Peptidase_C48: Ulp1 p 99.1 5.5E-11 1.2E-15 77.5 2.7 59 2-60 13-96 (216)
5 KOG0779|consensus 98.2 6.1E-07 1.3E-11 69.8 1.3 47 14-60 392-450 (595)
6 KOG3246|consensus 87.7 0.56 1.2E-05 33.5 2.7 18 42-59 82-99 (223)
7 PF14162 YozD: YozD-like prote 59.5 6 0.00013 22.8 1.2 13 22-34 15-27 (57)
8 PF08644 SPT16: FACT complex s 43.2 17 0.00036 24.3 1.6 15 47-61 6-20 (152)
9 PF07582 AP_endonuc_2_N: AP en 32.5 25 0.00055 19.8 1.0 13 24-36 5-17 (55)
10 PF02180 BH4: Bcl-2 homology r 26.9 49 0.0011 16.4 1.3 13 23-35 12-24 (27)
11 KOG1852|consensus 25.7 37 0.0008 23.9 1.0 23 36-58 188-213 (223)
12 PHA02763 hypothetical protein; 25.6 58 0.0013 20.7 1.8 28 31-58 65-100 (102)
13 PHA02510 X gene X product; Rev 25.3 29 0.00062 22.5 0.4 15 24-38 37-51 (116)
14 KOG1160|consensus 23.4 36 0.00078 27.4 0.7 18 25-42 238-263 (601)
15 PF06135 DUF965: Bacterial pro 20.2 63 0.0014 19.7 1.2 17 24-40 24-40 (79)
No 1
>KOG0778|consensus
Probab=99.94 E-value=4.3e-28 Score=184.41 Aligned_cols=60 Identities=40% Similarity=0.629 Sum_probs=58.7
Q ss_pred CcchhhhhccCCCCCeEEEEccHhHHHHhhccccchhhhhhccCcccCCeEEEeccCCcc
Q psy12909 1 MALIMERSKEKTDLPRAYGFNTFFHSALAEHGYSRVKRWTKKLNPLFYNNHKIPTYILVV 60 (63)
Q Consensus 1 m~Li~eRs~~~~~~~~~~~fntFFy~~L~~~gy~~V~RWtk~vdlf~~d~I~iPI~~~~~ 60 (63)
|+||+||+++++++|+||+||||||++|.++||++|+|||+++|||++|+|+||||+++|
T Consensus 343 m~ll~ers~~~~~yp~~h~FnTFFy~kL~~~gy~~VkRWTk~v~if~~d~i~vPIH~~vH 402 (511)
T KOG0778|consen 343 MELLKERSKKDSKYPKVHAFNTFFYTKLVGRGYAGVKRWTKKVDIFDKDIIFVPIHLGVH 402 (511)
T ss_pred HHHHHhhccccCCCceEEEEechhhhhhhhcchHHHHhHhhccCccccceeEeeeecCce
Confidence 789999999999999999999999999999999999999999999999999999999987
No 2
>COG5160 ULP1 Protease, Ulp1 family [Posttranslational modification, protein turnover, chaperones]
Probab=99.84 E-value=8e-22 Score=151.15 Aligned_cols=60 Identities=37% Similarity=0.491 Sum_probs=56.2
Q ss_pred CcchhhhhccCCCCCeEEEEccHhHHHHhhccccchhhhhhccCcccCCeEEEeccCCcc
Q psy12909 1 MALIMERSKEKTDLPRAYGFNTFFHSALAEHGYSRVKRWTKKLNPLFYNNHKIPTYILVV 60 (63)
Q Consensus 1 m~Li~eRs~~~~~~~~~~~fntFFy~~L~~~gy~~V~RWtk~vdlf~~d~I~iPI~~~~~ 60 (63)
|++|.++++.....++||+||||||++|.+.||++|+|||+++|||++|+|+||||+..|
T Consensus 406 ~k~ls~~sk~~s~~~~vh~FnTFFYT~LsrrGy~gVrrW~kk~dif~~k~I~iPIni~~H 465 (578)
T COG5160 406 MKLLSKISKNTSKREQVHLFNTFFYTKLSRRGYSGVRRWTKKTDIFSKKYIFIPINISYH 465 (578)
T ss_pred HHHHHHhccCcccccceEEeehhhHHHHHHHHhHHHHHHHhccCccccceEEEEecccce
Confidence 678888888877789999999999999999999999999999999999999999999765
No 3
>PLN03189 Protease specific for SMALL UBIQUITIN-RELATED MODIFIER (SUMO); Provisional
Probab=99.74 E-value=1.2e-18 Score=132.51 Aligned_cols=60 Identities=25% Similarity=0.427 Sum_probs=53.3
Q ss_pred CcchhhhhccCCC-CCeEEEEccHhHHHHhhc----cccchhhhhhc----cCcccCCeEEEeccCCcc
Q psy12909 1 MALIMERSKEKTD-LPRAYGFNTFFHSALAEH----GYSRVKRWTKK----LNPLFYNNHKIPTYILVV 60 (63)
Q Consensus 1 m~Li~eRs~~~~~-~~~~~~fntFFy~~L~~~----gy~~V~RWtk~----vdlf~~d~I~iPI~~~~~ 60 (63)
|+||.+|++.+++ .+++|+||||||++|.+. ||++|+|||++ ++||++|+||||||.++|
T Consensus 313 m~LL~er~~~~p~~~~k~h~FNTFFytkL~~~~~~ygY~~VrRWTk~kKigv~Lfs~D~IFIPIh~n~H 381 (490)
T PLN03189 313 LELLKEREAREPKKFLKCHFFNTFFYKKLVSGKSGYDYKAVRRWTTQKKLGYHLIDCDKIFVPIHQEIH 381 (490)
T ss_pred HHHHHHhhhcCcccccceEEEehHHHHHHhhcCCcCChHHHHHHhhhcccccccccCceEEeeeecCCe
Confidence 5789999877664 689999999999999986 89999999974 579999999999999877
No 4
>PF02902 Peptidase_C48: Ulp1 protease family, C-terminal catalytic domain This family belongs to family C48 of the peptidase classification.; InterPro: IPR003653 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad []. This group of proteins contain cysteine peptidases belonging to MEROPS peptidase family C48 (Ulp1 endopeptidase family, clan CE). The protein fold of the peptidase domain for members of this family resembles that of adenain, the type example for clan CE. This group of sequences also contains a number of hypothetical proteins, which have not yet been characterised, and non-peptidase homologues. These are proteins that have either been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity of the peptidases in the family. The Ulp1 endopeptidase family contain the deubiquitinating enzymes (DUB) that can de-conjugate ubiquitin or ubiquitin-like proteins from ubiquitin-conjugated proteins. They can be classified in 3 families according to sequence homology [, ]: Ubiquitin carboxyl-terminal hydrolase (UCH) (see PDOC00127 from PROSITEDOC), Ubiquitin-specific processing protease (UBP) (see PDOC00750 from PROSITEDOC), and ubiquitin-like protease (ULP) specific for de-conjugating ubiquitin-like proteins. In contrast to the UBP pathway, which is very redundant (16 UBP enzymes in yeast), there are few ubiquitin-like proteases (only one in yeast, Ulp1). Ulp1 catalyses two critical functions in the SUMO/Smt3 pathway via its cysteine protease activity. Ulp1 processes the Smt3 C-terminal sequence (-GGATY) to its mature form (-GG), and it de-conjugates Smt3 from the lysine epsilon-amino group of the target protein []. Crystal structure of yeast Ulp1 bound to Smt3 [] revealed that the catalytic and interaction interface is situated in a shallow and narrow cleft where conserved residues recognise the Gly-Gly motif at the C-terminal extremity of Smt3 protein. Ulp1 adopts a novel architecture despite some structural similarity with other cysteine protease. The secondary structure is composed of seven alpha helices and seven beta strands. The catalytic domain includes the central alpha helix, beta-strands 4 to 6, and the catalytic triad (Cys-His-Asp). This profile is directed against the C-terminal part of ULP proteins that displays full proteolytic activity [].; GO: 0008234 cysteine-type peptidase activity, 0006508 proteolysis; PDB: 1EUV_A 2HL8_A 2HKP_A 2HL9_A 1XT9_A 2BKQ_C 2BKR_A 2IO1_E 1TH0_B 1TGZ_A ....
Probab=99.09 E-value=5.5e-11 Score=77.52 Aligned_cols=59 Identities=25% Similarity=0.323 Sum_probs=46.5
Q ss_pred cchhhhhcc-CCCCCeEEEEccHhHHHHh--------------------hccccchhhhhhcc---CcccCCeEEEeccC
Q psy12909 2 ALIMERSKE-KTDLPRAYGFNTFFHSALA--------------------EHGYSRVKRWTKKL---NPLFYNNHKIPTYI 57 (63)
Q Consensus 2 ~Li~eRs~~-~~~~~~~~~fntFFy~~L~--------------------~~gy~~V~RWtk~v---dlf~~d~I~iPI~~ 57 (63)
++|.++... ....+++++|+|||+++|. +..+.++.+|+++. +++++|+|++|||.
T Consensus 13 ~~l~~~~~~~~~~~~~~~~~~~~f~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~i~iPin~ 92 (216)
T PF02902_consen 13 EYLRHRLESENKNSKRVHFFSSFFYQKLTECFKQFKKDKERSKFKWNESKDFYNGVQRWFRKKNKKNLFDKDYIFIPINI 92 (216)
T ss_dssp HHHHHHTCCTHHTSTTEEEE-THHHHHHH----HHHCCH--S-----HHHHCHHHCGGGGTTCCTSTGGGSSEEEEEEEE
T ss_pred HHHHHhhccCccCCCcEEEECceeeeccccccccccccccccccchhhhhHhhhhhhhhhhccccccccccCEEEEEEec
Confidence 345544322 2235799999999999999 56789999999987 99999999999999
Q ss_pred -Ccc
Q psy12909 58 -LVV 60 (63)
Q Consensus 58 -~~~ 60 (63)
+.|
T Consensus 93 ~~~H 96 (216)
T PF02902_consen 93 NNNH 96 (216)
T ss_dssp TTTE
T ss_pred hhhc
Confidence 765
No 5
>KOG0779|consensus
Probab=98.17 E-value=6.1e-07 Score=69.79 Aligned_cols=47 Identities=21% Similarity=0.288 Sum_probs=41.7
Q ss_pred CCeEEEEccHhHHHHhh------------ccccchhhhhhccCcccCCeEEEeccCCcc
Q psy12909 14 LPRAYGFNTFFHSALAE------------HGYSRVKRWTKKLNPLFYNNHKIPTYILVV 60 (63)
Q Consensus 14 ~~~~~~fntFFy~~L~~------------~gy~~V~RWtk~vdlf~~d~I~iPI~~~~~ 60 (63)
.+.+|+|+||||..|.+ .....+++|++.+|+|.+++|++|+|...|
T Consensus 392 s~~~h~f~tffyk~l~~~~~~~~~d~~~~~~~~~~~~~~~~~d~~~k~yi~~P~~E~~h 450 (595)
T KOG0779|consen 392 SNDRHIFSTFFYKRLCRKLRQKSNDQIQDNRAVRLRTWTRHFDLFNKDYVFVPTHERFH 450 (595)
T ss_pred CcchhhhhhHHHhhhhhhhhhhhhhhhhccccCceeeeeeccccccceeEEecCchHhh
Confidence 47999999999999996 246789999999999999999999997654
No 6
>KOG3246|consensus
Probab=87.72 E-value=0.56 Score=33.50 Aligned_cols=18 Identities=11% Similarity=-0.221 Sum_probs=15.9
Q ss_pred ccCcccCCeEEEeccCCc
Q psy12909 42 KLNPLFYNNHKIPTYILV 59 (63)
Q Consensus 42 ~vdlf~~d~I~iPI~~~~ 59 (63)
..|+++||+||+|||.+.
T Consensus 82 pl~l~~k~~iflpiNDn~ 99 (223)
T KOG3246|consen 82 PLDLNDKDFIFLPINDNS 99 (223)
T ss_pred hhhcCCCceEEEEecCCC
Confidence 359999999999999875
No 7
>PF14162 YozD: YozD-like protein
Probab=59.53 E-value=6 Score=22.82 Aligned_cols=13 Identities=38% Similarity=0.789 Sum_probs=11.5
Q ss_pred cHhHHHHhhcccc
Q psy12909 22 TFFHSALAEHGYS 34 (63)
Q Consensus 22 tFFy~~L~~~gy~ 34 (63)
-|||..|...||-
T Consensus 15 efFy~eL~kRGyv 27 (57)
T PF14162_consen 15 EFFYHELVKRGYV 27 (57)
T ss_pred HHHHHHHHHccCC
Confidence 4999999999983
No 8
>PF08644 SPT16: FACT complex subunit (SPT16/CDC68); InterPro: IPR013953 Proteins in this entry are subunits the FACT complex; the FACT complex is a stable heterodimer in Saccharomyces cerevisiae (Baker's yeast) comprising Spt16p and Pob3p. The complex plays a role in transcription initiation and promotes binding of TATA-binding protein (TBP) to a TATA box in chromatin []; it also facilitates RNA Polymerase II transcription elongation through nucleosomes by destabilising and then reassembling nucleosome structure [, ]. The proteins in this entry are non-peptidase homologues belonging to MEROPS peptidase family M24 (clan MG).
Probab=43.17 E-value=17 Score=24.33 Aligned_cols=15 Identities=20% Similarity=0.089 Sum_probs=13.4
Q ss_pred cCCeEEEeccCCccc
Q psy12909 47 FYNNHKIPTYILVVP 61 (63)
Q Consensus 47 ~~d~I~iPI~~~~~~ 61 (63)
.++-|++||+...||
T Consensus 6 k~esvllPI~G~~VP 20 (152)
T PF08644_consen 6 KNESVLLPINGRPVP 20 (152)
T ss_pred cCCEEEEEeCCcccc
Confidence 568899999999988
No 9
>PF07582 AP_endonuc_2_N: AP endonuclease family 2 C terminus; InterPro: IPR011418 DNA damaging agents such as the anti-tumour drugs bleomycin and neocarzinostatin or those that generate oxygen radicals produce a variety of lesions in DNA. Amongst these is base-loss which forms apurinic/apyrimidinic (AP) sites or strand breaks with atypical 3' termini. DNA repair at the AP sites is initiated by specific endonuclease cleavage of the phosphodiester backbone. Such endonucleases are also generally capable of removing blocking groups from the 3' terminus of DNA strand breaks. AP endonucleases can be classified into two families based on sequence similarity []. This entry represents a highly-conserved sequence found at the C terminus of several apurinic/apyrimidinic (AP) endonucleases in a range of Gram-positive and Gram-negative bacteria. ; PDB: 3LMZ_A 2ZDS_D.
Probab=32.47 E-value=25 Score=19.77 Aligned_cols=13 Identities=46% Similarity=0.554 Sum_probs=8.9
Q ss_pred hHHHHhhccccch
Q psy12909 24 FHSALAEHGYSRV 36 (63)
Q Consensus 24 Fy~~L~~~gy~~V 36 (63)
|++.|.+.||+++
T Consensus 5 i~~~L~~~GYdG~ 17 (55)
T PF07582_consen 5 IFSALREIGYDGW 17 (55)
T ss_dssp HHHHHHHTT--SE
T ss_pred HHHHHHHcCCCce
Confidence 6788999999763
No 10
>PF02180 BH4: Bcl-2 homology region 4; InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope. Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon. All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=26.89 E-value=49 Score=16.40 Aligned_cols=13 Identities=23% Similarity=0.585 Sum_probs=10.3
Q ss_pred HhHHHHhhccccc
Q psy12909 23 FFHSALAEHGYSR 35 (63)
Q Consensus 23 FFy~~L~~~gy~~ 35 (63)
|+--||.++||..
T Consensus 12 yi~yKLsQrgy~w 24 (27)
T PF02180_consen 12 YISYKLSQRGYVW 24 (27)
T ss_dssp HHHHHHHHTTSTS
T ss_pred HHHHHhhhcCCCC
Confidence 6677899999863
No 11
>KOG1852|consensus
Probab=25.75 E-value=37 Score=23.92 Aligned_cols=23 Identities=30% Similarity=0.326 Sum_probs=18.5
Q ss_pred hhhhhh---ccCcccCCeEEEeccCC
Q psy12909 36 VKRWTK---KLNPLFYNNHKIPTYIL 58 (63)
Q Consensus 36 V~RWtk---~vdlf~~d~I~iPI~~~ 58 (63)
..|.|+ +.||.+++-++|||+.+
T Consensus 188 c~rft~~v~kynlms~e~livpi~~~ 213 (223)
T KOG1852|consen 188 CHRFTKFVSKYNLMSKENLIVPILPN 213 (223)
T ss_pred HHHHHHHHHhhhhccccceeeecCcc
Confidence 445554 67999999999999876
No 12
>PHA02763 hypothetical protein; Provisional
Probab=25.58 E-value=58 Score=20.65 Aligned_cols=28 Identities=25% Similarity=0.392 Sum_probs=23.2
Q ss_pred ccccchhhhhh--------ccCcccCCeEEEeccCC
Q psy12909 31 HGYSRVKRWTK--------KLNPLFYNNHKIPTYIL 58 (63)
Q Consensus 31 ~gy~~V~RWtk--------~vdlf~~d~I~iPI~~~ 58 (63)
.|+++|.-|.. ++|--.+++|.|=||..
T Consensus 65 SGFe~VEeWl~eArrLh~~~id~~ryeiivi~in~~ 100 (102)
T PHA02763 65 SGFENVEEWLNEARRLHNDKIDPERYEIIVIWINGR 100 (102)
T ss_pred cchhhHHHHHHHHHHHhcCCCChhheEEEEEEEcCc
Confidence 79999999984 47888899999888753
No 13
>PHA02510 X gene X product; Reviewed
Probab=25.33 E-value=29 Score=22.48 Aligned_cols=15 Identities=33% Similarity=0.607 Sum_probs=13.0
Q ss_pred hHHHHhhccccchhh
Q psy12909 24 FHSALAEHGYSRVKR 38 (63)
Q Consensus 24 Fy~~L~~~gy~~V~R 38 (63)
||..|...||+.|+.
T Consensus 37 ~y~~l~~~g~~~vk~ 51 (116)
T PHA02510 37 FYRRLVNEGYDNVAD 51 (116)
T ss_pred HHHhhhhhhHHHHHH
Confidence 788999999988875
No 14
>KOG1160|consensus
Probab=23.42 E-value=36 Score=27.39 Aligned_cols=18 Identities=56% Similarity=0.892 Sum_probs=14.3
Q ss_pred HHHHhhccc------cch--hhhhhc
Q psy12909 25 HSALAEHGY------SRV--KRWTKK 42 (63)
Q Consensus 25 y~~L~~~gy------~~V--~RWtk~ 42 (63)
|..|+..|| ++| =||||.
T Consensus 238 ~~aLTKQGYkviGSHSGVKiCRWTKs 263 (601)
T KOG1160|consen 238 YKALTKQGYKVIGSHSGVKICRWTKS 263 (601)
T ss_pred HHHHHhccceEeeccCCeeeeeechH
Confidence 999999998 444 489974
No 15
>PF06135 DUF965: Bacterial protein of unknown function (DUF965); InterPro: IPR009309 This family consists of several hypothetical bacterial proteins. The function of the family is unknown.
Probab=20.18 E-value=63 Score=19.72 Aligned_cols=17 Identities=29% Similarity=0.542 Sum_probs=13.3
Q ss_pred hHHHHhhccccchhhhh
Q psy12909 24 FHSALAEHGYSRVKRWT 40 (63)
Q Consensus 24 Fy~~L~~~gy~~V~RWt 40 (63)
=|..|.++||.-|..-.
T Consensus 24 Vy~AL~EKGYnPinQiv 40 (79)
T PF06135_consen 24 VYAALEEKGYNPINQIV 40 (79)
T ss_pred HHHHHHHcCCChHHHHH
Confidence 47899999998776543
Done!