BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy12936
(187 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3A9R|A Chain A, X-Ray Structures Of Bacillus Pallidus D-Arabinose
Isomerasecomplex With (4r)-2-Methylpentane-2,4-Diol
pdb|3A9R|B Chain B, X-Ray Structures Of Bacillus Pallidus D-Arabinose
Isomerasecomplex With (4r)-2-Methylpentane-2,4-Diol
pdb|3A9R|C Chain C, X-Ray Structures Of Bacillus Pallidus D-Arabinose
Isomerasecomplex With (4r)-2-Methylpentane-2,4-Diol
pdb|3A9S|A Chain A, X-Ray Structure Of Bacillus Pallidus D-Arabinose Isomerase
Complex With Glycerol
pdb|3A9S|B Chain B, X-Ray Structure Of Bacillus Pallidus D-Arabinose Isomerase
Complex With Glycerol
pdb|3A9S|C Chain C, X-Ray Structure Of Bacillus Pallidus D-Arabinose Isomerase
Complex With Glycerol
pdb|3A9T|A Chain A, X-Ray Structure Of Bacillus Pallidus D-Arabinose Isomerase
Complex With L-Fucitol
pdb|3A9T|B Chain B, X-Ray Structure Of Bacillus Pallidus D-Arabinose Isomerase
Complex With L-Fucitol
pdb|3A9T|C Chain C, X-Ray Structure Of Bacillus Pallidus D-Arabinose Isomerase
Complex With L-Fucitol
Length = 595
Score = 26.9 bits (58), Expect = 6.5, Method: Composition-based stats.
Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 6/71 (8%)
Query: 70 FTKVTLDSFLAWKKRKLK----EKSEAMTKAEEKKRSDFKAGRQVGLSGRDMFSFNPDLA 125
+ K + L W K K + + EE+K D++ ++ L RD+ N L
Sbjct: 227 YDKEEYERALKWVKENCKVGPDNNRDGFKRTEEQKEKDWEISVKMALIARDLMVGNKKL- 285
Query: 126 KDDMDEGDEAF 136
++M G+EA
Sbjct: 286 -EEMGYGEEAL 295
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.132 0.384
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,199,407
Number of Sequences: 62578
Number of extensions: 193959
Number of successful extensions: 368
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 360
Number of HSP's gapped (non-prelim): 20
length of query: 187
length of database: 14,973,337
effective HSP length: 93
effective length of query: 94
effective length of database: 9,153,583
effective search space: 860436802
effective search space used: 860436802
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 48 (23.1 bits)